3RX3A

Crystal structure of human aldose reductase complexed with sulindac
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx3A00
3MC5A 4GQGA 4F40A 3UG8A 2WZMA 1MI3A 4H8NA 1AFSA 2PDXA 4Q3MA 2FGBA 4XVDA 2ISFA 2PDNA 1RY0A 5KETA 3EB4A 4JTQA 4JQ3A 1VP5A 5LIKX 3M4HA 4PRRA 1MRQA 2NVDA 5JH1A 3UZWA 3LZ3A 2PDUA 1T40A 3N2TA 1EF3A 3MB9A 2HEJA 3UZXA 2IKIA 3B3DA 2PDYA 3V35A 4FA3A 2PD5A 4LBSA 4FZIA 3LQGA 4WRHA 5AZ0A 4LAUA 3WBYA 4XZHA 3RX4A 4GACA 2PDPA 4DZ5A 4GCAA 4LBRA 4DBUA 5AZ1A 4Q7BA 4GA8A 3R8HA 1S2CA 3ERPA 1VBJA 3LD5A 3R7MA 4AUBA 4ICCX 5HA7A 2PF8A 1X96A 3V0UA 1YE6A 1EL3A 5M2FX 3R58A 3F7JA 4WDWA 4OTKA 4PUUA 3O0KA 3Q65A 2PDKA 4GABA 3CAQA 2FVLA 4WEVX 1SM9A 3GHSA 1ZGDA 3EB3A 3R94A 4YVPA 3COTA 2FZDA 1PWLA 3GUGA 3ONCA 2PDCA 2INZA 3KRBA 1QRQA 2DV0A 3H7UA 1RY8A 1X97A 3WCZA 1S1RA 4EXAA 1YNPA 1R38A 2J8TA 4NKCA 4WDXA 4JQ2A 2BGQA 3UGRA 3G5EA 1ZSXA 3GHUA 2C91A 2PDHA 1AZ1A 3UFYA 2DUXA 3DN5A 3GHRA 3UP8A 4ASTA 2CLPA 2WZTA 4G5DA 3UYIA 2PDFA 2IQDA 1T41A 2ALRA 4JQAA 2R24A 1LWIA 3M64A 2FZ9A 4LB3A 3P2VA 4JQ1A 4WGHA 4L1XA 3LUTA 4PUWA 3N6QA 3LBOA 2PEVA 4JIRA 3S3GA 4XZMX 2A79A 3H4GA 1JEZA 4IJRA 4FALA 5C7HA 4XVEA 1PZ1A 4FAMA 3FX4A 1Z8AA 1ZQ5A 2ACQA 1XGDA 2FZBA 4WDTA 3D3FA 2PZNA 1Q13A 3V0SA 3WBXA 2PDJA 3CAVA 3Q67A 2F38A 1FRBA 2IKGA 3ONBA 4XAPA 1PWMA 2F2KA 4DBWA 3T42A 4YU1A 4HMNA 3G1RA 2IPFA 3UZZA 4I5XA 1AH3A 1HW6A 1Z3NA 1K8CA 3R6IA 4LAZA 5HNUA 1EKOA 2HE8A 3LENA 3V0TA 1US0A 4IJCA 3M0IA 4XO6A 5LIYX 1S1PA 1OG6A 1AH0A 2I16A 4ZFCA 3H7RA 1RALA 1PZ0A 3UWEA 1IEIA 4XZIA 3U2CA 2VDGA 3CMFA 4DBSA 3C3UA 1ADSA 1Z9AA 2PDLA 1ZUAX 4PRTA 4QXIA 4YVXA 3V36A 3BCJA 5LIWX 2PDIA 1X98A 4PMJA 2IKHA 2HDJA 2HVOA 4QBXA 4QR6A 3LEPA 3LN3A 3BURA 4JQ4A 4GQ0A 4HBKA 3BV7A 2IS7A 3WBWA 1IHIA 2HE5A 4XK2A 5HNTA 1A80A 3VXGA 2R9RA 3RX3A 1LQAA 5LIUX 4PR4A 3R43A 1YNQA 4YVVA 2PDQA 2ACRA 1EXBA 2PDGA 3NTYA 1C9WA 1MZRA 4WDUA 5LIXX 3O3RA 4L1WA 2ACSA 2I17A 2BP1A 3UZYA 2HV5A 4JIIX 4YS1A 4JTRA 4XZLX 4JIHA 1XJBA 4QX4A 3RX2A 4R9OA 1AZ2A 1M9HA 1QWKA 5DANA 1Z89A 2PDWA 3R8GA 3LQLA 3QKZA 2PFHA 4GIEA 4RPQA 4IGSA 2IPJA 3BUVA 2IPGA 4JTCA 1Q5MA 2INEA 4JTAA 3CV7A 1AH4A 3GHTA 1J96A 2ACUA 1S2AA 2HVNA 1YE4A 3DOPA 5JH2A 2NVCA 3LNMA 2IKJA 4JTDA 2AGTA 2PDBA 2DUZA 3LZ5A 2P5NA 2QXWA 4XZNX 1HQTA 2PD9A 4XO7A 2IQ0A 4LB4A 2BGSA 2PDMA 1GVEA 3WG6A 2FZ8A 4H7CA 3CASA 2IPWA 3CV6A 3FJNA 4EXBA 1XF0A 3EAUA 4MHBA 1UR3M 1PYFA
chains in the Genus database with same CATH superfamily
4HU3A 3UG8A 3AO0A 4L65A 1B30A 1XSJA 3E96A 3A4AA 4UZSA 1K8YA 3IIPA 2ZC8A 3VCNA 1AFSA 1O95A 4AXKA 3I65A 1HKWA 1F2JA 1Q6LA 3URNA 4ACZB 1PUDA 1Q45A 1TIWA 3V16A 1Q6GA 1AL7A 3OLDA 2NUXA 1IT0A 5EB8A 4NRSA 3GKAA 2QIIA 2OSYA 4H9TA 1ECEA 4R7JA 1QI0A 3MJMA 3WH8A 2OEJA 3VNMA 2J8FA 3KXQA 4G8TA 4NJHA 3GXTA 1F6KA 3O8AA 4JDBA 4JEJA 4CD7A 4MYXA 3WEZA 1XYBA 3DKLA 4D6FA 4TMCA 1CGYA 3P80A 2Y8UA 2VXNA 1A5KC 1EJUC 3QEZA 1AW2A 4DZ5A 3S5OA 3W1PA 1VBUA 2V8ZA 1RCOB 3OZYA 3C2FA 1G7UA 1PX4A 4NZJA 1VYSX 4D8ZA 2VGBA 5D02A 2PF8A 1D3HA 3VINA 1VFHA 3NQMA 1QNSA 3ZLGA 1QASA 4BZYA 1FCQA 2NQJA 1EL3A 1RSCA 2HS8A 3E0VA 4TR9A 2ZX7A 2WSPA 3W25A 4HMCA 4FNRA 4PMZA 2J88A 2R1KA 3IGHX 3GIQA 2XIOA 2J79A 2VZSA 1EX5A 2JFEX 2NWRA 3PBMA 4GNJA 4QISA 4J3XA 3W22A 1PAMA 4RE0A 5REQA 1KM6A 2PRLA 3BWWA 2QMJA 4MSSA 1ZBVA 3IJQA 4UFJA 3XISA 2FB3A 1HNYA 3BMVA 1EWDA 4LEFA 2ADAA 3QQ1A 1OZQA 2NZLA 3QTPA 3OYXA 4YL2A 4JTLA 4NF7A 5HMSA 4BF5A 2REQB 3I6TA 3ABRA 1JYNA 3BAKA 3I6EA 2G37A 2HNEA 3WENA 3VIIA 2QF8A 2G96A 1K03A 1H7RA 4A8LA 1XRVA 3K8KA 2G3FA 5HAOA 5BRQA 1LBFA 1HKKA 4KGLA 4EWJA 4XQ6A 4GOAA 4MY1A 3S2JA 3W1TA 1JG9A 4DXKA 4O1EA 1W3TA 3B0YA 1PCWA 2FB2A 4CN1A 2G8ZA 3UJRA 4C90A 3KS6A 1IV8A 1PSCA 4AIUA 3TW6A 1BQGA 1IEXA 1FP8A 4YWSA 3W37A 4D9PA 1SO4A 1MNZA 3KX6A 2CESA 4LAMA 3TNOA 4GVHA 1QDSA 5BXTA 3I3BA 1Q6FA 4FPSA 3P74A 3AYVA 4WQ6A 2NUYA 3CNYA 3NL3A 2ZX5A 3I7SA 4JD4A 1KRMA 2E6DA 4AD5A 3G1RA 4GNVA 5LKYA 1PIIA 1UD2A 4C65A 3A4JA 3CEUA 4NJGA 4R3UA 2I56A 4OWGA 4I8DA 3PVFA 1GYMA 1N2VA 2HE8A 3LRMA 5CSRA 3TTOA 1W31A 4HA1A 2C8NA 1E9LA 1VIWA 1ZAIA 2WM0A 4QCFA 3VOGA 3PZOA 5CC3A 4O10A 4IIEA 5LA0A 3S46A 5IFPA 5H6HA 2WJDA 3V5FA 2YDSA 4OUIA 2HXTA 4H8HA 4OV9A 3S4TA 2PE4A 1A0DA 2E6AA 3UY8A 5C2CA 2CWXA 1KCXA 3EOUA 3H2EA 2BDQA 2VEMA 4GYJA 1VFFA 1R3QA 1NDYA 4YTRA 2C71A 3C3UA 4GYKA 2DUAA 5E93A 1JYVA 3KRZA 3QBUA 4FF5A 3LPOA 4YPJA 1XC4A 3PJUA 4PRTA 1H41A 4L4OA 1S46A 3PZTA 3TJLA 2O4QA 4X3ZA 1GEHA 5C9WA 1FY6A 1GOOA 2TODA 6TIMA 2NXIA 3SY8A 2VNCA 3B9AA 4DM1A 2YL8A 3RCNA 3WF2A 1BYAA 4GE8A 2ISSA 2WLYA 1XV8A 1Q63A 4Q8OA 1EJ7L 2XSBA 1TMLA 3RJYA 3BO9A 4KMQA 2XIMA 1UIPA 3RX3A 3ITTA 1WUEA 3CZLA 3WLNA 3HPSA 2OJPA 3L4YA 3WUFA 1QK2A 2ZVIA 5IRPA 1JRCA 5ABFA 1S5VA 4D2JA 3BAWA 3O3RA 3WYZA 2J66A 1E4NA 1UR4A 4X2RA 1FA2A 1XSIA 2E8ZA 4B3ZA 3UZYA 1UD8A 1E43A 2QGHA 5CZJA 3IIVA 2YL5A 3W7NA 1N82A 1TPC1 3DUGA 4AZGA 4LUSB 1A5AA 3EMQA 4YTUA 5DT5A 3TOYA 3VMOA 5C9XA 4LVBA 3ARZA 3HG5A 3GRIA 1Q5MA 2O7QA 3TN4A 1KBLA 4HD5A 3GHTA 4B3KA 5I3KA 4HNTA 1OSEA 2G50A 3AIBA 4UNLA 4AMCA 3WELA 2HQAA 2QKFA 3AS3A 2ONEA 4AIEA 4RNIA 3GNXA 1JR1A 3RM8A 4ZEPA 3IJLA 5D2YA 3VU2A 3RLHA 3SDOA 2IPWA 4QLLA 3OJGA 2OB3A 2PWDA 2EHHA 3MCMA 3N13A 2W92A 5DFAA 2WZMA 4GC3A 4WKFA 3N2OA 4DJFD 3S5ZA 3PPFA 3O15A 5CH9A 3R0UA 3SCPA 4IF2A 1MUWA 4CU7A 3KRSA 1WXZA 1GONA 1GOXA 4HU8A 2PDNA 1AW5A 4O12A 1UR2A 3A6OA 3R2GA 2ODOA 4KEZA 4FXFA 4D6EA 3G1AA 3MZNA 2RGMA 3SFKA 3PZGA 4O8RA 4FNPA 1EHNA 4IP7A 2CIPA 5AHFA 1IGSA 4JAWA 1KV5A 2NV2A 9XIAA 3EOOA 5KEZA 2AKZA 1B5TA 1E6SM 3UZXA 3VM5A 4J3TA 3BGJA 2ABAA 2VUNA 1W9BM 3B8SA 1FWSA 3BANA 2GSJA 1VFOA 2QPSA 4HA0A 1KQZA 3L67A 1DTNA 4XZHA 3CAWA 3CO8A 3PHAA 3MHGA 3D0CA 1JNDA 4Q4PA 4LBRA 3RR1A 3TONA 4FNTA 4ZOCA 4IPIA 3A9BA 4HZ7A 2E40A 2A3AA 4ICCX 1GQLA 3HOJA 4DYJA 1GVRA 1Z42A 4XISA 2GUUA 1W2PA 3AU6A 1KC7A 4U2YA 1CLVA 4IXXA 1NY1A 3EXTA 4CVUA 4BF7A 4XAZA 4PUUA 3VKBA 5FF0A 3GC2A 1AUSL 3NL6A 4W8BA 1BKHA 2VFFA 2E5CA 3AS2A 3K30A 3AUJA 1SM9A 1KTCA 1A53A 1F6PA 1WXYA 4C6MA 1PBGA 3GUGA 5EFFA 1FDYA 2Y7FA 4ROPA 3MPGA 4V33A 1RY8A 3WCZA 1GTHA 3HA1A 2W3ZA 2WXDM 3FKRA 3ZJKA 1C91A 2QUTA 3BGGA 3IGSA 3F2BA 4M1RA 2GJNA 4XUYA 1YTKA 1GVIA 1A4LA 2WMJA 2PLCA 3F4CA 2W6RA 2EG6A 1Q4WA 3UJFA 3WK2A 2PDFA 4Q7NA 4F8XA 2BHYA 3IIZA 2DP3A 2EJAA 3LHWA 2ALDA 5A1AA 3GTHA 2EGZA 3H53A 4W86A 3BW4A 4K68A 2WLZA 3S3GA 3UYCA 1MEIA 3IJ7A 2OQYA 4M6UA 1B54A 3O05A 3RLGA 1VJSA 1VH7A 4XVEA 5KITA 2ZZ1A 3KAOA 1BWVA 3L66A 1IEQA 3JW7A 2NUWA 4GQBA 1XLJA 3F4WA 2ZUVA 3BL3A 2VCCA 3GDBA 1FRBA 3K5XA 2J9YA 1QT1A 3QYSA 4K8EA 1OB0A 4U33A 3APTA 4IXHA 3R8RA 3W53A 3SGUA 1J11A 1ZAHA 4TQTA 1N8IA 1E1EA 4KWUA 3FYOA 1TG7A 2E3ZA 1KM1A 2PWEA 3R0KA 2VR4A 1TWZA 2PCQA 2Q8XA 2F2HA 1LRQA 4QCEA 6ENLA 1RD5A 2V38A 2P8BA 2RFGA 3W0KA 3WD1A 3PZIA 5D8WA 4BWLC 4TVCA 4JPGA 1LZOA 1UBSA 3CMFA 2PMQA 5A8GA 3UQNA 2X1UA 2PDLA 4ZR8A 5TNVA 3MMTA 3U8GA 4QFUA 3NM1A 5T8GA 1PDYA 4HIBA 3FW6A 4HT3A 5FEZA 4MZYA 3S1VA 4IQEA 4LBUA 4NZ3A 4JN7A 3E49A 3OOQA 4Z2HA 3U57A 4GO9A 3BURA 4L4PA 2BFGA 4MNKA 4H01A 1UJQA 2FTYA 2FPVA 4KCWA 1JF5A 3RN6A 3CQJA 1B9ZA 1FKXA 1YX1A 2IUZA 3KL3A 4IFKA 4Z1YA 2R9RA 5CC5A 2O55A 1EPVA 4Q33A 2YR1A 4WD0A 2Z26A 2CLLA 2J24A 3NQGA 4C1LA 3E74A 3C2YA 3P8JA 3R43A 1R3WA 1TCDA 4C6LA 1KBBA 3W74A 4HHPA 3NTYA 2QDHA 1KFLA 1V6XA 1F8IA 3AXKA 4NHVA 1NQ6A 3H23A 4JYFA 3TC3A 1E6XM 2SFPA 2X8RA 1QXLA 3OZMA 3M43A 4GI6A 2Y8VA 3G2GA 2CEQA 3TK7A 5DANA 1XR2A 1W56A 1FWDC 3GC4A 1OIFA 3WLQA 1LWJA 3B8UA 3WKZA 4JFSA 5FJJA 1TV4A 1E0VA 3EWZA 3SUVA 4OHQA 3P5YA 2QUVA 4QG6A 1AH4A 2XH0A 3TWBA 1E0WA 3R12A 2BGNE 1C7SA 4WOZA 3PTDA 3W28A 2ZUSA 1JZ4A 2OSXA 3WQDA 4GMEA 3CM4A 4ZENA 3B97A 1SJCA 4NSBA 4BQ3A 1X1OA 1C9DA 1J2BA 1W5NA 2QXWA 3WH5A 2JKPA 2C16A 1WZLA 3PG8A 5G4EA 4ICNA 1GOWA 3DC0A 1ZJBA 2DZSA 5LA1A 3BSGA 4Q4QA 3TLLA 3D46A 1F73A 5FJRA 3AIWA 3TN3A 3SADA 3KHJA 1PYFA 4LY4A 1DJNA 3ARUA 2I1OA 5T91A 4EP8C 3RYSA 2D3NA 2CERA 3IGXA 2JEPA 2X7VA 4QQUA 3QHNA 2X0YA 4E2BA 2AOSA 2WKGA 1NDZA 1J79A 2Y4SA 4C6EA 5I77A 1TPB1 4I7VA 4LTSA 2X41A 5B80A 3KUMA 4QE5A 4LCQA 1A4MA 5A2AA 5HQEA 3TCSA 4DJFA 1M7JA 4GCXA 4LWWA 3G77A 2QDGA 1Q6QA 3DGRA 3ES7A 2VCBA 4EXQA 4HN4A 2R82A 1IIGA 2ZZ7A 1FFRA 2WO5A 1KXTA 2FH6A 4IG2A 4MZ1A 3W7EA 3N4AA 3OG3A 1B1YA 5C2XA 1J6OA 2XGZA 5D30A 2ZXAA 3DG6A 1JNEA 3U5UA 3G1VA 4UQBA 3MKVA 4Q4RA 4C6CA 3IVUA 4DF1A 3WLHA 4KT2A 1E73M 3WEMA 3V0UA 1IEVA 1M01A 5BWAA 1V0KA 2F8QA 1I2PA 3GVVA 1RBAA 1XBYA 3W7CA 1C29A 2G4FA 2I5GA 1J6PA 4NILA 3E5PA 4YTQA 2R8WA 2W62A 3K8MA 5JBFA 2QCNA 1E15A 3EYPA 3NPXA 3CV1A 2XN1A 4P2VA 5GQBA 1QPQA 3B0VC 1BRLB 1OYCA 1HKIA 3NSXA 1VYPX 1M65A 2WC3A 4EPKA 4EXAA 1TMQA 4FP1A 1NELA 4O13A 3EB2A 2YXXA 1AVAA 3TJ4A 4ERGA 3EPOA 3WLMA 1O5RA 2YDAA 1N55A 3KBMA 2QJMA 3YPIA 3GHRA 1R3RA 2DJLA 4Q8TA 4MYAA 3VNJA 2PTXA 3BJTA 2A6LA 2BB0A 4A8RA 2V3EA 4AZBA 4LB3A 3EKGA 4MNLA 2Q3OA 4JTGA 3P60A 3OYZA 4IMDA 5HBFA 4OZOA 4F0HA 2VX6A 1PPIA 2QQ6A 4M1BA 3QH2A 2WB5A 3QKEA 2FFCA 4H2CA 4Z1AA 1FWIC 1ZPTA 5EBUA 3AJ7A 4XWUA 4H4IA 1FHDA 3LPPA 3LM7A 3NQEA 2DIJA 5LGXA 3UWZA 4HTYA 1XLFA 3LMZA 4OECA 2QUNA 2WPGA 1S3HA 3TYUA 5BRPA 3NM3A 1A5MC 4Q7IA 2PTWA 2GGJA 4EF9A 2PA6A 4K1GA 2VOTA 4IIFA 5LYRA 3V75A 3PY2A 1C8YA 4M51A 3ITYA 4Z17A 2J62A 3IIXA 3U48A 4GO8A 2VFHA 3LCHA 1S2WA 1GT8A 4JNYA 2PAJA 3M0KA 4V1XA 1JGMA 1DP0A 3RM4A 3HQOA 2BOEX 3H54A 1SQ7A 3WQEA 4UOQA 4MMWA 4EANA 3AZSA 3LV6A 1JFHA 1P6CA 3QV8A 4UQDA 1FWTA 1CB7B 3GIPA 3MUAA 4XZIA 2FDMA 4PCFA 3LLDA 3GVQA 1JCXA 3WMSA 3BARA 4P7RA 2V63A 2EBNA 1Y0EA 1K6WA 1DWFM 5FL0A 1FWJC 4GRSA 3VNYA 2NX1A 3MHUA 4EACA 2OX1A 4QLKA 3TH6A 4INFA 2PDIA 1SZGA 1Z6KA 3NZGA 3E0WA 4XD6A 1LQ0A 1KM2A 4DYEA 3H2NA 1T0OA 1QK0A 3NQDA 4PULA 2QGYA 4AD4A 1TRDA 1YW1A 3MV11 5L6UA 1W1B1 4HNLA 2BS9A 3KP1A 4OOUA 7ODCA 1XFCA 1BXBA 2HNHA 6XIAA 1IHIA 4J1OA 3LM3A 1ZJAA 3FDKA 1FWGC 1JGIA 1TTQA 3F1QA 3NA8A 2JF7A 3W72A 4WJXA 1H61A 3TTYA 1V93A 1FWRA 7PTDA 3L68A 1UYQA 4JTHA 3TFCA 4PUDA 3NSNA 5CEWA 2CBVA 4FOKA 1VF8A 2OYKA 3VGFA 4KF1A 1GQKA 4JKKA 5BU6A 3TN5A 4LVGA 2H3BA 1MZHA 2G95A 3DBPA 4BKNA 2JIWA 1W5QA 5H8MA 1DE6A 3RG6A 1DWIM 1B3ZA 4KIEA 5CBJA 2HSAA 1G7VA 2X40A 4JTJA 5EA9A 3P82A 1MXDA 4NIRA 2AQWA 1FH8A 3APGA 1SZEA 2YW4A 3WF1A 1PKYA 5D04C 1VEOA 3QY8A 3PULA 5CC6A 4CNTA 3H70A 3S2MA 4HSNA 1K8XA 3ZSTA 3AYSA 2PU0A 5KINA 3BC9A 3DI1A 2NVCA 4O57A 4RKAA 4HOZA 2WNNA 2V30A 5FEPA 4LS0A 4ZO7A 4NAFB 2KZHA 5E0CA 3UA4A 3KVMA 1K9FA 5AYYA 4IPJA 1L8PA 4PMNA 4FHAA 3WD0A 2PD9A 1YADA 4LF2A 2O9PA 3D47A 2Y62A 2WVTA 2EJ1A 1BTCA 1BVWA 2OFJA 2FZ8A 3ELFA 3WFZA 3FN9A 4PCNA 4XD5A 4EXBA 4QG8A 4O53A 3DGBA 3PUDA 1CGWA 3W2JA 1MI3A 1WNOA 1NP0A 1JULA 4IM4A 5A6LA 1OFAA 1YDNA 4XKYA 4F48A 1JRBA 1EUNA 2E77A 4OE7A 3WLSA 5DXYA 4OT7A 4DF2A 3R5EA 5KETA 2VENA 1UWSA 5IDZA 5AHIA 2J27A 2P0IA 1CTNA 4AB4A 3PBVA 4GGHA 4U3AA 1IWAA 2W91A 1E40A 3QPZA 3N2TA 2HEJA 3P5ZA 3QHOA 4CU8A 3CT7A 4U28A 4W9TA 2PD5A 1FCBA 3SN1A 3GG8A 4J4KA 2P8CA 3TX9A 1DORA 2Z2BA 3GAKA 4UTWC 1SFSA 2UZ9A 3LD5A 4C6OA 3N2MA 3OLGA 1X6UA 3KBNA 3HPAA 2ZUNA 1DIDA 3A64A 3G1FA 1QW8A 1E5JA 3QR3A 5J04A 1UPMB 1GPFA 1IIHA 1LUCB 2QR6A 3LI0A 3K13A 3NCOA 2VURA 4A4AA 2J74A 4LYPA 1NF7A 3W23A 1RR2A 2Z28A 4HOWA 3WDHA 3C0JA 1B4EA 3CAQA 1OFBA 1JD9A 3EWCA 3G24A 3F4VA 1VLWA 2GYIA 3CYVA 2TSYA 2BOFX 1E3XA 5IXEA 1J2WA 4XAFA 2GVEA 3BMXA 1SSGA 3MW7A 3NJ3A 1W37A 1S1RA 2J8TA 4WDXA 3G3MA 4F9DA 1HZYA 1ZSXA 1HKJA 2QJGA 4H9ZA 1AZ1A 3UZJA 3UXAA 3MP5A 4IH3A 3PWIA 5LNUA 4UFHA 1XISA 4C1NA 3QOKA 4ACZA 1EZ2A 1JFXA 1VQTA 1CLXA 1GG1A 3P2VA 4RXFA 4OV4A 1GW1A 4GZ7A 1IR1A 3HPZA 3CTTA 4GUFA 1GHSA 2VL4A 1R0MA 1DBTA 2OT1A 3A22A 1HJWA 4DUWA 3EWYA 2PS2A 3OA3A 1X6NA 3NQFA 1CDGA 2EPLX 2P3ZA 2EPMX 4H9MA 4Q4SA 1T5AA 3C56A 3FX4A 1WPCA 5D32A 4PBFA 5CG7A 2TYSA 3H12A 3BSMA 1VD6A 2PDJA 5F2IA 3GKFA 4BCEA 1VC4A 5LXEA 4MWAB 3TJXA 2WVSA 4D71A 2PRMA 5FKYA 5I3DA 3PF3A 1V3IA 4QSHA 2V2CA 1JF6A 1DJWA 1OFOA 3GXPA 4E3TA 3R6IA 3ARWA 2GJPA 1FH9A 2FJUB 3KHDA 1QI4A 2QNEA 4JKMA 1OVDA 4PBEA 3KRUA 2I5IA 3K8LA 5AC4A 4RDVA 3E38A 3U0HA 4FX8A 1AH0A 4AF0A 2J75A 4JYDA 3SCUA 1V0MA 3QFEA 1A5LC 2PP0A 1LRTA 2ZX9A 1ZBKA 1ZL1A 2YSWA 2ZRYA 3TSBA 2F6XA 2PGRA 2V5JA 2ZUWA 4FO4A 1FHUA 3TU9A 1RHCA 4NZ4A 4LGXA 3SUWA 4I5UA 4CNOA 3BLKA 1XI3A 1F3WA 2X42A 3II1A 3HURA 4Q4OA 1QBBA 3RMEA 3FJLA 1WO2A 3QMTA 4JNZA 1X7IA 3VM7A 4CCDA 5D37A 2DVXA 1Q8JA 3M5YA 9RUBA 1NWRA 3SO7A 3BV7A 3PZ9A 1R2RA 4A3RA 2JBMA 5HNTA 4PTWA 3HGJA 1K1DA 2POTA 4M80A 1FX6A 4GZJA 3GXNA 1B57A 2DZUA 2TMDA 1LQAA 2RAGA 3TAOA 3FGCA 3E2RA 4NP7A 3QY7A 3SQSA 1W1PA 4C6BA 2ZE0A 3NPUA 3W7HA 1C9WA 3U3HA 2PLKA 3EDFA 5CJ5A 4WDUA 3V18A 5LIXX 3U2OA 1C90A 1L0PA 1CLKA 3DG7A 3EDEA 3OO2A 3GNPA 4A3QA 2GL5A 4XZLX 1TV2A 2GQ8A 3EA3A 5CAKA 1VS1A 2WHJA 1OC7A 1V0LA 1AG1O 2OLHA 1NEYA 1Z89A 3W7PA 3OVRA 1SW3A 4DWSD 3RM9A 4CNUA 1TX0A 4P8UA 3RR4A 3NIYA 3ZZ1A 2VR2A 2C79A 5CPMA 4B5XA 2VHLA 3HGOA 4NNAA 3B8TA 4AEEA 2CXGA 1RA0A 3FK4A 2VC9A 4B5VA 4XUGA 4LYRA 4K3ZA 4G6CA 3L5MA 3CZ8A 2Y85A 5DMNA 4NXKA 2P5NA 1D2KA 1OT1A 3LPGA 3UT0A 2VP8A 3WBEA 4ZXOA 1KTBA 3DHUA 1ZP3A 4LVAA 4GVFA 1TJ0A 3GR8A 5I5RA 1EP2A 1K02A 4PMQA 4H7CA 4NT0A 4HYVA 3OGVA 4DVOA 5FESA 2V9DA 3QFWA 4MWAC 2MUCA 1JCMP 4GZEA 4F0RA 3QZAA 3R0DA 4ZQNA 1RQBA 3EMZA 5MKGB 4B5UA 5AFDA 3PZQA 4KFOA 3WQOA 3UJEA 1S39A 3FLUA 4QJ4B 3I7QA 4JL1A 1S2TA 4KWWA 4S1FA 4CQAA 5LIKX 3DYOA 3RFAA 2KX9A 2YB4A 2YYUA 1M68A 2VZOA 1TJRA 2PC8A 5CQ1A 1LQ2A 3CHFA 1SVDA 5G1TA 1P43A 4PCSA 4TU1A 1DXIA 1REQA 2GJRA 3WNKA 2XVNA 2PDYA 1A3HA 3LLFA 1BD0A 1E0TA 2GVJA 3CAKA 2CYGA 4UFKA 3TSDA 3PUEA 2ZZ2A 1GCYA 4GI4A 2VEIA 1DJHA 1A5SA 3QSTA 5EGRA 3R8HA 1BXCA 1IEWA 2Z00A 5XIMA 1V6VA 2QHAA 1RXOB 3ITVA 3LXCA 1XCWA 4FIQA 3WQFA 3SQMA 1NOFA 3GK0A 1FWBC 4B2DA 4DUVA 1ONXA 4UUIA 2OTDA 3B40A 5M2FX 2D22A 3TE9A 1REQB 1N7KA 1GJPA 5A8MA 1UC5A 1RLDA 3ZR6A 2Z29A 3VD5A 3PB2A 3VKJA 3S9IA 2QVHA 3EZ4A 5FAJA 2QLYA 3ZFHA 1US3A 4WCJA 5DQPA 4XB3A 3TIMA 5CGQA 1PJ9A 3COTA 2R1LA 3VD4A 4JX4A 1M6JA 3B8DA 2OO6A 2GFTA 1ZFJA 4H3DA 4RDZA 3HFYA 5MKGA 3SJ3A 4Z0SA 4HCDA 2OEKA 1D7KA 1QOPA 4JNMA 2FVMA 4PODA 2X30A 3TSMA 5G2HA 3QW4B 2HXUA 2GDUA 4ERAA 5AN7A 2QZRA 2YGYA 5HWMA 2WSYA 3OHMB 1OX5A 4AHQA 2W79A 2D73A 1K70A 1W3HA 3LS9A 3ZOAA 1PIGA 4BA0A 1YTEA 4L1XA 1LM1A 2VO5A 3RPMA 1E9YB 2A3EA 2VC7A 3SSZA 3PJXA 3I4KA 5LHEA 1YLVA 1TPVA 4IX0A 1CXLA 3CHDA 2VZTA 3CZEA 3KWXA 1YPIA 1IZJA 1R2SA 2YL9A 1PZ1A 4AF0B 1Z8AA 1ZQ5A 4GBDA 1ZBWA 2VX4A 4BI5A 4CD5A 3PAOA 5EMMA 1HL2A 3PPGA 4H9UA 4JY9A 1U30A 2Y0FA 1E6ZA 1V03A 3L23A 1JAKA 4TIMA 1PV8A 3O07A 2FLIA 4B5NA 2ZZ3A 2YA0A 2BNJA 4OBSA 4YNGA 3KTSA 5AB3A 1DWHM 3VOHA 1JPDX 1VENA 5HR6A 1OFQA 4ZB0A 3UZZA 2ZDRA 5F1UA 1POJA 4BI6A 4UC5A 1S3TC 3VNLA 3O2LA 3WX7A 1KFWA 3BPWA 3W7QA 3CV2A 4M7SA 3RILA 3NUKA 3M0IA 3WQCA 3NOYA 5ECVA 1THFD 3HTWA 5ECUA 4S3JA 5A6TC 3GD6A 3UWEA 2ZWYA 3ABZA 4YWIA 3ANUA 2DEPA 3W6MA 1EUAA 4JTFA 3ATYA 4IWWA 1DEDA 3KLKA 1QNQA 3RRAA 4A2RA 3WQ6A 1FCVA 3JUGA 3KL0A 3GTFA 3BJSA 1KCZA 1W8SA 5I3JA 1XYCA 1G5AA 1R3TA 4FNUA 2VFGA 2YDRA 4OUEA 1GYNA 2I57A 1XLAA 4IFKB 4TO8A 1SR0A 3A4WA 1XQLA 3NWRA 4REQA 3GTXA 2BY3A 2ZOXA 1XH0A 3FA4A 5HJLA 3P7YA 1J5SA 4HBKA 4LX4A 2B7PA 2CW6A 3ITXA 5I07A 4JFWA 2A3CA 5AYBA 4HMDA 4C5ZA 1W1IE 3EDJA 4LANA 2R6OA 1HL8A 2VDIA 3RRXA 3WO8A 7A3HA 3C0SA 1P7TB 2GUBA 4MAVA 2B81A 3STEA 4Q8UA 3DCPA 4LALA 3N29A 2XFYA 2ISDA 3GVWA 2A7PA 2QCHA 4MKNA 2A2IA 3N2XA 4L56A 4AD0A 5IDIA 1CXFA 3PSVA 1Z7AA 2BY1A 3SRFA 4JTRA 3LG3A 4XG1A 1EJRC 4HPHA 4K8GA 3OEXA 3W26A 1GVYA 3AZTA 1TO3A 4AD2A 1CT5A 5I23A 3WY1A 4D6IA 1DJIA 4F0KA 3LQLA 3L4WA 4UTKA 3S1GA 1GWJA 3N4FA 5C9ZA 1ZCOA 1XUZA 3CK5A 3HG2A 5E6ZA 4IUGA 3TMLA 3NYZA 4D8LA 4PYSA 2UWFA 4LUYA 2H8XA 4K8HA 4NYYA 5BMWA 3A9IA 1ESWA 4EOUA 1CEOA 3U2EA 1F9CA 4WSHA 4MDOA 1XXXA 4B3LA 2V68A 3NXLA 4FK9A 4S39A 3T1GA 1DE5A 1GHRA 2AGTA 2OQHA 1GOIA 2PDBA 4AZ6A 2AL1A 2ZA2A 5FACA 4XZNX 4ALDA 3IUHA 1QI2A 4FX7A 2FJKA 1QJWA 2H90A 1DJYA 1QU4A 2VZUA 5CXPA 3L4ZA 3UWVA 3MC5A 3CHVA 2D2JA 1B9BA 3WUEA 2XH7A 1DJGA 1K3UA 4WHBA 5MHBA 4DO5A 3KCJA 1L2UA 1UWUA 2NVAA 4CD6A 2NSXA 4OQVA 1XRFA 2HTMA 2R94A 3ABSA 3G18A 4NY2A 5REQB 3EB4A 5H2ZA 3ARSA 3CZJA 1TZ7A 2BXVA 5FL1A 3OZPA 3O6YX 1IZCA 1MRQA 1ZLPA 3STFA 4WX2A 3QF0A 2XM2A 5DT7A 1I2RA 4KEVA 5F4SA 2V67A 3B3DA 4MB5A 3RU8X 1I9CB 1VYRA 1WBHA 2QPUA 2W9MA 1ONRA 1JXKA 3DHFA 3ATZA 3TNBA 4IJBA 3ZIZA 1V3HA 3BMWA 1TE1A 1YXYA 2O92A 2G0WA 4W88A 2OX4A 1BWKA 3EXSA 3LSCA 5B7YA 4PTMA 4B4FA 4KEUA 4LS1A 4HKPA 3UG5A 3AS0A 1TV3A 1EPXA 1DV7A 3SRHA 5CPTA 3HJEA 5E1QA 4REQB 2D0FA 4GABA 4A8NA 3M44A 5TIMA 2A85A 3HF3A 1KD0A 4WEVX 1TV5A 3M0YA 4K6AA 4Y9AA 3B4YA 1BXNA 3WLPA 4J5NA 4O28A 2YA2A 3FSTA 4B9ZA 1XIEA 1X97A 2FIQA 2WSQA 7TAAA 1YXDA 4FX6M 3THCA 5CCZA 4Q6JA 2R1NA 3BSHA 1R30A 3DI0A 3W01A 4GUIA 5EMLA 3MWCA 1Y8BA 1F3TA 4B4HA 3WQ8A 4GGBA 3IIOA 4D6CA 1XCXA 2CLPA 3QV6A 3VD3A 2IQDA 5BXPA 4NQ1A 4ZFMA 1UD3A 4O1DA 3E0FA 2FZ9A 5D9OA 2WMKA 4W7WA 4W7VA 3PK7A 3BICA 1AA1B 3QXBA 3GDMA 1G4PA 4JIRA 1FFQA 1XPGA 1AJ2A 1LL4A 1XLGA 3W1NA 1MUCA 1TUFA 2IQTA 4Y9OA 2V0TA 3E9AA 5C7HA 3ARTA 1ICPA 3D3FA 4CN4A 3W86A 4O52A 3WBXA 1XLMA 3TCEA 3VO0A 4CU6A 4PL2A 3W7IA 4LPCA 5TAOA 4X0NA 3TMQA 5DY2A 3ZR5A 4PMUA 8CGTA 2VOMA 3N11A 2F2KA 4DBWA 1ITQA 1AW1A 3T42A 5FJIA 1JZ7A 3RO8A 3V3WA 3A4XA 2QDEA 1HW6A 3BOLA 4NZ1A 1RJPA 3MSGA 4MKSA 1K7XA 4HA4A 3TTEA 3L21A 5AVNA 1OG6A 1O60A 1XCFA 6REQA 1SW7A 5FF2A 4IL2A 3H7RA 1RALA 5M17A 3WFLA 2RJHA 1G1YA 2WM1A 5KZMA 3CL8A 3EKLA 2DH3A 2VDGA 1KTNA 3GTNA 3CO4A 4R5EA 1OADA 1XINA 1V3KA 2HPIA 3ZQ9A 5IM51 4MKVA 5G2IA 2WMFA 4P8VA 3C8NA 1V79A 4MNMA 3MVIA 2G41A 2XZ9A 1NIUA 2CLHA 3KP0A 3VD7A 2D0HA 1DL3A 3IUIA 3ANVA 3N25A 2B31A 3JS3A 1DTUA 4HU0A 3ZVHA 5E70A 3SFWA 1ZS2A 3K4WA 3LEPA 3MCNA 4R85A 3TV8A 4XAGA 1MEHA 3QRHA 3FKKA 4RK8A 2Y8KA 4X22A 4A2SA 1BVZA 1H2JA 3O9NA 1QCWA 5HNRA 4K38A 4NNCA 4UQ9A 3I7RA 3GIYA 3IUDA 4C60A 1BRLA 1C7TA 2OCZA 2E25A 4ES4A 2VTFA 1ISYA 4GFIA 2FHFA 2PLJA 2WMGA 4L9XA 5LIUX 1JQXA 4PR4A 3H55A 2HZGA 1OCBA 2QJNA 2PDGA 1JXJA 1Q4NX 1H11A 4M24A 4C7DA 5HINA 2PC4A 2AL2B 1S38A 5JU6A 2GGEA 1B3YA 1ITXA 4GJ1A 3THQA 3WNLA 3T0AA 3HO8A 3QJAA 3LLXA 4FSAA 5AYXA 3DBNA 1KWGA 1S5MA 3N9SA 3GO2A 1ZALA 1G6CA 3SM0A 1P0DA 3R8GA 3WIJA 3TN6A 1VRDA 2FZNA 1D9EA 3CLMA 4AC1X 1W8GA 2PFHA 3QOMA 5DO8A 1YDYA 4PFHA 2PGWA 3VKAA 1XUUA 4ATLA 4HYRA 1X38A 3Q2DA 4K39A 2ZZ4A 2G3IA 1RCXB 3ZVIA 2YYTA 3C8FA 1V7AA 3SIZA 3LNMA 4AZCA 3AIRA 3B03A 4PB5A 1JDEA 3BGAA 3SRDA 1LJYA 4R53A 3MANA 4R33A 3OVPA 4XAYA 1ZJHA 1PKLA 1YNYA 1QAPA 4GK8A 4OU1A 2YCJA 5DCDA 5BOEA 4LC6A 3L7RA 5KZ6A 3PSWA 1EQCA 1RPKA 4H7ZA 3DFYA 1UZ1A 2V2DA 5TF0A 2V5BA 2AQOA 4MVAA 2YXGA 4AIBA 4WGXA 2BHUA 2YW3A 5GNYA 4GPNA 1AQ0A 1Q3NA 2J7EA 1KBKA 4LRTA 2E6YA 2VC6A 3AICA 3TQKA 3OG2A 5C7VA 1RUSA 1O7AA 2FGBA 1GK8A 3GR7A 4HPNA 4LU0A 4U31A 4CCEA 1AD1A 5EKYA 2DZXA 2WHKA 1JAEA 3CMJA 3Q45A 3BTNA 4L61A 2I5QA 3NGFA 4LYQA 1SYTA 3CS2A 1HL9A 1VLIA 4DBDA 2C0AA 5LZLA 1YBQB 4I90A 4AHPA 3L2IA 3MB9A 4ZQPA 2GJLA 2CC0A 5D4YA 1PB0A 2J77A 2PGEA 2J9XA 4XKMA 2EO7A 4MAZA 4FZIA 3W83A 3NZPA 3AU2A 3BAXA 3ZLFA 3LBCA 1R5YA 3UWWA 1B4KA 1QPOA 3T4CA 4YCOA 3NYDA 4L4LA 4UQEA 1JDCA 1IGWA 4ZOBA 2EQDA 3GAYA 4M0XA 3W87A 3F03K 3FNDA 2D69A 1UUQA 4O54A 3VOIA 4FR6A 2RKXA 3ARQA 3GNNA 3QQ0A 5D8ZA 5D03A 1K7EA 3THDA 1DVJA 4H8VA 3W2KA 4OTKA 1ICSA 3VD9A 4EWND 3T7VA 3PP7A 1EYEA 1SO3A 4DUOA 4PN2A 4C6QA 1RZMA 4PMRA 1ME8A 2OKTA 1GQJA 1VCVA 2FVLA 1XYAA 5DCBA 1ZGDA 1WDDA 4IIGA 1H7OA 4YVPA 1S2UA 5TD4A 3ONCA 4HZ8A 3KRBA 2PTZA 2WHMA 3KFTA 3H7UA 4KRTA 4TVDA 2NV9A 1VCFA 1EEXA 4IIDA 4AZIA 1PVNA 2GWGA 4DJEA 2WMIB 1XICA 3KTXA 2PDHA 1FDZA 1UOKA 4I5RA 5DN1A 3E5BA 4MPKA 4H9XA 3UY7A 1B0IA 3PWAA 2WZTA 4G5DA 3TR9A 1WDWA 2CPUA 1K77A 2ZFAA 2WZHA 5G2WA 1CBGA 3W1UA 2D23A 3WLKX 3WQPA 3LBOA 3OGRA 1FWFC 3URBA 3MKKA 4TX8A 4IIHA 1PKMA 2MNRA 1AL8A 4NX0A 4H6EA 4S3EA 2CLKA 4AWSA 4FAMA 3RITA 1YMYA 4A8IA 2OOFA 3REQB 3PB0A 3UCQA 1Q13A 1U5HA 2QCFA 3H26A 1OCNA 3CAVA 5G1YA 3TC6A 3W1RA 3WLRA 3LHUA 4Z2GA 1SUXA 1LL7A 1ZENA 3KOXA 1NWTA 2XIQA 2XH2A 1V02A 5A6AA 3FVMA 4GVIA 4J3UA 2ZDSA 2BX7A 2IPFA 2NQ9A 2PF0A 4Y8EA 1OFRA 1SPQA 1WDRA 4ADUA 2OYMA 3LTPA 3PS7A 4GNKB 3VE7A 1YTDA 2GLKA 3G0SA 1P1MA 1T96A 1C93A 3NEVA 5C9UA 4UTJA 3TYCA 2XFWA 1ODZA 3S1WA 2CZVA 2CBUA 3UR5A 3RNDA 2E9BA 3C2EA 3EWWA 3EPNA 3GH5A 1GVOA 3PAJA 1ITCA 3VDHA 2HMCA 4RLIA 2Y7EA 1TPEA 3N6HA 2Y88A 1LG1A 1P0EA 4UNIA 4GI9A 1EDGA 3WK0A 4W84A 2REQA 5GPRA 4UQCA 3CZKA 2ANUA 1P6WA 4TTGA 3TOPA 1VIZA 1CCWB 4YVXA 1NFGA 1VFTA 3V36A 2GK1A 4PC8A 5CPLA 4DNMA 1TMHA 3U6WA 3ZSSA 4CVWA 1A49A 2WC7A 3EGJA 1K8ZA 4QR6A 1QO5A 1UHVA 4NJIA 1UA3A 1CXHA 3RMJA 4B15A 1XS2A 4RCXA 3EWBX 1DJQA 2WQDA 3CQ0A 5CJNA 3WBWA 1LUCA 3LU2A 5AECA 1W6TA 2GJXA 3CTLA 3LOTA 3URAA 5SWUA 4M6PA 1PIFA 2FTWA 4X2PA 2VVNA 1E51A 3NQCA 3U4FA 5DRIA 1H51A 3PTMA 4P7OA 2PP3A 1XGZA 1M1BA 3ORWA 4CGTA 4MFEA 5KZDA 4YCPA 2D1ZA 1H1YA 3PZNA 1J93A 1SJBA 5IFTA 4CEUC 2BP1A 2C7FA 1UD5A 1O1ZA 2P10A 2O56A 3IS4A 3NZQA 3T81A 1M9HA 4ZQMA 1RH9A 1KFJA 1YBQA 3N4EA 1JJKA 1U5VA 1JI2A 4M5PA 4N4PA 3WMCA 1YXCA 4FXRA 4KCTA 5F4WA 2BLEA 4MZ8A 4I7UA 4G7EA 4Q8WA 1XIIA 3T0TA 4JTAA 3KBVA 1WA3A 4ZL1A 3CV7A 2OGJA 1RBOB 2PODA 1GORA 1P0KA 1JZ6A 3CWHA 1H7WA 1EB3A 3PBGA 3T44A 4MJZA 2ZKMX 1EJVC 4ZO6A 1SMDA 3FSUA 3PBUA 4PE8A 1ZB5A 5AHMA 2DSZA 4JTDA 4GY1A 2O7SA 2DUZA 1TV7A 1W0MA 4NZ5A 1LOQA 4HSOA 3ECQA 4NI3A 4AVFA 6ALDA 1Y5VA 1TA3A 2VT0A 1UD4A 3SGGA 3EA1A 2J47A 2V5DA 3ZO9A 4EK7A 1KV8A 3PNZA 3N12A 4FIRA 3VIHA 1E72M 1QO2A 1ZZMA 1TJ1A 5JMUA 3WLIA 5IHRA 1UZHA 4DJDA 3VMPA 3DYPA 3GR4A 3WF3A 1KBJA 4N9DA 4BFAA 3PWGA 1B3WA 1QW7A 2I9UA 2PPGA 2QCGA 5FI8A 1PKNA 4O16A 2CZDA 1L8NA 1PTAA 3E2QA 2JF6A 1BFNA 1OC6A 4GG9A 5C55A 1UJPA 1OC5A 1L9WA 2O0TA 3W7GA 3HGSA 4F2UA 1MUMA 1I4NA 1T40A 2HCVA 4EX4A 4JN6A 3HPFA 4E8GA 1AQFA 1XQKA 2V5CA 3V35A 2BVWA 4E6MA 1OYAA 3CYJA 3E3HA 4RDYA 2XN0A 4G1NA 3VIKA 3C86A 4MUZA 1LYXA 2VC5A 1WYIA 4HPXA 3WL1A 2YCKX 1OEPA 1UZDA 4IGNA 5AZ1A 4IL0A 1S2CA 2EAWA 1OF6A 4PTXA 2Y5JA 4LUSA 1KW1A 3PBYA 1S5NA 1EA0A 1YPXA 4A22A 3G6LA 2WCSA 1TYGA 3F5KA 4S3DA 4CNPA 3VAVA 3KVLA 1G69A 3BAYA 1JPMA 4NXSA 3N04A 1O6IA 3UESA 5K9CA 1KFBA 3RO6A 2YZRA 1G4SA 4R9XA 1XBVA 4S2CA 1H50A 1KO0A 1OQFA 4D1JA 1DXEA 3QHMA 1R46A 2X1TA 1UWIA 2CZ5A 4G56A 5D2VA 1M7XA 3BZJA 5M3WA 1DWAM 3EB3A 3WSUA 1KA9F 3MYOA 3GXIA 3W3OA 4C1KA 1JD7A 2INZA 2DV0A 2VFIA 1FBAA 1GJUA 4JN8A 4NKCA 2E28A 2CHRA 1XLKA 4NUWA 1TELA 3T0CA 2PTDA 3OVQA 1X1NA 5HJXA 5JIWA 2O9OA 3G5EA 3P0XA 4Q8VA 3GW3A 3L0KA 4GC4A 1PX8A 1XBZA 3AXHA 3EWXA 4FF7A 1XLBA 3P8IA 2QAFA 2VGFA 4J2MA 1PYMA 3F4DA 1J0KA 2PI6A 1T41A 3CPRA 2Z7GA 4F2BA 3VGHA 1F6YA 4GJIA 5FJOA 3DDMA 3NDYA 1W1A1 4WGHA 4ZE5A 4DWSA 2Q8ZA 5C71A 2QCMA 1AJ0A 4MOZA 5LA2A 4W8AA 5A6JA 2BSLA 4E4FA 2PSNA 1X8CA 6A3HA 1FP9A 4B5WA 5PTDA 4RE2A 1QHPA 4AY8A 3PTKA 3DKJA 1O5XA 1V6UA 4N9CA 5A8QA 5JUVA 3HG4A 1XGDA 4QAWA 5BOFA 4ONVA 3M46A 2E67A 2V81A 3AMDA 5ABEA 4AFYA 3R1ZA 3GU1A 4E4UA 1KRBC 4DUXA 3KBSA 3DHPA 4JKLA 3V4BA 3MQTA 2O4MA 3BW3A 5EFDA 4DO7A 3T2OA 3PFRA 1TE6A 3XINA 3TROA 2BMBA 1J01A 3H24A 3CHCA 1WZAA 1OJXA 1BYDA 1WXJA 4I5XA 5E5CA 1EF2A 4AMAA 4DXXA 4QIUA 5DX7A 1DJXA 2HWGA 1O68A 2DSWA 3CLWA 1TJPA 4DX3A 3HB9A 4H19A 1XBXA 4O11A 1CXEA 1BGGA 1MYRA 4QSFA 4JXCA 3P0WA 3OIXA 3R25A 4LUIA 1S1PA 1TWWA 3GG7A 1R3YA 1C92A 1Q6OA 4ZTXA 5K2ZA 2QCDB 4ZO8A 3T4WA 3FAXA 4ORIA 1GW9A 5CSSA 3OZOA 1A0CA 2HJPA 3D6NA 2IXVA 3L2LA 3E02A 2VEFA 3SRKA 4CLMA 3PZVA 1FKWA 1W3NA 5F4XA 3WMLA 1D7FA 2W5FA 3DG3A 3NDZA 1AK5A 3W82A 3OGSA 5U4NA 5EY5A 1J18A 2OWCA 2GVGA 2X2YA 4C1NB 4UCGA 3SCOA 5EL1A 2HDJA 2ZUMA 4TX9A 1MMFA 4MY8A 4DIAA 3LHZA 4IUOA 3WFAA 5F2MA 2OKOA 2HVMA 5DMLA 2A3LA 3AYTA 2B4GA 4MLJA 2FGZA 3DENA 1MW2A 3O6DA 4NYUA 4IQDA 1BHGA 4KRZA 4OFCA 3ZMRA 2OSWA 4Z2JA 4KBXA 1TWSA 1OY0A 2WQPA 1EC9A 3WLTA 1W32A 2D20A 1P48A 3B4UA 2UY3A 2WZEA 4QE4A 4Q4MA 3LDVA 3RIKA 3N2BA 2QT3A 2ZBTA 4IMGA 3AISA 2ACSA 5A69A 1EOMA 3CL7A 4CCCA 1XYMA 1E71M 1ZCCA 2CKSA 4UOJA 3BK0A 3DFTA 4QX4A 1JI1A 4R9OA 4P8WA 2XN2A 5CPQA 1I2QA 3R11A 4EPEC 1FWNA 2CHNA 1GG0A 3K4AA 5CZTA 4DRSA 2Y7GA 3WK3A 5D2WA 1LBMA 4JX6A 2XH4A 4RPQA 4LAOA 3UPWA 3SCTA 1TPWA 4V28A 3STGA 1ISVA 3NPVA 2IPGA 4Z2LA 4DNHA 4XD3A 2VZVA 3C4UA 4HPJA 2H3DA 1K6AA 1IE7C 4N6EA 2ACUA 1RK5A 1YE4A 2OWWA 1T99A 2BY0A 1FXPA 3I4EA 4DZHA 1PXGA 4TTUA 3W07A 3CB8A 2CLFA 1CGTA 1U2YA 4GYFA 5LNRA 1OX6A 2Y5EA 3VCCA 4W4QA 3DECA 1XIMA 3AHTA 1EGVA 4FLRA 3BVJA 3CASA 1UR0A 3EAUA 3WJXA 2WBGA 3P3BA 4GFSA 5GJMA 3SQLA 3S5SA 5D09A 2DH2A 4FB7A 2FDSA 5I79A 4C6NA 2WJEA 1LOSA 3SR7A 1GQIA 3NQ7A 2HPMA 3BW2A 2JQXA 1H1ZA 4N0RA 1HXJA 4JTQA 3W24A 4JQ3A 2HRWA 3WEOA 2X09A 2J6VA 1R85A 4H6KA 3SIMA 4AWEA 2DQXA 3UXKA 2PDUA 3RPTA 2ATMA 1KB3A 4CQ8A 3VNIA 1Z41A 3WN6A 3H2FA 3KM8A 4P61A 3KS5A 4JEQA 3DFSA 3E6EA 1UWAA 4UB9A 3TYZA 4XBKA 3VILA 2EPKX 5I3GA 2OZ3A 4HU4A 4FA3A 3LQGA 1HVXA 4A35A 4LVDA 1BKSA 4WRHA 4H00A 1EA9C 4LAUA 2EKCA 3WBYA 4GACA 4M6VA 4QAIA 4A6GA 3FS2A 4HQVA 1TB3A 1EOKA 3MDWA 1M3UA 3R7MA 3VUSA 2XVLA 4BJHA 2W27A 1MSSA 4AVNA 3WJZA 4C6FA 4DY1A 1GOQA 3MDUA 3WD2A 3L0GA 3S6OA 2ZA3A 5LHFA 2JEQA 3OTRA 2HBVA 2P1FA 3DYMA 4I6KA 3QN3A 2WHLA 4ERIA 2PU1A 3T9PA 3WDQA 2XGIA 3C0QA 3K4DA 2NQLA 4NASA 2BODX 3PBWA 4BEQA 4DF0A 1UCWA 3ZLHA 3NO3A 3A13A 4LT9A 5XIAA 3KVKA 3T78A 3FY1A 3R94A 4UFIA 3CXOA 4JTUA 3HPXA 5I24A 4N2YA 1TTIA 1KLYA 1K4GA 3T07A 1Q66A 5HWJA 5IOBA 3AS1A 5FEWA 2H9AA 3GG0A 3IWPA 5L9FA 2XG9A 3GU9A 1NFBA 1PDZA 3W00A 2CKRA 4ZGYA 4AW7A 4GUJA 3HN3A 4W85A 2C19A 3B9NA 1O12A 4XD4A 3W7JA 3UCDA 4MJ2A 3SBFA 4B5SA 4FXJA 4ASTA 2GOKA 4GJJA 3E1F1 2BY2A 4JFUA 1C8VA 3UR8A 2XVPA 2XINA 3PN8A 3C61A 4HK7A 3EOEA 2G4JA 1XX1A 1LL6A 5FJPA 1W3IA 1RP8A 3WDJA 1N8WA 3M41A 1XLDA 2ZA1A 2Q71A 5ABTA 4M29A 1DIOA 2D2OA 2WSRA 3U9IA 4E2VA 1H4PA 2VGGA 2FVKA 5T9BG 4OJYA 2P3EA 3KDOA 5G1MA 4G2DA 4S23A 2A1YA 3AMLA 1V6WA 4AWTA 1J0HA 3OP2A 2F38A 5BRBA 3CUJA 1MW1A 4I9AA 4JFVA 2IKGA 3QQWA 3W1AA 2W0UA 1B3VA 3KBWA 4WJ8A 1B90A 4NJJA 1ITUA 3IEBA 4AY1A 5AC5A 2OPJA 3AIUA 1AH3A 3WNPA 2Y70A 4B9YA 1MRAA 4RJEA 2JKEA 1W5PA 3KEHA 1WZKA 3LENA 5D2TA 3OLEA 5BYWA 4XO6A 3N2CA 2X16A 5BNKA 1ONWA 1H5VA 4MGGA 4RZ4A 1XGEA 1XPYA 7CGTA 2DT1A 2ISVA 4K36A 4AZHA 3VZXA 3UW6A 3G1SA 5GJPA 4UQAA 3WD3A 4W5ZA 1HG3A 1Q85A 3U7VA 1ADSA 2WJZA 2X1SA 3LTSA 5FF7A 3UGVA 5FSDC 4H41A 2XWDA 5LNVA 2W63A 3BCJA 3TZNA 5CJMA 4J40A 1L6WA 5BXSA 1PTGA 3CEPA 3LY0A 3ITCA 3MT1A 3FHAA 1Y7VA 5HQLA 3CH0A 3VGBA 1W9DM 2VJXA 1VRXA 4DZAA 1TCMA 2BASA 3ZYZA 3GZAA 1X39A 4H2HA 4MPQA 3TQ0A 4GQ0A 3S2NA 3I10A 5AY7A 3WDIA 4L7ZA 3UA3A 3ZXWA 3WD4A 5BMXA 4V15A 3WLOA 1VHNA 3PPHA 3NNTA 3FHQA 4UTUA 1NSJA 4HP5A 2DSKA 3V7PA 3TKFA 3BE7A 3W7DA 2Y7DA 1YNQA 1EXBA 2P53A 3SY1A 4Q22A 1E3ZA 4Q8PA 3GM8A 1VKFA 3BDKA 5H1WA 2R1MA 3AXMA 3QPYA 4WSKA 3CUXA 2W4XA 4Y2WA 4ZOAA 4L1WA 3ARXA 7XIMA 3WUBA 3PG9A 2I17A 4YTSA 2YBUA 4QITA 1XJBA 3RX2A 1O5QA 4RDWA 4U10A 4CD4A 4JDYA 2RH9A 1CIUA 3AROA 3B8IA 4N6FA 1W9VA 4MWAD 4S3BA 4X9YA 3OBKA 4MM1A 3Q37A 2Q3RA 4D6JA 2EPOA 1TJ2A 9XIMA 4BR1A 1TREA 3BXWA 1OG0A 4Z2KA 2OLSA 4IMCA 1Z69A 5CAHA 4XBSA 3TQVA 1W2VA 2OO0A 1EIXA 3QVQA 2A4AA 4IG2B 1KXVA 3LX9A 3WDPP 3GUWA 3L5AA 3LGGA 1GTEA 4BQ5A 2XFRA 2ZTJA 3IJ9A 3TLQA 3VIFA 3RHGA 4C6KA 3LZ5A 3BJFA 3IJ6A 1HQTA 5K4XA 3L5LA 4ML4A 3KE0A 2ZVRA 1W17A 1TA3B 5CLWA 2B7QA 1P1XA 4YJ5A 3SAZA 2ESCA 5C0QA 3W38A 3M0LA 3TFXA 4DPPA 5H8UA 4YXGA 2F7FA 5BZAA 2YL6A 3A24A 4IPLA 2YBTA 4RW3A 3GBDA 1NVMA 1Y5WA 1SSDA 4C6JA 2PDXA 3MSYA 3N3TA 1WDQA 2G97A 4MG4A 3N34A 1O66A 1HJSA 3GFYA 3O63A 1OD8A 4DJDC 1Q2RA 4PB3A 3BOFA 2VRKA 3U5YA 5I03A 3UZWA 5JH1A 3AYRA 3HGRA 4J27A 2DFAA 3WQVA 4DJDD 4TV6A 4DWDA 2VEKA 2HISA 3M5ZA 4PUMA 3EOSA 4ZA0A 3D5HA 5C5YA 4PMDA 1EZWA 2VKZG 1WE5A 1YIXA 3QGAC 3FJ6A 1JDDA 3HMCA 3L2MA 1AODA 1YHTA 4ZMGA 4GCAA 3MKCA 4ZTYA 3GBEA 1TVNA 4HSHA 4M19A 4Q7BA 1GNXA 4FNSA 1W9PA 2GQAA 2QV4A 4Z1CA 3PTQA 3FGCB 2DPEA 4WLCA 3FA5A 4AUBA 5HA7A 3CJPA 1PE1A 3AZRA 1IT7A 1E56A 3WF4A 1XH2A 1UD6A 1UMYA 3W7RA 1V8EA 1QNOA 3AIQA 2E8YA 4R88A 3EX6A 3HBLA 1XM3A 2XUCA 3ANYA 1WOBA 5A6BA 2EXOA 4UMCA 3P81A 2YLLA 2XWEA 3K1DA 2NLIA 1TR1A 1CX9A 4Q8MA 3KOFA 1IYXA 3QMRA 1A5UA 3SGZA 1JPHA 3APYA 1IXOA 3QGKC 2BVYA 4B92A 1FDJA 3D3AA 1ADDA 1UASA 3GU2A 1QRQA 1J4EA 1UPPA 2C1IA 1YNPA 3GDRA 2WVVB 1F61A 5J8LA 5DRCA 2NQ5A 2QAPA 2E1DA 5HATA 2CU0A 3UFYA 1U22A 5JBEA 1IR2A 3QV9A 3VDGA 4PA8A 2FGLA 2VWSA 1SGJA 3FIGA 3VGGA 1ZBCA 2QCLA 3LCWA 4MB3A 4GLEA 4A05A 2E7FA 3M64A 3NL5A 3SJNA 3ZT7A 5CLTA 4AQLA 1RLCL 4RW5A 3DIPA 1IWBA 1I75A 4AX7A 4JTIA 2F6KA 2ZWZA 4KS0A 5FD0A 1OZMA 1CNVA 1NJJA 2PRHA 3DEQA 4NRRA 1UWQA 1ZJIA 1VZWA 4DAFA 3SN0A 2QIWA 3DU0A 1R7OA 1HP5A 1UC4A 1XIFA 1SMAA 2QUMA 3B05A 4I3GA 2J6XA 3C2OA 5FF3A 4YN5A 4GHRA 4GVGA 3UVAA 3F5JA 4GXMA 1DQUA 5EMUA 2PURA 3ABQA 1ICQA 2DW6A 2JALA 3PR2A 4LFYA 2OELA 1LWHA 2CBJA 3IVTA 1TR9A 4UCFA 1BF2A 3C5QA 2NWSA 4O4WA 1U83A 1GKRA 4ML9A 4X63A 4L9ZA 4AG0A 5ABHA 1HO1A 1WP6A 2NV1A 4NVTA 1AD4A 5A8NA 4LOCA 1QVBA 2OZ8A 4ZFCA 1KGXA 3M0MA 3R13A 5J5RA 2A7NA 3CWOX 2J8GA 1RJRA 4N4QA 2ZYFA 4ACYA 4BI7A 3MO4A 4M81A 3VIOA 2A5HA 3VX1A 1E4LA 3C2VA 5AKQA 1TX2A 5CPNA 3V1HA 4L6DA 4UMAA 2AAMA 3NQVA 2F84A 4CQBA 4DBSA 1U5JA 1FWWA 3FFSA 5T26A 1JQVA 1G4TA 3NXFA 5EPDA 4QXIA 4I6VA 5E9AA 2IKHA 3KL5A 3T2PA 4QQ3A 1TUXA 1JCYA 4NNBA 2AGKA 4E5TA 2WCGA 4A3YA 4GUHA 2JK2A 4F3HA 2A6NA 2DT2A 1UWRA 5F7UA 4ILSA 4NZCA 3W1QA 2AMXA 4XK2A 3WH7A 3VXGA 3UBPC 3KOWA 2H8ZA 4HTBA 4Q32A 2OG9A 4C6PA 3EWDA 1LROA 3TVAA 4LXFA 1ZU8A 3OQ8A 1VJIA 3NQ2A 2Z27A 4LNCA 4WJEA 4LYKA 5GNZA 3AUOA 3DFOA 1WZMA 1I1WA 1W3JA 4RR4A 4JZ5A 1RAKA 1UW9A 4DBEA 3CQIA 4O0KA 3R10A 1QTWA 2A21A 4C91A 1RA5A 3ITGA 4ZXLA 3F2DA 2DW7A 3CU2A 1TZ9A 3T05A 3M0VA 4QEHA 2ZXBA 3SUUA 2E5BA 3QGVA 3MTWA 1W9XA 1EP3A 2VMFA 4DJED 1HGWA 5BROA 1J0IA 3BUVA 5I0DA 3V5OA 4PMXA 3KZSA 4KWVA 2INEA 4ZE4A 3UPMA 2C0HA 3INPA 2V2HA 1XIBA 4TXEA 1CPUA 3B8VA 1S2AA 2HVNA 1A47A 2EG7A 2ATSA 5DEZA 3SCRA 3B0UX 4UTTC 2Q01A 4OKDA 1WOAA 3QLDA 2PCEA 3BOXA 3FJ4A 1IXQA 3EPMA 4P8XA 3TJIA 4KFNA 4P7LA 4LCRA 4Y96A 3MV01 3AMCA 4C7FA 3CV6A 3FJNA 3EMCA 3HU7A 1BQCA 3WLJA 1W3KA 4R7OA 4WKAA 4S3GA 1A0EA 5A6SA 4UBPC 1VFSA 5FAGA 3DH7A 4DB7A 3THUA 2G3MA 1TPFA 1XDLA 2E6FA 4MWAE 1JPIA 3T6CA 1OBAA 3UR2A 3NURA 1OABA 3GDLA 1JIBA 1PL9A 4O0QA 4XSMA 3Q58A 4EE9A 3KOYA 4PRRA 4E0CA 3N6JA 1N8FA 4IFOA 5BU9A 3N9KA 3FVDA 3UVIA 1XLCA 3H7VA 2QULA 4ADTA 1OYBA 1EEPA 3G1HA 1SZFA 1DWJM 2AKMA 1C8XA 2OGYA 2WPBA 9CGTA 1EJSC 3S9YA 1E6RA 3CL6A 5CBIA 4CCZA 3WBAA 3LI1A 3LNPA 1KXHA 3O16A 2WBKA 2W66A 3QYQA 4GA8A 1J0JA 4PUNA 4GQRA 1LTDA 2RDUA 1IWPA 5G4WA 3WNNA 4IT1A 5BOOA 4EPBC 4E3VA 4O8AA 4M6QA 1YKWA 4FXSA 3TTSA 1YE6A 3S0CA 3ICJA 4LEQA 1QI3A 3WQ5A 3M7WA 4WDWA 2AMGA 2FPTA 5M1TA 1OGGA 1GZJA 3LRLA 3O0KA 2WJFA 2Z1WA 2ZXQA 1A5BA 1GOMA 1RQEA 2FPYA 5FA5A 2XU2A 2E9MA 2F61A 1WUFA 3TA9A 2XDFA 4Q8NA 1IXPA 2FZDA 4HB7A 4L6OA 2J13A 3E12A 1O94A 3G8RA 2DZAA 2XVKA 3TC7A 5I6SA 2I9EA 1S5WA 4JQ2A 3UGRA 3R79A 3HIJA 1NTHA 1EX1A 3GHUA 5HJYA 5A6MA 1I8JA 1QHOA 3MCOA 5EMJA 5K4ZA 1HJUA 2PWHA 3FYYA 4GISA 3TYDA 4PZVA 1QW9A 3DN5A 5XINA 3MU7A 6REQB 4DZIA 2A3BA 2YIHA 1MQQA 2FYMA 5GJNA 4RNFA 3E2VA 3QPEA 3AHXA 2VCAA 3UG4A 5FOOA 4DHGA 3OLIA 3AOFA 1MFUA 2ZUTA 4IHCA 1LLWA 1E6NA 3E0IA 1WAWA 4UR7A 4KGJA 3LUTA 4PUWA 3N6QA 2YJQA 2QEZA 3CT2A 4OGZA 1LLZA 3SUSA 5FEXA 1VBGA 3LCGA 1I6NA 4LC8A 3N15A 2ZIDA 3AHVA 1RJQA 3H22A 2JIEA 1MO0A 2VRQA 2E0PA 4WDTA 4C6IA 4RE4A 3AIVA 2WMHA 5AC6A 3IANA 4FOJA 4N42A 2I14A 3CUFA 2WC4A 1A50A 3BQ6A 1T8QA 5I02A 4QDPA 4ZZ9A 4UTTA 3T8LA 4FS9A 4US5A 2ICSA 2A7RA 1G9HA 3OIHA 3T40A 3S8HA 4KFPA 3UEQA 1UOZA 8XIAA 5E6YA 4I9TA 1IF2A 3ZS4A 3LA4A 3RF9A 4LH8A 3B0PA 5I06A 1NQKA 2WVUA 3RXZA 1UH3A 4EAYA 3AXIA 1VGAA 2KAUC 4JY8A 4CNSA 3LCLA 2GSHA 3RCMA 5CGMA 4W93A 3VGDA 1WQ5A 3GLCA 4ATWA 4J2PA 4KCVA 2I16A 1FTXA 1E9IA 1KM4A 3ZT5A 3NO5A 4QG9A 1PZ0A 2G3JA 1M53A 4QHRA 2GGGA 3AQUA 1KKRA 2B7OA 5EMKA 1GGOA 1JYXA 2XIBA 2YA1A 3LB0A 4HNNA 3SCQA 5DCEA 1VBRA 1KLZA 4GH1A 4J3VA 4AU0A 4L6HA 3S1XA 3I3DA 3MVTA 3CPUA 4JTTA 4WY0F 2FMNA 3OHIA 3HM7A 4H04A 2HBXA 3T8QA 3HJZA 4J28A 2NX9A 1QBAA 3CUGA 4GXWA 3ALFA 5CPSA 2IS7A 1V02E 1BAGA 5E09A 1UWTA 3ZVHB 3VA8A 2VR5A 2Y89A 1J5TA 4LY8A 3W4RA 3WL0A 5CC7A 2CZFA 4JTEA 3VUPA 1MQRA 4YYCA 3N19B 1FUYA 1JCJA 5DBTA 3W2UA 3N9RA 4XZBA 1SO6A 2YBVA 2FH8A 4RZ6A 1A5OC 3AWOA 4AC7C 4EVZA 2JGQA 1E4IA 4IISA 3ME3A 4JFTA 1L2QA 3L4VA 1SFTA 3T0BA 1H09A 4DEFA 4JIPA 1OK4A 3JU2A 4DN1A 1HF6A 4GINA 3RAOA 4Z08A 4FMVA 3CWNA 3NG3A 3W6YA 4UIOA 4ZB5A 3G1YA 3PJTA 1YQ2A 4GYPA 1OIMA 3MY9A 2OLAA 1YDVA 2OQLA 2DJXA 7ENLA 1GEQA 1HVQA 1T8XA 3KVJA 4IFRA 3N73A 1VJZA 1J0ZA 1PHQA 1V08A 3U7BA 3G1XA 5AHEA 1IZKA 5U7SA 5K9DA 4JICA 4JL2A 5AC7A 3DOPA 1JZ3A 4DWSB 3EEZA 3TQPA 4UZUA 4MUPA 2EKGA 4BQ2A 1FOBA 5IHSA 2WNWA 4HJFA 1LRNA 3BAJA 3SY5A 3VNKA 3RJXA 3EEGA 1MDRA 3UCCA 3DFQA 3C2RA 4X9SA 4GY0A 2PB1A 1UR3M 5LGZA 3M5VA 2NLYA 4HGXA 1ME9A 4DO6A 1ADOA 2Z25A 3DERA 1DHPA 4WZHA 4MADA 3TYEA 3TAKA 3T55A 3NPWA 3MUXA 3CUZA 4ORMA 4ZSUA 5A6KA 2P76A 3HQNA 2VYOA 1OT2A 3H2MA 5HNNA 1CXIA 1QPRA 3SN4A 2EPNA 2VQTA 1EYWA 5CSUA 3NQAA 4L1GA 2IKIA 3IVSA 1V51A 3LSBA 3CHEA 1DQWA 3L0NA 3H2OA 4AXNA 4RUBA 3CIVA 3W1LA 3ALGA 2RGLA 4P5UA 3KLLA 4EPDC 3H2AA 2Z1VA 2D0GA 4FOUA 4N7QA 2ZX6A 2AQVA 1HIZA 1EQPA 3O6CA 4I8YA 3W88A 3I6RA 1LCOA 2NSOA 3G8EA 3POHA 4ZQRA 3TYBA 2UY4A 1XWYA 1CI1A 3CC1A 3VYLA 3TP4A 3THAA 3R58A 1NDWA 1E1CA 3ABOA 1QOQA 1G94A 2Y61A 1ODUA 4RNHA 1YPFA 4PMYA 3LV5A 4QROA 4AYSA 1JCTA 2GVYA 4PRWA 1M5WA 4QDWA 2V82A 4ADSA 4P7QA 4Z0JA 1H1NA 2UV8G 5AYIA 4ZO9A 5BXRA 2OU4A 4L5ZA 1EBGA 3OA5A 2Z1KA 1W91A 2X05A 3F5LA 4H9YA 5C6MA 1R38A 4EKJA 1DIKA 3M9YA 4BK9A 1R9ZA 1MW3A 3B06A 4NG3A 4W8LA 1ONEA 4WVXA 1HKMA 3K1GA 4L80A 5EMYA 3VNDA 3L4TA 3ZT6A 3IPWA 5HWNA 1A3WA 1LF1A 1Q6DA 2F6UA 3VDCA 1XLIA 3GTIA 3CQKA 4UTIA 2WOQA 3R89A 3GDTA 2XM1A 2R24A 5A2CA 1U1JA 1O4UA 4FLSA 3QSRA 1PS9A 2PEVA 3LCIA 2R14A 1F4AA 3GSMA 4RX0A 1UKTA 2BOGX 2AAAA 3VKKA 1M7PA 4XZMX 3CIXA 4LV4A 5E9XA 2XVGA 1JEZA 2DY3A 3ID7A 1E4MM 4G7EB 4V27A 1TQJA 4J35A 5D33A 4JIEA 5HPOA 5A6BD 4HVXA 3I3EA 4L4MA 3BLOA 4Y90A 1JCLA 1SJDA 1RBLA 4UFLA 4DM2A 3ONBA 4XAPA 2V5KA 5HMDA 1PWMA 5ENLA 3VCRA 2Y1HA 5M5DA 4CEXC 4YU1A 4HMNA 4PMVA 2R1PA 2DSVA 4FLOA 5CGTA 3VIMA 1ZTVA 3UWYA 2DSUA 4LAZA 3L9CA 1C3FA 1OM0A 3VPLA 1MQPA 5FIPA 1JVNA 4YMZA 1ME7A 3ARRA 1HGYA 4Y9MA 1EHAA 3BCFA 5D2XA 1MNSA 2D2HA 1ZRQA 1IEIA 3W2NA 3ABXA 5KTLA 1B3OA 1OINA 1XRTA 3L65A 1Z9AA 5KSWA 5E0KA 1VBHA 4G7FA 4QS5A 1ZUAX 1VPYA 4YLWA 5FF4A 1BWLA 1H0IA 1MFVA 2G3NA 1FWAC 1F7BA 3J7HA 2HVOA 5K7JA 1L6SA 2V3DA 3ES8A 4QGCA 3PZMA 2X0HA 1DKWA 4IMEA 3WQWA 3B9DA 4JR5A 4DI9A 4C6DA 3SSJA 2PWGA 4DYKA 4LQ1A 2CWNA 4K2SA 1Z48A 3KCLA 4O19A 1UP2A 3IJ8A 2XZ7A 3N17A 1S5TA 4UFMA 1K9DA 1NWUA 1OX4B 4J9JA 3MI2A 3PM6A 4DJEC 4WIWA 1MXGA 2PDQA 3O06A 1E6PA 3TWAA 1H7PA 3W81A 1XYLA 4HOXA 3GW0A 1LBLA 2EF9A 1WBJA 3UNDA 4IMAA 3GH7A 3B04A 4LRSA 2BHZA 5HOSA 3G1DA 1PX3A 2BVDA 4A21A 3GNOA 4HHHA 3USZA 1H5YA 4JIHA 2POZA 4IMFA 1V3LA 4LVFA 4O14A 4V2XA 1TPDA 2C15A 1XC6A 1GZ1A 4MY9A 3W71A 1XIGA 4F4RA 2CLMA 1Q6EA 4JTKA 3VZYA 2WSKA 3LXAA 2YZ5A 3QKZA 4GIEA 4QLJA 2WZIA 4DLFA 3REQA 3C6CA 2WV8A 3S9ZA 4JTCA 1OGBA 4AIOA 2BXZA 3VKCA 2QS8A 1KR0A 1X1ZA 5JVLA 4MIMA 1D3CA 1O5KA 2DZWA 3PPCA 3N18A 3ZWSA 4KKXA 1OFDA 1A5CA 2IKJA 4UOZA 1UKPA 4QP0A 1TFVA 3DFHA 4Y9PA 2NXHA 1V77A 4KRUA 4AYGA 3IGUA 3ZJ7A 1HX0A 1EXPA 4HCLA 3OPSA 1G4EA 3FEQA 4BQ4A 3ISIX 4CN6A 1U1HA 2Z6IA 3I68A 2E4TA 1OFPA 3TUUA 1RP9A 4O17A 1VPXA 4YHEA 2JKAA 4O1AA 2XGBA 1TKKA 5B7ZA 2WMIA 1XF0A 3WJYA 2WVVA 1FQ0A 3AFBA 1R7AA 1OK6A 2XIJA 3NO1A 1XW8A 4IGHA 1UKSA 4AD1A 3IRSA 2Z1BA 3EX4A 2A3HA 1JL8A 1B31A 1H63A 1R9YA 2ISFA 4F79A 2XPKA 4D1IA 1GYLA 2J4GA 1BGAA 3M4HA 4Q6XA 3WZ0E 1ENUA 3EBVA 4PL1A 1ALDA 3EDDA 2VUYA 4LUTB 4WY0A 4FI4A 1UUMA 1SFLA 3M0HA 4QRNA 1POKA 1UQZA 1EJTC 1FH7A 1Q7ZA 1CENA 1XKYA 4RE3A 3QC3A 3SURA 2BVTA 3GZ3A 4HNCA 1ISXA 1WX0A 4XIMA 2YCLA 2ZRWA 2CLIA 4WR3A 1QHZA 1K9TA 3WMBA 3M1ZA 1XIJA 1UB3A 5FJUA 5A8OA 3ERPA 1EJWC 5G5IA 3HQ1A 3BV4A 1EP1A 4L64A 5A95A 2ZICA 4GY7A 1R2TA 3RPDA 5DELA 4O1BA 3S83A 1E70M 4QTGA 4RZBA 3CB3A 1XRSA 1JUKA 3M6DA 1GQNA 4GUGA 4ATDA 3BLPX 4QJ5B 1JYWA 5CKSA 1DIEA 3MBDA 1SO5A 3A3WA 3VZZA 1E6QM 5A3HA 3N14A 4IX2A 4IP5A 2ZX8A 3EX2A 4PB4A 1DHKA 2EPHA 1V4YA 2OZTA 1KRCC 4D8AA 5TBOA 3TXVA 1JZ5A 4AZ5A 4JIQA 1F5ZA 2CZEA 3MYPA 3LCFA 5DLCA 4KQNA 3W85A 1Q2SA 2J7GA 3SI9A 3JVAA 4B2DD 3UP8A 4JCLA 5I3FA 1V6TA 4S3CA 4HNOA 4O1FA 1MVYA 3UJSA 4JQAA 3UF9A 1EBHA 4JQ1A 4ZODA 2BG5A 2WYSA 2Z2UA 4AZCB 3Q4DA 4K7VA 4NL1A 4H1ZA 2YFOA 2ZRVA 1UR1A 2A79A 3TYAA 2XISA 2V69A 4NX5A 1AJZA 1G01A 1XLHA 5HXMA 1PTDA 2UY2A 4LW7A 4MJ4A 4QEEA 5HULA 4NAEB 1EC8A 2WANA 5MF5A 2YKKA 1RV8A 2DZTA 1TV8A 1YRRA 3TDFA 4LCSA 3O7UA 2ZTKA 3W7MA 4E38A 2OYLA 3GY1A 3IAPA 1F3EA 1LT7A 3FYPA 4LNYA 3MMWA 2Z4GA 5A94A 4DAIA 1RCQA 1L6FA 4I9JA 3MUIA 2PP1A 2R91A 7TIMA 3NQBA 4IJCA 1VFMA 2Z1SA 4PEKA 2WCAA 3AI0A 3AALA 1HTIA 2BTMA 4AEFA 1UIOA 1UR8A 1X8FA 4P7NA 1W5OA 2ZCGA 1I0BA 3VI2A 3K46A 4M82A 3U2CA 2UBPC 2PBGA 5C2GA 4PTVA 1XLLA 5AOUA 1I2OA 2Q02A 5C70A 1NARA 4US6A 4GXPA 5F1VA 5C9RA 1X98A 3QLLA 3UXLA 2OT0A 4WF7A 1CGUA 1EDQA 4JCMA 1BSIA 3P6LA 3QC0A 3RCYA 1AQMA 5J5DA 3IJIA 2WWDA 3GYCA 1P0NA 5K9XA 4F0LA 2HK1A 2EG8A 1CZ1A 2QVNA 4LSBA 4HCHA 3MSDA 3VKDA 3RU6A 3O1NA 1I0DA 2Q6ZA 3UPBA 4CKQA 4FR1A 8A3HA 1KQYA 4ZCWA 1TTPA 3HZ3A 4WSJA 3W27A 4LF1A 1YEYA 1W54A 1IT8A 3N1AA 2OVLA 1LLOA 4G1KA 1BYCA 5BCAA 1XFBA 3R4IA 3W7KA 1XL9A 3LERA 2OZ0A 3KDNA 2GDQA 3C3NA 4D6DA 3QM3A 3V1PA 4W5UA 3H21A 5KZEA 3BLLA 4NU7A 3W76A 2PTYA 4HK6A 1ML1A 4RZ5A 3GWQA 2YDQA 1UZ4A 1CB2A 2J7HA 2P0OA 4XSLA 4JGDA 7REQB 1WDPA 3BLFA 4BEUA 2DVTA 1S2VA 2IPJA 1L6GA 3MHFA 1FWEC 1JUEA 1KRAC 4ZSTA 3MI6A 4HYWA 4XKYB 1TRIA 3G3DA 4GYPC 2NQHA 3HMJG 4QS6A 5AHNA 4R27A 2XJ7A 4NI8A 1YYAA 1OHLA 4I7WA 4GZIA 1DXFA 4B91A 2PLMA 3A3XA 4LB4A 2RHGA 2ZZ6A 4KWOA 2QYGA 3PNUA 3WK1A 2Z1XA 2PBOA 1V7YA 1QPKA 4H8UA 1LDCA 4DO4A 4C7GA 1R6WA 1SW0A 4ZVJA 4X60A 3WLLA 5F2GA 4XZWA 2BV9A 1T6MA 1TTJA 3TZFA 2E1WA 4BY3A 1TZZA 3FCPA 2XHYA 1FVPA 4F0MA 5I3HA 4X61A 5I3IA 4YYFA 4Q3MA 1XYZA 4MB4A 2BBFA 2VELA 1RY0A 4D6GA 4G9PA 3PZUA 4U3CA 4ENLA 3W1XA 3MZ2A 3SEPA 1US2A 3S6TA 3N3MA 2Z7KA 3VFLA 1HN1A 4OIFA 2W61A 2P88A 4CUCA 4U2ZA 3LZ3A 3FXYA 3MI3A 4PUEA 4EIVA 4UR9A 3VE9A 3WNMA 4XTDA 4U5KA 1MDLA 1RVGA 3B9OA 4OOZA 3WQGA 2Z24A 1G67A 3JZUA 1XKJA 3RX4A 3L12A 4QNEA 1YDOA 3QV7A 4DBUA 1HO4A 1ZNNA 4F66A 3USBA 1WDSA 1VBJA 3NZRA 4H9VA 1X96A 4AY7A 3FDGA 1XP3A 3V5CA 2CBIA 4AEOA 3F7JA 5FSEC 3T09A 3VTRA 3WUGA 3SCVA 1UH4A 3AJXA 3JR2A 1XHGA 1NAL1 4FEZA 1CWYA 3AHZA 4RV8A 1D8CA 2QJHA 1RQHA 4PUJA 3PANA 3UR7A 2X1IA 1DOSA 3ARYA 1SR9A 2ASHA 2FTPA 4C5YA 2J25A 3F4NA 3FEMA 1TVLA 2DGAA 2QJIA 1QPNA 3UZ5A 1AQHA 2VEGA 3NL2A 1PWLA 4KH2A 3LYEA 4GD0A 4U4MA 2PDCA 3QZ6A 1GUVA 2DDXA 2G5WA 3W75A 5C8BB 3M7SA 1WV2A 3C0LA 4B16A 3MO7A 3UU0A 1PCKA 3WNOA 1OD0A 4AISA 3AIEA 2IXUA 1JCNA 4E4PA 4XV0A 4W7UA 2DUXA 3W1MA 1OWQA 2FQIA 4JHOA 2VX5A 8XIMA 1TSIA 1EDTA 1G0CA 3JZEA 3UYIA 3AMGA 3RUBL 2RDWA 1BSLA 4Z1DA 2ALRA 4EAMA 2XYLA 5F2LA 4ZB2A 4HPGA 1BTMA 1KGWA 3RLVA 5CZSA 3GE7A 2YCIX 5H91A 1KCLA 1KNWA 3GNRA 1J0YA 2VGIA 5IBXA 4BHYA 2H6RA 4Y9NA 1VAHA 5HQMA 3WJSA 1NF0A 1BVNP 2QCDA 4Z1BA 2Z0IA 3PUOA 1K7FA 1KR1A 4IJRA 4FALA 3PFMA 2OEMA 3VDAA 3VGEA 1Q7QA 3GC5A 5D05A 3O6AA 4GKLA 2FZBA 2DIEA 1MEWA 2XSAA 5EYWA 4KESA 2JGYA 2DORA 3V0SA 5FCZA 1LT8A 2VFDA 6CGTA 5LSMA 4NAFA 1FCUA 4ECLA 1UA7A 3T2QA 4JTSA 6XIMA 3H8AA 5LNWA 3FAWA 3KBJA 4HZ6A 1P4CA 5G4HC 1RD6A 3HG3A 3L4XA 3EX1A 3HV8A 2IMRA 4KIRA 2GWNA 1NFPA 3LGDA 1Z3NA 2ZUUA 1SZRA 1WCGA 3UWQA 1XD1A 2J9ZA 1J10A 5I09A 1P7TA 2YX0A 1A5NC 4YTTA 1EKOA 1NH6A 3URQA 3V0TA 1RVKA 1HJQA 2GOUA 5I00A 4TUFA 3STCA 1V3JA 5LIYX 3QR1A 3SCWA 1ISZA 3NOEA 4PBGA 1KWKA 1LG2A 1F4HA 1TPUA 1H7NA 3ITOA 1FWCC 1CYGA 3DX5A 3AC0A 3EA2A 3TTQA 2QV5A 3OW1A 3WF0A 1U1UA 3MSRA 1X7FA 2VDHA 4F0SA 3KCOA 5I2UA 5D9NA 2P50A 3IRDA 5JQ9A 2WNZA 5CG0A 2ZQ0A 4PMJA 3QY6A 4BWLA 3LXBA 1F74A 4JBRA 3RDKA 4QBXA 3LCXA 3WDRA 2WW5A 2YXOA 4TVUA 2Z6JA 5A2BA 4UTWA 5AVHA 1A80A 3BLIA 5AYZA 5HR7A 2ZXDA 4GQQA 4WXZA 3AHYA 4HNVA 2XSXA 3LHVA 3W7OA 4DLMA 4X0VA 5TQLA 1D8WA 1W1VA 3O0FA 3LHYA 4QM1A 4YVVA 3NQ6A 1H60A 3UD6A 1UKQA 4QJ1A 2NW0A 1KFKA 3TEVA 1F07A 4A29A 3IJDA 2VD9A 3EXRA 2DT3A 1L6YA 2YCLB 3TW7A 4CQCA 3QR0A 3S6DA 4D6HA 4UWMA 1I60A 3RGTA 4ICMA 1HUVA 1M04A 1MWOA 3K2GA 1QI5A 1KKOA 2HV5A 1F8MA 4JIIX 5M03A 3BLDA 2Y24A 2QPXA 5A5WA 1WKDA 2CFFA 3SCNA 3VIPA 2GDVA 2CNCA 4WK9A 1NM9A 1CGXA 3G6MA 3BQ5A 3W70A 1KXQA 1ZP4A 4WKHA 4QNWA 4NJKA 1QNVA 5HUOA 4BF9A 4UTHA 1J96A 2YFNA 1X6LA 1TVPA 4J3SA 3KW3A 4U5IA 4ROQA 4N02A 2GUYA 4KCUA 2FFIA 3S2CA 2NT1A 3UG3A 4DQWA 2NXGA 1JZ2A 3HFTA 3UWUA 2PWFA 2Y6ZA 3B9EA 3ITLA 4Y6GA 4B90A 2QW5A 4RL3A 2OXNA 3ZR4A 3M47A 4KEMA 4Y8FA 4RXGA 1BG4A 3P67A 4YIWA 3UXIA 1PZ3A 3B8WA 4GQGA 4RPPA 3VIGA 4F40A 4R34A 1VFLA 2GVLA 2YB1A 3UERA 4US5D 1QMLA 4XVDA 4O0ZA 1QATA 3GXMA 3M16A 1W3LA 4KETA 2VI0A 1VP5A 2PWVA 4DELA 4LV9A 3RLUA 1R87A 1OFEA 5K3VA 1Q7MA 3EOLA 1NDVA 1