3RX3A

Crystal structure of human aldose reductase complexed with sulindac
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx3A00
4H8NA 3P2VA 1X96A 4WRHA 3WBXA 1MRQA 4JQAA 1Z8AA 1RY8A 1PYFA 2IKJA 1HW6A 4LBRA 4GA8A 3D3FA 4WDUA 4ZFCA 3R7MA 3V35A 3CV7A 3V36A 3M0IA 3V0SA 3H7RA 4XZNX 4WGHA 3CMFA 3ONCA 2PDCA 3R43A 4HBKA 4XK2A 2IQ0A 4XO6A 4Q7BA 1YE6A 2IKHA 1PZ0A 4JIRA 4HMNA 2I17A 1PWLA 1XGDA 4DBWA 3QKZA 4WEVX 1QRQA 1T40A 3T42A 4GIEA 3C3UA 1US0A 2PDHA 4QBXA 4G5DA 1YNQA 1EL3A 1S1RA 2F2KA 4ICCX 5AZ0A 3KRBA 2R9RA 3LEPA 3MB9A 1ZQ5A 2AGTA 3ONBA 3G5EA 1PWMA 2INZA 3UWEA 1FRBA 1EF3A 2PDLA 2PFHA 2PDPA 1K8CA 3FJNA 2DUXA 3EB4A 1EXBA 2PDFA 2ACQA 4YVVA 4LB4A 3BCJA 3LUTA 3V0TA 1AH3A 4GABA 5HNTA 4I5XA 1IHIA 1VBJA 2IS7A 2BGSA 3F7JA 2QXWA 1M9HA 2HVOA 2DV0A 1QWKA 2PD9A 3LZ3A 4PRRA 4NKCA 3N6QA 5LIUX 3WBYA 4PUUA 3UP8A 2HEJA 2WZMA 4L1WA 1R38A 4QR6A 3LZ5A 1C9WA 2ACRA 4XVEA 3LQLA 2FVLA 2IPFA 1VP5A 3BV7A 4GACA 4JQ1A 2NVCA 2FZ9A 5LIKX 2R24A 1A80A 4H7CA 2HE5A 4FAMA 1AFSA 3LENA 5JH1A 2FZDA 4QXIA 2INEA 4LBSA 2PDKA 1Z3NA 4JQ3A 2BGQA 2NVDA 1ADSA 2ALRA 2C91A 4JTCA 2P5NA 5LIYX 4XAPA 1HQTA 3EB3A 4XO7A 1LWIA 2PDNA 3S3GA 1AZ2A 4ASTA 1OG6A 2HVNA 3N2TA 3EAUA 1X98A 2IKGA 4IJCA 1YNPA 4JTRA 4IJRA 2IPJA 1ZGDA 3UZWA 4YVPA 3U2CA 4IGSA 3BURA 2ISFA 1AZ1A 3H7UA 4XZIA 3RX3A 4PRTA 3LBOA 4DBSA 2ACSA 4DBUA 2PZNA 1UR3M 3GHUA 2PDGA 4YS1A 4F40A 4FALA 3R6IA 5LIWX 4JQ2A 4PR4A 3RX2A 3LN3A 4WDXA 3LQGA 4EXAA 2WZTA 3CV6A 1YE4A 4PMJA 2BP1A 2F38A 1RY0A 3O0KA 3Q65A 3R8HA 1XF0A 1S2AA 4R9OA 4WDTA 1EKOA 1T41A 2ACUA 3WG6A 5LIXX 3UYIA 3WBWA 1IEIA 3M4HA 3VXGA 1GVEA 4EXBA 2PD5A 2PDUA 4XZHA 3CAVA 5M2FX 5DANA 2PDXA 5C7HA 1AH4A 1SM9A 3B3DA 2IQDA 3ERPA 2HDJA 4YU1A 2IKIA 1Z9AA 1AH0A 4LAUA 1MI3A 4L1XA 4OTKA 4WDWA 3CASA 3R8GA 4JIIX 4JTQA 4PUWA 3UZXA 3COTA 1ZSXA 3DOPA 3GHRA 4XZMX 1XJBA 1S1PA 3FX4A 4GQGA 2I16A 2HV5A 1S2CA 4QX4A 3Q67A 1RALA 4MHBA 2DUZA 2PDYA 3R94A 3O3RA 3V0UA 3RX4A 5HNUA 4FZIA 4GCAA 4JIHA 2FGBA 2CLPA 3M64A 2PDQA 1Q13A 2IPWA 5KETA 3NTYA 2PDBA 2FZ8A 3UZZA 3GHSA 4JQ4A 3UGRA 4XVDA 4FA3A 2FZBA 1MZRA 2PDIA 4JTDA 1JEZA 1J96A 2VDGA 3R58A 1PZ1A 3UFYA 2A79A 3DN5A 4Q3MA 3LD5A 5AZ1A 1Q5MA 2PDWA 1Z89A 4JTAA 4GQ0A 5JH2A 3GHTA 3UZYA 3WCZA 4LAZA 1X97A 1ZUAX 4XZLX 3CAQA 3LNMA 3UG8A 3G1RA 4LB3A 3GUGA 2HE8A 2J8TA 4AUBA 4DZ5A 4RPQA 2PDMA 3MC5A 2PF8A 5HA7A 1LQAA 2PEVA 4YVXA 3BUVA 2IPGA 3H4GA 2PDJA
chains in the Genus database with same CATH superfamily
2NX9A 5K4ZA 1KM1A 3F4VA 5I3GA 3LI0A 3GXMA 1QT1A 3UCQA 1CBGA 4GH1A 4PC8A 2V68A 5D32A 4NZCA 2WB5A 2VZSA 1SFTA 3HURA 1Y0EA 4RV8A 1I8JA 3VD5A 5A8PA 3CXOA 5J04A 4E2DA 2J25A 4J3SA 3MCOA 1KBJA 3M9YA 4HBKA 1TPH1 5T26A 1EBGA 3BK0A 1UC5A 3GTIA 3LXCA 4OUEA 5F4XA 3WMSA 2BGNE 4JIRA 1REQB 3WLPA 3N17A 2FHFA 4NSBA 1POKA 1PWLA 2O56A 1JDFA 2VD9A 3BGGA 3M46A 3PJTA 3QW3A 3BH4A 3G0SA 3T1GA 2GZXA 3KBSA 3QOMA 1FCUA 4TO8A 4FMVA 3I68A 4ZB5A 1T7LA 2X41A 4M6VA 4A21A 5D09A 4IQDA 4J3UA 3WD4A 3MP3A 1RXOB 3W76A 4MJ2A 4JYEA 1OBAA 3E0IA 3TX9A 2G8ZA 1GG0A 3NPUA 1A5BA 2P0IA 3R11A 4C6IA 2P8CA 1OB0A 1GVQA 4U28A 3BQ6A 4X9YA 1Z7AA 3FJNA 1BGGA 2WQDA 3ITVA 3A4WA 1PYMA 1C8VA 3NQ8A 4E8CA 1J8VA 3LGGA 2EEXA 4AHPA 3TFXA 2PRMA 4QJ3B 3V0TA 3KVLA 1IR2A 3TTEA 1NF7A 5HNTA 1LBLA 4S3FA 3S1GA 5DN1A 3S6DA 4FNQA 4E4FA 2CESA 2TSYA 3VKBA 4H6QA 1IHIA 4XV0A 5A95A 2GK1B 1XM3A 5BWFA 3HGOA 3HG4A 2GLKA 1WXJA 1L9WA 2E28A 4FLQA 3A3HA 3EB2A 1AW5A 3SUTA 4U31A 1ME7A 3KRUA 3KRSA 4NAEA 5KINA 5CCZA 4UFHA 2CHNA 4NKCA 1TSIA 3FW6A 2ISSA 5LIUX 2Z6JA 3VNKA 4B92A 1TMQA 2B81A 1OD8A 4NP7A 4DX3A 1JD7A 2R1NA 4ZBCA 5CJMA 5G4EA 4NHVA 4QE5A 1A5NC 3UJRA 5M1TA 2FZMA 3RUBL 2ZZ6A 2R1PA 4D8ZA 3OQEA 4JY8A 1VPQA 2CZ5A 4K7VA 4M5PA 4UQ9A 4QAWA 3P61A 4DYKA 1Z3NA 2YSWA 1WAUA 3WF0A 2ALRA 2V5LA 2Y0FA 4DELA 4IIHA 1FKWA 2WNNA 2Z24A 3GNOA 3E2VA 3VD7A 4A8LA 1PPIA 3U4AA 1VD6A 2VC6A 1R87A 1W8GA 5H91A 3TJIA 3NPXA 5U7SA 3XINA 3BGAA 5JBFA 1XBZA 3HU7A 3VDBA 4GLEA 2VDHA 4F8XA 4JN8A 4FK9A 4K8GA 4DJDD 1UIPA 1UBPC 1X7FA 1YXCA 3EX1A 1RVKA 3BARA 4KIEA 1QBBA 4C5ZA 5A8OA 4ONVA 2CERA 3K2GA 1X1OA 1Q65A 1VFFA 3O0FA 2J7FA 5CJ5A 4F0RA 4FSAA 2NQ9A 2VGIA 3KL5A 4XIMA 1T8QA 3W7MA 4CQ9A 2CLLA 4PR4A 4Q7NA 1HKKA 3BW2A 1TPB1 4XAYA 1AQ0A 1QI4A 3TV8A 2DPEA 1S2VA 3Q45A 4MFDA 1REQA 4AY8A 2AL1A 2XVNA 4V2XA 2VCCA 3FLUA 3LXAA 1Q6LA 3U7BA 4RCXA 1XSKA 2WMJA 1EKOA 2ACUA 2A6NA 3IJ6A 1LQ2A 2PWEA 1VGAA 3DI1A 1F6YA 3GYCA 5EMJA 2NZLA 4O4WA 4IQLA 3EWWA 4FIRA 2YL9A 2CZDA 4X3ZA 1IWBA 2PD5A 5M3WA 2WZHA 2OB3A 2ZYFA 3NG3A 4H9MA 5CZTA 1NSJA 2QF8A 1IZCA 4PGLA 1MI3A 1KM3A 1H51A 2YCJA 4IG2B 5CPLA 4US5A 4PUDA 3K8KA 2VOMA 3GHRA 3KUMA 2VRKA 3EX6A 1EHNA 4MKSA 2HV5A 1D2KA 4HA3A 3EWDA 1F3XA 3U4FA 1HO1A 2GK1A 2DUZA 4XAGA 1D7KA 1QI0A 2FVMA 3BICA 3GTFA 4C7DA 3DCPA 1F3EA 1M03A 3OG3A 4S2CA 3CQIA 1XIGA 3L5LA 3MJYA 2ABBA 1FWNA 1BWKA 4C1NB 3ECQA 2JGYA 2TYSA 4EE9A 5HATA 4I5UA 5EA9A 1MZRA 1OCBA 2PDIA 3BMWA 4JTDA 4MMWA 4HJFA 3OVRA 1P0NA 3MMDA 3E96A 3QPEA 3UFYA 2OR2A 3DN5A 4ML9A 5EMYA 1DJYA 3VC6A 4OU1A 1TPEA 3GVRA 4C7FA 1SR9A 4KWSA 1YXDA 5E9XA 3WUEA 2PWDA 4CGTA 2BVYA 4LVDA 4TMCA 1PKMA 3EZ4A 2YDSA 1RQHA 2AAAA 3MUZ1 1UD8A 3D6NA 2QUVA 4JD4A 2PF8A 5C7VA 4QEHA 3IJDA 4KWOA 4WVXA 3T09A 4L61A 2HBXA 3NZGA 5HWNA 5A6MA 4V27A 4DUOA 3LPOA 5LXEA 1JNDA 3MKCA 3W6YA 4O1EA 3R10A 5CC7A 4X22A 1VRDA 1BLIA 3EMZA 2OCZA 4GZEA 1JZ4A 3HQNA 1ZP3A 1QNOA 1FWAC 3DFSA 4WLCA 1CDGA 1L0PA 1WOBA 3RRXA 2QUTA 1UC4A 1HG3A 3EX3A 4B16A 3SFKA 5CZJA 2O7SA 1JZ6A 3N12A 1HIZA 1K4GA 3DH7A 3F5LA 1L6WA 2KZHA 4AMAA 1V6UA 3MCMA 3S5YA 3GDTA 2OWCA 3WFAA 2BNJA 2BHYA 1J0KA 4CU7A 4UOZA 2X1SA 1LTDA 2W6RA 4FR1A 1V77A 3C3UA 4MF4A 1BPLB 2FTWA 2VFFA 3A47A 2UY2A 1EIXA 2WLZA 2DT2A 3KTSA 1RLCL 3AQUA 4IIDA 1HT6A 5DRCA 1EO7A 1I2PA 4MJ4A 1DJZA 1KXVA 1ONEA 1ONWA 1J9YA 2O0TA 5I3DA 2A7PA 2EPLX 1U83A 4DPPA 4JTUA 5IOBA 4EPBC 4ATLA 1GCYA 3DEQA 3SCSA 5H8UA 3VUPA 3ZFHA 3MCNA 3QMSA 2ICSA 2RUSA 4IG2A 3ITLA 5DT5A 3WQOA 1EQPA 1M01A 1J10A 3GSMA 4UQAA 1P0DA 4A3UA 2BVDA 3MI3A 3LUTA 2CEQA 3OW1A 2HS6A 4DF0A 2X7WA 3O7UA 1D8CA 3MQTA 1TZ7A 3LLDA 1LWHA 3OGVA 4PMQA 2YFOA 3W1RA 2CBUA 1H1YA 3UERA 1R3TA 3IGSA 5FEXA 1V7YA 4PYSA 5HUPA 4V1YA 1QNQA 2CZEA 1XUUA 4CQBA 4A8RA 2VEPA 4C1NA 1XYAA 1DJIA 4DWSB 4JKKA 4K3ZA 4WXZA 3T7VA 2CLIA 3MANA 4LRTA 3PPCA 3H2NA 2CLKA 3OBAA 4H9TA 4NIRA 3SFWA 3TC3A 2AOSA 5I3IA 5E0CA 3TQ0A 1E73M 2YKKA 4GO9A 3P80A 5FF2A 2GOUA 4RDZA 3NWRA 3OZYA 4FLSA 2OELA 1MQQA 2D23A 4YPJA 4GX9A 1ADSA 4EPDC 3SCTA 5T9CE 3TC7A 3B8UA 2QCHA 1OCQA 1LWIA 3TDFA 3WK2A 1MWOA 4JFSA 3GXPA 4AFYA 3TTSA 2XM2A 4D1IA 2GWNA 1FHVA 3FEQA 1UH3A 1YW1A 2RGMA 5GQBA 3BURA 1SZNA 1OYBA 2V82A 3GC5A 1GOKA 3KBJA 1YIXA 2H9AB 2VFDA 3TW7A 3GKAA 2CYGA 2OJPA 5D03A 2H6RA 1W3IA 3LGEA 3L21A 1UZHA 2VEKA 3AYSA 1EDTA 2XWDA 2YX0A 4G9PA 2Z1BA 4A29A 1EH9A 4GKTA 3LN3A 3AC0A 1PAMA 2WMIB 1YE4A 2D24A 2BODX 4QITA 3LV5A 1S2AA 1TX0A 4BWLC 2ZX7A 3TOYA 3UR8A 1GGOA 1CCWB 1T41A 5F2IA 5AC5A 4CD4A 1XRTA 5I3JA 3IVUA 4YLWA 3PJUA 5AHEA 3NZQA 3AIEA 3GZ3A 4OVXA 1KB3A 3W84A 3QR1A 2QCCA 2PODA 2GGJA 1N8FA 1MVYA 2OX1A 1P7TB 4IPIA 4F9JA 3M5YA 3QR0A 2VVSA 3UBPC 2FMOA 1JYXA 4GRSA 1IQ8A 4TV5A 4F79A 4GY1A 3GU9A 2QCMA 3GU2A 4L1XA 1D7FA 3BCFA 4NXSA 4I7WA 5AN7A 5FD0A 1LDCA 5BW6A 1JPDX 4C7GA 3VE9A 4HOXA 1EP3A 3QHMA 3MWCA 2UZ9A 4AZIA 3UQNA 1FKXA 1V0LA 3TLQA 4D6DA 3CH9A 2D1ZA 3FS2A 1IT0A 4S2BA 4W5UA 4QX4A 1CXFA 1XI3A 4AMCA 4GH3A 3V0UA 1NOUA 1W54A 3W2KA 4X0VA 3UEQA 5HNUA 3FY1A 1R3VA 3LV6A 1DKWA 2Q3OA 3W1LA 3U2ZA 1OADA 5E5CA 4UC5A 3IIPA 3VZZA 2IPWA 4XD4A 1E40A 2O55A 3GHSA 1GQNA 3S5NA 3M47A 1WP6A 3WZ0E 3UF9A 3UWWA 2D2JA 1WKDA 4KEZA 4DO5A 2XFRA 4W4QA 3C2VA 2DFAA 2GSJA 3KBNA 4TX9A 3W82A 1Q2SA 2XPKA 1Y7VA 3QY7A 5EB8A 4KRUA 3L66A 1PHWA 2CWXA 1K9DA 3NFUA 1EQCA 2FKPA 4D72A 1JZ2A 5DY2A 4JFTA 2GOKA 4B2DA 3JRKA 3LNMA 4HGXA 4PCNA 3EBVA 3RCYA 1U33A 2ONEA 1HL9A 3KOXA 2ZVIA 1I0BA 4E4PA 4P8UA 3BUVA 3VZXA 2WMKA 3FJLA 2A3AA 4AB4A 1KCXA 2C18A 3L7RA 1F74A 2NQJA 3I6TA 5C9UA 4L65A 4M0XA 1PYFA 3VGFA 3GVGA 2H9AA 3UG3A 1FUYA 1VBHA 4J7RA 4LBRA 2YB1A 3AHTA 1RCQA 5C2CA 1KCLA 1XYCA 3GAYA 1JR1A 1EJ7L 2J79A 4IUOA 4PTNA 3PNZA 1XLIA 1UP3A 4FF7A 3P81A 4XK2A 2XH2A 1QOPA 4NZ4A 1TUFA 3T81A 4P7RA 3W83A 5A94A 2PP0A 5ABEA 2YDQA 4Q7BA 4ROPA 2Y7DA 2Y24A 2VX5A 5FJIA 2P50A 2WMIA 3PBGA 3N15A 1JCTA 1NVMA 4DQWA 3WQGA 4QG8A 3MUY1 1W3JA 1W9PA 1A0CA 4LS0A 1D3GA 2V6AA 3M0KA 3LYEA 4JTKA 6CGTA 3P8IA 4DXKA 2QV4A 5FF0A 1XWYA 1C93A 3KRBA 4E4UA 9RUBA 5CEWA 4TOQA 3G1AA 3W1XA 4H83A 1NFPA 2R94A 3WLTA 2ZA2A 2OZTA 1OEPA 3SRKA 1P7TA 1C90A 4RDWA 2WCSA 3KLLA 2VEGA 1K8YA 3UJSA 3QFEA 4D6IA 1A4MA 3TFCA 3P84A 5GNXA 3ALGA 2OOFA 3NR0A 1YBQB 3R2GA 3IRDA 3PZNA 3UJEA 2IXUA 2VGBA 1V6XA 3BCJA 1Z32X 3BAWA 1CYGA 3BGJA 3RHGA 1BAGA 3HPZA 3WQ6A 4RK8A 4PUMA 3DX5A 3TONA 2Z2AA 1FHLA 3CYVA 3EOSA 4XISA 4DI9A 4LYQA 1TO3A 1Q6CA 4RL3A 3TQPA 1A0DA 3B9NA 3NVTA 3PWIA 1UWRA 1QO5A 1W5MA 3EPOA 3V5CA 1NARA 2VELA 2ACRA 2W92A 1W37A 5I03A 2Q8ZA 3NQMA 1H11A 5E9AA 2FYMA 4WY0F 2OXNA 4V15A 3F2BA 3W53A 1ZJIA 1OM0A 1XH2A 3UY8A 2VEFA 3M5XA 4L9XA 1FWEC 2WKJA 1AFSA 2Y1HA 3A9IA 4QXIA 4A8IA 3PZOA 2QR6A 1KBBA 2WSYA 3DYPA 4NVTA 3W9ZA 5HMFA 3KCJA 3MSYA 1MW1A 2NLYA 4LUIA 1K7XA 3U6WA 3G8RA 3UETA 5CLWA 4HMEA 3QGAC 3SECA 3O6AA 3RM4A 3CH0A 5I79A 1J18A 4QLKA 3SBFA 1TZ9A 4DLFA 1X98A 1XLLA 4LV9A 2CBJA 3L4XA 3M7WA 1LF1A 3MSRA 1EZ2A 4GI8A 2I57A 2VHLA 5D05A 1K8XA 1PDYA 2ISFA 4XZIA 4ZQPA 3BAJA 4NY2A 3S2LA 4DBSA 4C5YA 2VEIA 4IUGA 4B4FA 1FCQA 3WN6A 4DXXA 4Q8TA 3DG7A 2PTXA 5A8MA 4E38A 3WD3A 3SIZA 4LUYA 4GVGA 3R6IA 3VD3A 1HJSA 2V81A 3FIGA 3UXKA 1RD5A 1N8IA 1S39A 3NL6A 3RX2A 2E1WA 4WY0B 1SJCA 3NO5A 3QPZA 2OWWA 4PCTA 3CQKA 3VOJA 1TPC1 4IGMA 4MPKA 3STEA 1VB9A 1EJVC 1J93A 4RNFA 4D6HA 2OU4A 4Y6GA 2ZE3A 1LT8A 3FA3A 4AW7A 1DJNA 2Z1SA 4JXCA 3L9CA 4C91A 4J3TA 2MNRA 2WJFA 2SFPA 3DDMA 3W86A 4MUZA 1UR4A 3S83A 2WJZA 4INFA 1M7PA 2CPUA 2QYGA 4QG9A 1CIUA 1UW9A 4F0SA 1FWSA 1Z9AA 4RDYA 4ZODA 4MPQA 1YBQA 4P8VA 1AG1O 5HQLA 4AZGA 4LALA 4OTKA 1F61A 2Q8LA 1BVNP 1EFZA 4JTQA 2JE8A 4XBKA 4GG9A 4MLRA 5GNYA 4QM1A 1F5ZA 1S1PA 3KP1A 3PY2A 4EAYA 1QI5A 2J8GA 3BJSA 1U1HA 4EANA 1JDDA 1IE7C 1JAKA 2I5QA 3B9EA 4GUIA 3I3DA 2Y61A 1EBHA 3MWAA 1RA0A 4HTBA 4F0HA 4GCAA 6XIAA 3EX2A 3VIGA 3NZ1A 1GYNA 3CQJA 2PDQA 3EMCA 1F3TA 5HBFA 3MP4A 3GNXA 2FJUB 5EY5A 3HG2A 4JN7A 3UGRA 5C9WA 3DUGA 1ESWA 3SQSA 4FA3A 4GI4A 3F03K 5AY7A 4KEMA 4RLIA 2C6QA 3CZGA 3K4WA 2XN0A 2POTA 3T2QA 1B5TA 4IXHA 4UTWC 3P7YA 1PS9A 3CZKA 3PUDA 1U5JA 2ZX5A 1AUSL 1PDZA 1M5WA 3KW3A 3LD5A 5AZ1A 1BVZA 2WPGA 4H00A 2WMGA 3UPMA 4JTJA 4FPSA 4LAZA 3ZLGA 1X97A 4YTTA 1VCVA 2YFNA 3EEGA 3ABRA 4JL1A 1BTMA 1OFEA 4IPPA 1I2RA 3PAJA 4M7TA 1Q85A 4IX2A 1A5OC 1SJDA 3W81A 4L7ZA 1GW9A 1I1WA 4PFHA 1KLYA 2FGZA 3TWAA 3B8IA 3GH4A 3W1NA 1GVSA 2MUCA 1A5MC 4FXJA 3UPBA 1XCFA 4BF9A 3N9KA 1P4CA 2ZC1A 3LB0A 2P88A 4O28A 2J7HA 3CM4A 5EBAA 3TCEA 4JX4A 3W7IA 3WQWA 4PB5A 3TR9A 4GYPA 1F76A 3R43A 2DORA 3DHUA 2V3EA 4BZYA 2BOFX 2J7CA 5MF5A 1NQKA 3AALA 4WY0A 5I5RA 3TWBA 4ERGA 2A4AA 3CUXA 2QCNA 2F6XA 3TVAA 5TAOA 3IIVA 3PHAA 2D3NA 1NP2A 3TN5A 1DXFA 5AZ0A 3CUIA 3D5HA 4IFKB 3NSXA 3EDDA 2FB3A 3N73A 3NQEA 5MKGB 3QHOA 3N14A 3GG0A 5HWJA 4FOKA 1DVJA 5LZLA 3FXGA 2VJXA 2QPXA 4TVCA 3QTPA 3WNOA 2D2OA 4R27A 2ZVRA 4NAFB 4GYFA 2GQAA 1XLGA 4F9DA 1JPIA 3HJZA 3SCWA 3SCOA 4IL0A 3C61A 1Q8AA 4B3LA 4AISA 2GJXB 1TV4A 5BXTA 4AYGA 4TTGA 5BMXA 1FWHC 1EJTC 2EKCA 2E67A 4HPNA 3EXSA 1JI1A 1UZ4A 3CWHA 3FKKA 8CGTA 2GUBA 3U7VA 3I4EA 2DV0A 3BW4A 4IP4A 3FGCB 1Q45A 2BHZA 1E6SM 4L6OA 1YEYA 1JXJA 2WMHA 3RCMA 3MUCA 5BCAA 1E4IA 4DJDA 4KCUA 3U57A 3C2OA 1QXLA 4J3ZA 1ISVA 3WQCA 4DO7A 4AZCB 4XVEA 4BEUA 1OGBA 4DJEC 5C9RA 5HANA 4DYJA 1UWTA 3NCOA 1I1XA 2JEQA 2Z26A 1BHGA 1KM4A 4NJHA 4R53A 3W7PA 4E0CA 1JFHA 4Z2KA 3VK5A 3VCCA 5A1AA 1XYMA 4LBSA 5D04C 4MY9A 3BLOA 1JCYA 3GNPA 1J6OA 2Q09A 1RJPA 2C91A 3M1ZA 3EOEA 5TNVA 1XC6A 1SJBA 4XO7A 4ASTA 1NOWA 1G94A 1MRAA 3H24A 1YNPA 3PTQA 2ZUWA 5I0DA 4CCDA 1ZGDA 3UG4A 2R8WA 2WC4A 4AC1X 3IEBA 4FEZA 2CIPA 2WV8A 4PRTA 1R9ZA 1W31A 1YYAA 1OC7A 1RPXA 3TAKA 4RZBA 1JDAA 2BG5A 2X40A 1HVQA 2E9BA 3CHEA 2A2IA 4R3UA 3CB8A 1P43A 3AMDA 3CNYA 3RDKA 3P5YA 4XQ6A 1OFBA 9XIAA 4JQ2A 3TYEA 4ADUA 4H3DA 5J5DA 3CIWA 1AQMA 3G18A 1GPWA 1EOKA 1NQ6A 5AHLA 2NX3A 4WDXA 1LJYA 3GC2A 4NX0A 2YL8A 4ORIA 3OBEA 3B8WA 3LM3A 1QMLA 4XD3A 3R8HA 5C71A 3GX9A 1PUDA 4FLRA 1DOSA 4UTHA 2E8ZA 4IFKA 5JIPA 1UB3A 2HXTA 1GVEA 1R9YA 1ZNNA 5MKGA 1ADDA 3HPFA 4QQ3A 3ARTA 2PWGA 3SCPA 3VVGA 1KR1A 3AXHA 4P8WA 1DJGA 4NAFA 2ATSA 4Z1DA 2J9YA 1K6AA 3SIMA 3BAIA 2GYIA 3CWOX 3W1MA 1AL7A 3CQ0A 1EJRC 2F8QA 2P76A 3DYOA 2VFGA 2GJXA 3H4WA 4HMDA 3MJMA 2OMAA 4US6A 1J11A 2H8ZA 5C55A 3MYOA 2INFA 5IHRA 4AEOA 4ZCWA 1G4EA 1VJZA 1HJXA 5T91A 1UD4A 5FSDC 5CJNA 5FAJA 3C56A 2CLPA 4MIMA 3W7NA 3N25A 3HO8A 1HJQA 4ZA0A 5BU6A 3FGCA 2BZNA 4RNIA 3L2LA 3JVAA 1H50A 3UZZA 3G1FA 5JU6A 2GWGA 4W7UA 3BG9A 4AZCA 4JTEA 1OD0A 3HPSA 4C60A 1V03A 3A22A 2OYKA 4TXEA 4M6QA 1TE1A 4Y2WA 2Y8VA 1NFGA 4EAMA 3IJQA 1HGWA 1P0KA 4MG4A 2WO5A 2CZFA 4Q4PA 3J7HA 4I7UA 3PUOA 1PTGA 4W8BA 2BFGA 3T4WA 2Y5SA 4NJIA 4E2BA 4PB4A 3NXFA 3OQ8A 3KZPA 4OBTA 4QJ1A 4LEFA 1S38A 3EKLA 1UMLA 4ZR8A 4TQTA 3THQA 4ZTXA 3PBUA 2NX1A 1HKJA 1H7PA 3WQ5A 4MOZA 1Z8AA 2QCLA 3WFZA 1A49A 3KX6A 3OHMB 2QKFA 1Q3NA 2OEMA 1PIIA 3ZWSA 1OFDA 1UKPA 4QRNA 1C9DA 3GWQA 3LHWA 3QV9A 3WDIA 4LNYA 4W8LA 4B5XA 3TJ4A 3W0KA 4KESA 1Q6GA 4J2MA 1H1NA 3U2EA 1W6TA 4XD6A 3QYSA 3NDYA 4S3JA 3UG5A 3T42A 2FLIA 3TH6A 3TOPA 1ZJBA 4QBXA 4G5DA 1JXKA 2VP8A 2F2KA 2FH6A 4PUKA 4NU7A 1XIDA 3RO8A 1KR0A 3H4XA 3LHVA 1VPYA 4RE0A 3NA8A 5HR7A 3IIOA 3POHA 3PWGA 3URNA 3R89A 3OO2A 2JK2A 2AGTA 3AI0A 2PURA 1VJSA 3I65A 4ORMA 3WELA 1R3WA 2ISVA 4FX8A 1J2BA 2ZXAA 4GFIA 1P0BA 2YCLB 4CLMA 5JXQA 1QHOA 3W28A 3CIXA 5HDRA 3WLIA 1H7NA 3CPRA 4H2CA 2E5DA 4O0KA 4YVVA 4UR7A 4YWSA 4I8DA 1XBVA 4MVAA 1DE6A 1L6GA 3FEMA 3R5EA 5FF3A 4LC8A 3PJXA 2QZRA 4MADA 1F07A 4IQEA 5D9OA 4MNLA 3N13A 2CLOA 2CETA 5JBEA 1NDYA 1S2WA 3LZ3A 3DERA 1KC7A 4H41A 3ITCA 1UQZA 1VRXA 2OVLA 7ODCA 2HK0A 3I7RA 1X38A 1XG3A 1FWJC 1PTDA 3THCA 2PWFA 3T08A 3BV7A 1KGWA 5JBDA 3FSUA 3VOHA 3KEHA 3R25A 1WE5A 4W7WA 1R9XA 4Q8VA 1JUBA 3RCNA 5CAKA 1I75A 4J35A 1QBAA 5DMMA 3N4EA 1OT2A 2PDKA 3HV9A 5AHNA 3WIJA 1E0TA 5AC6A 1BKSA 2XTKA 2QPUA 2QT3A 4CU8A 3CL6A 4JS3A 3TW6A 1HQTA 1SO5A 2ZWYA 3TN4A 2HVNA 4Q7IA 4I9MA 4OOUA 3EAUA 3ABZA 1GOQA 2J77A 2W91A 3P0XA 2X8RA 2RJHA 4HCLA 4IWWA 1DORA 2WQPA 1NWSA 1XLMA 1EP1A 3ES8A 4FXSA 1GT8A 4GBUA 1YPFA 1WQ5A 3SSJA 3LBOA 2VFIA 3GU1A 4G1KA 1OG0A 2YDRA 3WH6A 3KVMA 5FF7A 2X16A 3U5UA 3RU6A 2ZUSA 3SI9A 4ZE4A 2QMJA 5DBUA 4ATWA 3BZGA 2BB0A 1MZHA 1XLHA 4HYVA 4ZFMA 4XWUA 5GVJA 4IP5A 1TIMA 4IMAA 4MZ1A 3SJ3A 2BP1A 4U4MA 1VC4A 2WVTA 1E15A 3W25A 3OHIA 3EOLA 5DCEA 1BG4A 1EX1A 4S3KA 2Q3RA 3W1PA 1ZY9A 4PTDA 1F7BA 4PMUA 3W2JA 1XX1A 3VDHA 3LSCA 3C2EA 1PZ3A 5FJPA 4RDVA 4GJ1A 3P67A 3QZ6A 5M17A 3EDKA 4DLMA 3OVPA 3W6MA 5DCDA 3IANA 3EDFA 1HZYA 1RSCA 1HTIA 2YCLA 4ROQA 3T0BA 1VCGA 5CPMA 2E68A 4HNOA 2PLKA 3OU8A 3GG1A 3LHUA 2G3MA 3R8GA 1OT1A 8A3HA 1L2QA 3COTA 1JRBA 5JUVA 1XJBA 2XIIA 2VT0A 3A4XA 1Q6FA 1YTKA 2HNEA 1O1HA 3DFQA 4MB5A 1SPQA 1S2CA 1FWTA 2D2HA 3EKZA 3STFA 2G3IA 1XLJA 1UH2A 2DZSA 5DT7A 2YXXA 2ZFAA 4TVDA 4LH8A 3W00A 1TKKA 3T6CA 4JNMA 4UUIA 4IQJA 3ITOA 3UYCA 5HXMA 5K7JA 1M68A 3CWNA 3HQ1A 3K8MA 3TQVA 3QHNA 1IGSA 1DV7A 3ZT7A 3T9PA 3NTYA 5E70A 4QTGA 1DWFM 1W1PA 5K9DA 1YNYA 1MO0A 1YXYA 3EA3A 3R4IA 4OIFA 2X1UA 3S1XA 1FDYA 1UP0A 5HR6A 1EC9A 3MDWA 1EC8A 3BLEA 4LUSB 1BG9A 1H0GA 3TU9A 2VDIA 1TREA 3ZLHA 1EIBA 3B4YA 2PDWA 1AQFA 1JNEA 3OIHA 4HJWA 3H12A 3LTSA 3GHTA 4BQ5A 4ZXLA 3NDZA 2ZDRA 1E6PA 3BQ5A 1H2JA 4ZQCA 3O63A 1DYSA 4Y96A 3HBLA 3R0UA 3XIMA 3FDGA 1JZ5A 5FJJA 3USZA 1DXIA 1V3JA 1K9TA 2IPGA 1FWDC 2GVEA 4K38A 1PJ9A 4IF2A 2PUZA 3VOGA 4NJJA 2ZXDA 1QTWA 4AVNA 3LCXA 2WJEA 2OYMA 4AHQA 4PMNA 1HW6A 1TWZA 5JMUA 3GDKA 4XKMA 3NGFA 4JY9A 5I78A 4NL1A 4YJ5A 3HG5A 2ZOXA 2BXVA 3VM5A 2W4XA 3VNLA 3V0SA 4HVXA 1PIFA 3VILA 1VBUA 3BDKA 1AD1A 1XDJA 5F4WA 2NT1A 3SUVA 3U5YA 1EUNA 1EJXC 3ISIX 4QS6A 2BY0A 2Y70A 3P74A 4XUYA 2XIQA 3EOOA 3TROA 1I2NA 4WSKA 3Q58A 5D8WA 4DBWA 2YZ5A 3TA9A 4LBUA 4MWAC 5FJUA 4HNVA 2XHYA 4KRZA 5CG7A 2PDHA 1R2SA 2RDXA 1EL3A 4ICCX 1CXLA 1ICSA 1R6WA 1DBTA 4IFOA 3VKJA 5HWMA 3W7CA 1UUQA 3VNDA 4ACZB 5JIWA 3H2EA 4LF2A 2Y85A 1HP4A 2WM1A 3G5EA 5RUBA 3RJYA 1SVDA 5F2LA 1TELA 1CENA 3CO8A 2HBVA 4YXGA 2WVSA 2PDLA 1JAEA 3M0XA 1XLCA 1K8CA 4OOZA 1KBLA 2XINA 3K5XA 2QDEA 2JIWA 1W5NA 3EB4A 2D69A 4DNHA 3DKJA 2X09A 2PDFA 3EWXA 3VNJA 4LB4A 1XGEA 4Z17A 4PA8A 3OIXA 4UTMA 3ABQA 3OOQA 4HSOA 4UFKA 4LYKA 4EVZA 1TJ1A 1UWAA 3CMGA 3LRKA 3WSUA 4EACA 1UD6A 2VENA 3ANVA 4H9YA 3W38A 4B3KA 3N6QA 3FA5A 1MMFA 4PUEA 1W3LA 5B7ZA 3UP8A 3F2DA 4CCCA 4JFVA 1WXYA 2BVWA 3TYAA 4M82A 3A3XA 4QR6A 5K9CA 3FK4A 2Z2BA 3A13A 3FDKA 4XBJA 3KHDA 2Z25A 4CD8A 3CJPA 4LUSA 4NJKA 1V8EA 3RO6A 3NQAA 2C79A 4FNRA 4GFSA 1W8SA 2WWCA 3RXZA 4BWLA 5DELA 2GJNA 3ME3A 4JQ3A 4EP8C 4DWDA 3IUHA 4QAIA 1IEVA 3A64A 1AJ0A 5AYIA 3V5FA 4V1XA 5LIYX 2L5HA 3MS8A 4F0MA 2I5GA 1AZ2A 3S9ZA 1SSDA 4JTGA 3O8AA 1V51A 4QIUA 4IJRA 6TIMA 3L0GA 3KWXA 4IGHA 3E38A 1VEOA 4LCRA 3GG7A 1I6NA 2O9OA 1HFBA 4H01A 3AJXA 4FLOA 4MTVA 1LRNA 4C6FA 3TJLA 2FDMA 1TIWA 3PBVA 4IX0A 4DO4A 2HSAA 1V0MA 1FWBC 1VKFA 2GDQA 5A69A 1R3QA 1KFEA 3WDQA 3SGGA 2EG6A 5HOSA 3MUIA 2Y88A 4H9XA 2ZIDA 3VI2A 2QIWA 3G1SA 4LTSA 4B5UA 2WHMA 3DG6A 3KM8A 3B03A 1XIBA 3KAOA 3BG3A 1WAWA 3WLQA 2GGHA 3AXKA 1PEZA 2PRHA 2H3BA 1XIIA 2OGYA 2HJPA 1LP6A 4GUJA 3ATYA 2VX7A 3WBWA 4CCZA 2W63A 4N9EA 1IEIA 3N6HA 3M4HA 1PV8A 4HU3A 3AIRA 4ACZA 3A23A 1VFSA 3BLDA 3HMCA 3PFRA 1OGSA 3IIZA 2A21A 4KGLA 1EPXA 3ZXWA 2P53A 2ZTKA 3M7SA 2IQDA 3ERPA 1C91A 3EEZA 2EGZA 3SURA 1SFLA 5I24A 3S47A 4LAUA 4J5NA 4C6BA 4JKLA 3FVMA 5B7YA 1QO2A 4PTWA 5D9PA 1TPUA 3E3HA 4M6PA 3IUIA 4DAFA 2RAGA 4UMBA 5A6TC 4J9JA 5TQLA 1HKMA 3GQYA 3HZ3A 5EMKA 1UROA 5DBTA 2Y7EA 1GPFA 3DG3A 4I6KA 4O16A 4XB3A 2EBNA 4U10A 3L4VA 4PE8A 4AZ7A 3LXBA 5HJYA 1IYXA 3WNNA 1XW8A 3NUKA 3OB8A 3OP2A 1JI2A 2CHRA 1LUCB 3VGBA 4R85A 1TVLA 1E1EA 3PP7A 5IBXC 1M04A 2FZBA 4ZB2A 1AJ2A 1JEZA 3NVDA 3AISA 5ECUA 2RGLA 4W9TA 2O4QA 1CXEA 1JDEA 4Z2LA 4M24A 1X1ZA 1GVYA 4HN4A 4BI6A 4D6GA 1LG1A 3WNPA 1F4AA 2NWRA 4UTLA 3GXIA 1SUXA 1UUMA 1VEMA 3WDHA 1L6SA 2IMRA 3N19B 2HMCA 1XLFA 3LSBA 3P6LA 4HPXA 1XQLA 4P61A 2OYLA 2QNEA 4A2RA 2ZX9A 2YW3A 4ECLA 3XISA 1ONXA 3W75A 4ZQMA 1UWUA 2ZDSA 3M0ZA 3O6DA 1BD0A 2PDJA 1ECEA 5C54A 5FSEC 3VC5A 2QGYA 1UKSA 1JGMA 3GC4A 1R8LA 4RZ6A 3W7QA 4JDBA 1JPMA 3WLOA 3CTTA 3AIQA 2JF6A 2NW0A 3GUWA 1YTEA 3D3FA 2VOTA 7PTDA 2GQ9A 4N7QA 2YBVA 1K77A 1DJHA 2OOGA 3M0IA 2R1LA 5AOUA 4HZ6A 4WGHA 4MWAD 1BQGA 1UA3A 1SW0A 4UIOA 3QY6A 1X6NA 1OQFA 3ANYA 4IPNB 3PF3A 2I17A 1JPKA 1UA7A 2J6XA 1KFKA 3C86A 4GXPA 3WD2A 1T40A 4GIEA 4WCJA 1DJQA 4O1FA 3LCIA 3H2CA 2DZPA 4XAZA 4O4VA 4JOMA 3RITA 3QKEA 3F4DA 1RHCA 2POZA 1E5JA 1DP0A 4JFUA 4WIWA 3LEPA 4C6OA 4U2ZA 3T44A 2GL5A 3QOKA 2QQ6A 1VFTA 2J88A 3LGDA 1B0IA 1UUOA 1QOQA 3O06A 1GONA 3WBEA 4I7VA 3W70A 3WLSA 3UWEA 5B80A 3GTNA 1JZ3A 1TJRA 3CBWA 1CGWA 3GH7A 4JHOA 3GR8A 1XLEA 4V33A 2AGKA 3CEPA 4C65A 1ZBKA 2VGGA 4PSPA 1TVNA 2QDDA 1AH3A 3UXLA 1YTDA 1LYXA 1KO0A 1UP2A 2H90A 3SN1A 4TR9A 2OSWA 4I9JA 4F66A 1VBJA 3FYPA 4XBSA 2OLAA 3EYPA 4PCPA 2EXOA 3WFLA 2DIEA 3F7JA 1FCVA 1KRMA 1WUFA 1ZZMA 3BJFA 4POCA 1XIFA 4Q22A 4A3HA 3MYPA 4HHHA 1BSIA 1KV5A 2ZRWA 1WUEA 3KL0A 3DYMA 3OLEA 4EPKA 3C6CA 4J4KA 2QVNA 1BRLB 2AQVA 2F61A 1RZMA 1VH7A 1W2PA 1IIGA 3SB0A 3NQ6A 3W29A 4IMDA 5D9MA 4M29A 3SEPA 3PUEA 3V18A 4Y9MA 3QGVA 1JCLA 3AXMA 4JQ1A 2GVLA 2OTDA 1BWLA 2E7FA 1RA5A 1LLZA 2E6AA 3D47A 3A4AA 5JH1A 1F6PA 4WJXA 2DGAA 3NEVA 1BGAA 4JKMA 2BY3A 5CSSA 4GIAA 4GUHA 3OLDA 3VM7A 3T2PA 3WF1A 1QPOA 5CGQA 1XH1A 3NL3A 3GXNA 5AHMA 4H04A 4JTRA 3N11A 1W1IE 4BI5A 2VEMA 4YVPA 3ZLFA 3DENA 1IWPA 1SFJA 1THFD 2EHHA 4CN6A 1XC4A 1UD3A 4AQLA 1NU5A 4C6QA 2ZUUA 4A35A 2ESCA 4PMRA 1HJVA 4GQBA 3W7LA 1B3VA 4MYAA 3TYZA 1G7UA 4N4PA 1CEOA 3PG9A 1UHVA 2OQHA 5EMLA 3L5AA 2X0SA 3R12A 2ZKMX 3APGA 4O1AA 2OFJA 3PPFA 1PB0A 4KEVA 3W85A 3LQGA 1FFRA 3CLWA 4LAOA 3QV8A 2TRSA 5F2MA 4UTJA 1Y5WA 3NURA 4DHGA 4ZOAA 4JZ5A 4K37A 4XTIA 5FL1A 2WHLA 1GQKA 2XFWA 1POJA 5LIXX 3B0UX 5IHSA 1HO4A 4WR3A 3UNTA 1YADA 4PBFA 1JCNA 3C3NA 3LLFA 3PBYA 1L6YA 1AL8A 2HNHA 4GJJA 3W7KA 2YXOA 1TCDA 3TEVA 3PM6A 3F4WA 1JF5A 2I5IA 4UTWA 2O92A 2PDUA 3WLRA 4A22A 1ICQA 2D22A 2YA1A 1ZCOA 2PDXA 1KM2A 1C7TA 1KW1A 4GY7A 4H2HA 3TN3A 3QPYA 1VHNA 2ZZ7A 1EHAA 3PS7A 4HIBA 3E1F1 4U2YA 1W1ZA 5I07A 1PXGA 2BY1A 1NEYA 3URAA 2AKZA 3NYDA 4OFCA 1JYNA 4Z42C 1JQXA 1NIUA 1XYFA 1WDDA 4P5UA 1UJQA 2P0OA 4GQGA 3SY8A 4QHRA 2D20A 4LAKA 4QSHA 3H2OA 1XDLA 2BXYA 5L9FA 1Q4NX 1ZHAA 4HPGA 3AJ7A 3P8JA 2D0HA 2I7GA 2V5DA 3H2MA 2C14A 2PTYA 3W7DA 1RD6A 1WBJA 3K1DA 4N6FA 4OV4A 4EXQA 5LNVA 5GJMA 3UVAA 1BRLA 2R6OA 1TE6A 2BBFA 4EOUA 4I9AA 2PB1A 2JBMA 2EO7A 4NUWA 1J96A 4LVGA 4BJHA 4E3TA 1W3NA 3W6LA 4LC6A 2VDGA 1PZ1A 2A79A 3DC8A 3PAOA 1S2TA 1PTAA 3N3TA 1GVIA 1O12A 5K9XA 2TPSA 4PMVA 2OEKA 3LOTA 1A3WA 1E0WA 1H0IA 1TTJA 3WJXA 3QR3A 1MNSA 3LDVA 4GQ0A 2TMDA 3UZYA 1DQXA 5CZ0A 3LHZA 4P7QA 1V6VA 2X30A 4N9DA 1P6BA 3GUGA 4Q4RA 1KTNA 3TXVA 4J3XA 1GJPA 4PODA 2J47A 3KFTA 3TXZA 4Q6JA 2YJQA 3KOYA 1GJWA 2J7EA 1UG6A 1B2YA 3S4TA 4ZZ9A 1MFUA 2V5JA 4Z1AA 3THDA 2ATMA 1RY8A 1TV7A 3KBWA 3SR7A 3ANUA 1J6PA 2OSXA 1W5PA 2PP3A 1GHRA 4FNUA 1EDGA 3ONCA 2E3ZA 1XRSA 1WKFA 1S3HA 3NAVA 2YGYA 2EG7A 1V3LA 1FTXA 4CNTA 2HRWA 2AMGA 2YA2A 3VIFA 1JCXA 4WZHA 3W24A 1JIBA 1W9XA 3VIKA 1QHZA 4FNPA 1YLVA 4Q4MA 3M16A 2C3ZA 1GOMA 3QBUA 1CGXA 3N04A 4LPCA 4LSBA 3W72A 3G8EA 3CPUA 1BYAA 3KTCA 5D4YA 3VDCA 5XIMA 4F3HA 4FOJA 4ERIA 2XVLA 1XFBA 2UY4A 1DXEA 2VCBA 4D71A 2G41A 2DW6A 1FWWA 2VC7A 5AHIA 4ZQRA 4HPJA 2C19A 1EXBA 2PU0A 4ILSA 5FEPA 4I9TA 3JU2A 3PK7A 5FA5A 2ACQA 3DC0A 4R7OA 2Z27A 3IWPA 3KXQA 2C71A 2ZZ5A 1W3TA 3EOUA 5F4SA 1XRFA 4O8AA 5I7GA 5LSMA 3B8DA 4FP1A 5DQPA 1UKOA 2BS9A 3EPMA 1EUAA 2WNWA 3AHXA 1UWQA 1QI3A 2DVUA 1OFAA 3AMKA 1ONRA 4OQVA 4PUUA 3S1VA 2WZMA 3ABOA 3ARUA 1I4NA 4C6JA 4G7FA 4DWSC 4GZJA 3VIJA 5G4WA 3A24A 2X1TA 2FVLA 1WXZA 4U33A 4ZVJA 3PPGA 4YTQA 5BRPA 3GXFA 4GNJA 3T40A 4KMQA 2X0HA 3EXTA 3I3EA 3ZSSA 2WSQA 2V30A 2I14A 2AKMA 4AAJA 4GBDA 1MDRA 1XPGA 4KBXA 1B57A 2ZZ3A 4Z1CA 3LCLA 1DQWA 3EB3A 5BMWA 4PTXA 3S3GA 2X42A 1JZ7A 1TMLA 1HX0A 4GC3A 4IJCA 3IAPA 3L0NA 5BYWA 3PZMA 4G2DA 3OPSA 3R0DA 4LU0A 2VURA 3EWYA 4NI3A 3G1VA 3UR7A 4C6MA 3MV11 3RX3A 1VF8A 4BF7A 5G1YA 3GDLA 4HCHA 3U48A 2Y8KA 3FHQA 1W0MA 2RFGA 3LI1A 4PB3A 5CBJA 2PDGA 1XR2A 7TAAA 4F40A 1OGGA 4GMEA 2PS2A 3JR2A 1M53A 1NWTA 4J2PA 4YTUA 3GY1A 1IF2A 4GISA 3ZR5A 3E2SA 4ZO6A 4QP0A 1RP9A 3TSBA 2WSRA 3KE0A 1QNPA 4G6CA 3M0JA 1E9IA 1UASA 4L80A 1E0UA 1M1BA 5FAGA 2DZUA 2C8NA 1J12A 1H7WA 4O1CA 5HK4A 1IXQA 3OGRA 4AWTA 5A5WA 4KCTA 2DJLA 1K7FA 1VLWA 3AS3A 2VVNA 4TX8A 3D3AA 4I3GA 2C13A 3OA3A 2WWDA 1NDZA 3ARQA 4B5VA 1S5MA 2I56A 3HB9A 6TAAA 3H23A 1T5AA 4UCFA 1XD1A 1XYLA 4UR8A 1H09A 3CUJA 4EWJA 1AH4A 1HXJA 1TV3A 3SUUA 3LY0A 3W7RA 4OECA 1R5YA 4IP7A 4Y90A 1SMDA 3GTHA 1UOKA 3H21A 4R7WA 1KXHA 5F2GA 3PTMA 1DHKA 2X0YA 3WLNA 4JTHA 3RLUA 3FNDA 4UNLA 3F2CA 5FJRA 2E09A 4UFIA 4AZHA 4DBEA 3KWSA 1FXQA 1D9EA 4GUGA 3KS5A 3SZ8A 4CVUA 4OE7A 3R94A 3UR2A 4DJFC 1DPMA 3HMJG 1P5BA 3CHDA 4ALDA 3VKDA 3QLLA 3UR5A 2OZ8A 3E5BA 1GTEA 3NOYA 3VIMA 5L6UA 3KS6A 3T78A 2G95A 3BMXA 1XSJA 4FO4A 5MHBA 1DWAM 1PCWA 1QOXA 3NQGA 3TE9A 1US2A 3ITXA 1E6NA 4UTTC 3QQWA 4NYYA 1I2OA 3ID7A 4RR4A 1R3YA 4DZAA 4C6PA 4U5KA 4TU1A 4GVHA 4O15A 5C8BB 4O0QA 1DE5A 1Q5MA 1JVNA 3ZVIA 5E0KA 2GVGA 3VKKA 4GGHA 5HMDA 1QPNA 4C90A 1TTIA 4RV3A 4QJ4B 4LV4A 3G1RA 3GIPA 3DHPA 4GCXA 4LB3A 3HQPA 4DZ5A 1J0HA 5BOFA 3UA3A 2YLLA 2GSHA 1SZRA 3RMJA 3WO8A 4JNZA 4HNNA 3LM7A 3LCHA 3AXIA 3NQVA 1UBSA 1X8FA 1QPQA 2YCEA 3GLCA 4LF1A 3GM8A 1S5VA 1RBAA 4OBRA 3QEZA 4JCLA 1X39A 4GJIA 4B15A 2NV1A 4XUGA 1HKVA 2IQTA 2OO6A 5IRPA 2V38A 2PBOA 3C0LA 3RR1A 3IARA 1CLXA 1TWDA 1YMYA 2VUYA 3UZJA 5BXSA 4D8LA 1XD0A 3CGTA 5H6HA 2CLEA 1UOZA 3TSMA 2IQ0A 3GE7A 4ES4A 3IJLA 3KL3A 4K1WA 3LHTA 5G2HA 4C6LA 3VOIA 2PF0A 1QU4A 5LA2A 1W9DM 4S3GA 3CHVA 1XGDA 4ADTA 3QKZA 2QCGA 5TD4A 1ZPTA 1QRQA 3E49A 5D30A 2QDHA 1V7AA 3E74A 1N7KA 1V3MA 3MO7A 3S2JA 2PCEA 2V3GA 1WDQA 1TWSA 3TIMA 1IXOA 4PL1A 2PC8A 1G69A 3B0VC 1SYTA 3UWYA 2XN1A 3VGHA 1YX1A 5BXPA 4MDPA 3JS3A 2O9PA 1XH0A 4QEEA 1PWMA 1TV2A 2INZA 1EF3A 2YCKX 1ZAIA 4K39A 4PEEA 4GX8A 4FIQA 1OFQA 1E0XA 3O15A 2V2CA 1V79A 3PBMA 1GYMA 2CXEA 2HVMA 3UJFA 3RPDA 1LZOA 4E3VA 4FOUA 1GZJA 4S39A 2OWXA 5CPQA 1QR7A 1DIKA 4MNKA 3S5ZA 5I3FA 3CZJA 1E6RA 3BANA 1A53A 4AXNA 3L12A 3G1XA 3WF4A 5CSYA 2FMNA 2A3BA 4B4HA 3F5KA 2DZBA 3KP0A 3BW3A 4JGDA 4DWSD 5I06A 1WO2A 2E6YA 3HV8A 4JX6A 4M19A 2CBVA 2FB2A 3WLKX 3V5OA 2XG9A 1J0YA 3A21A 8RUCA 2WANA 3SY5A 2J4GA 4JR5A 4GC4A 3L5MA 3B9AA 1MEHA 4NXKA 2Z7KA 3OG2A 2HXUA 2V2HA 4PSRA 3UGVA 3BPWA 4BKNA 4PBEA 4Q8MA 4Z2HA 2FZ9A 4JEJA 4JL2A 2WZEA 1R86A 4WK9A 2DIKA 3TYBA 2V63A 2B4GA 1EGZA 1LWJA 4MWAB 2VR2A 1JFXA 5HQMA 1TMHA 2A3CA 1CECA 5FIPA 4D8AA 5CLTA 4F0KA 3JW7A 3AAMA 5TF0A 1TRIA 1CLKA 1MEIA 3DGRA 1PVNA 2F2HA 1OG6A 1RAKA 2XIOA 3N2TA 2ASHA 2Y89A 4CEUC 4DY1A 5FACA 3VE7A 2IPJA 1C92A 4GQRA 3BAYA 1QPRA 1H63A 1EDQA 2BY2A 3L67A 3PB0A 4JN6A 1B31A 1JQVA 1QPKA 1ISXA 5AECA 4PMXA 1O5QA 1FXPA 2E4TA 1VCFA 4M56A 1UR3M 1JL8A 2PU1A 4Q8OA 4YS1A 4WXYA 4L4LA 4D6EA 4X9SA 2X05A 2Y4SA 2CITA 4Y8EA 1YPIA 1RV8A 3CZEA 3GIQA 5M03A 4XX6A 2F6UA 4UBPC 3UZ5A 3KDNA 1QW9A 2F6KA 4YN5A 4EF8A 4B9YA 4PZVA 3MP5A 3VFCA 2V5CA 4HNCA 1EXPA 2PPGA 3M6DA 5T9BG 3UWUA 3PZUA 1WZAA 2F38A 2I9EA 5BXRA 1ISZA 5BOEA 1SO6A 1XV8A 4QFUA 5FEZA 3BMVA 4W8AA 1Z48A 3TNBA 2A0NA 3PSVA 1OFOA 5TBOA 3TTYA 3BSHA 4YYFA 3DZ1A 2F9RA 2WZIA 2C0HA 2A6LA 4PFMA 2EPMX 1P1XA 1E3ZA 1KD0A 2Q71A 4XZHA 1SU5A 4BHYA 3ZT6A 3MA8A 4Z0SA 3EWBX 3CC1A 5CGTA 5C7HA 1QAPA 3S6TA 3M0YA 3EWCA 8XIAA 3C2FA 3ATZA 2E25A 4BS0A 2V5KA 3BE7A 5GNZA 4IH3A 3W1UA 1ME9A 3CZLA 3DFHA 4GQQA 4K68A 4DJFD 4XZMX 1G4PA 4LUJA 3QY8A 3WJWA 1KTBA 1KFBA 5EMMA 3R13A 2A3EA 5AYBA 4CUCA 4HA4A 3O9NA 3T55A 3G3MA 3INPA 1MNZA 1OIFA 4MDOA 1S5NA 4QCFA 2GFTA 1HUVA 4KH2A 4W87A 1XSIA 4FZIA 3KBVA 6A3HA 4P7LA 5LNWA 3QLDA 3GFZA 3T0AA 2YYUA 3VMPA 2XWEA 2EPNA 3WENA 1LOSA 3MBFA 3RN6A 5ECVA 3G22A 4UQCA 3BAKA 3CAKA 3NM1A 3SW6A 2VC5A 1V6WA 4KPLA 1X8CA 2ZZ1A 3R58A 1U5HA 4UNIA 3T4CA 4PMZA 3EXRA 1HGYA 5KZMA 4MWAA 5ABHA 4XSLA 1ITCA 3IVTA 4O57A 4REQB 3N29A 2XJ7A 3U8GA 1Y8BA 2DJXA 1TRDA 4XZLX 5AYXA 2EG8A 2XVGA 3CLMA 3NO3A 3MC5A 2VMFA 3RYSA 1NH6A 4AG0A 4N02A 3PB2A 1IEXA 4OGZA 4IIFA 2YB4A 4AIOA 3C0SA 1ITUA 2G96A 4H8NA 1X96A 4BQ2A 1MSSA 1VFLA 4GO8A 4MB1A 1VFMA 4OHQA 3MHUA 3P82A 3G6LA 5CSRA 2VFHA 3LBMA 4OT7A 4GPNA 4E2VA 2VM8A 3W2LA 4RJEA 4WDUA 1M7OA 4XIAA 2PE4A 1JUKA 1LLWA 3JZUA 3DIPA 3H22A 3JUGA 2PDCA 4XD5A 1IR1A 3EDJA 3HOJA 3BV4A 1KBKA 4EPEC 2NVAA 1EPVA 4XO6A 3QGKC 4NT0A 2IKHA 3SSZA 2QCDA 3GVWA 3VABA 1GKRA 2G50A 4LXFA 3NSMA 4C6EA 1YDVA 1GQLA 1PE1A 1PKLA 2J8FA 4O19A 3BTNA 3ARVA 2DZAA 5I3HA 4BY3A 4ZSTA 2WK2A 3ZVHB 1AK5A 1B4KA 5FKYA 1WA3A 4ZL1A 1V4YA 3NEHA 2E6DA 1J01A 4R5EA 1O7AA 1LRTA 1BYCA 3VDAA 3G0UA 4L64A 3LTYA 1R85A 3QQ1A 3ABXA 1HL2A 2PDPA 1JULA 2VKZG 1XG4A 2I1OA 4AD5A 4DBDA 3THUA 4AD4A 1QW8A 1F8IA 4PBGA 2PC4A 2VZTA 4LRSA 1P0EA 1UR1A 2I9UA 1LORA 3PZTA 1G0CA 2A85A 4B91A 5HULA 1VENA 3ZIZA 3QRHA 1EP2A 4X63A 4AWEA 1LL6A 2VQTA 2BGSA 4IHCA 3W22A 3PG8A 1FWFC 1WCGA 4LVBA 2G0WA 4IISA 4AEEA 2HK1A 2HVOA 2J66A 1YQ2A 1G4SA 3B4UA 4JHMA 3VTRA 4A3QA 4HOWA 2WKGA 1MUCA 3L4UA 3NL2A 3EA1A 1LRQA 1FH9A 3W37A 4L1WA 2G4JA 4HMCA 2RKXA 4I90A 4QCEA 2DH2A 5CC5A 5CBBA 1W56A 1MQRA 2PTWA 3CB3A 3A6OA 3B8TA 2JF7A 1WZMA 2FPYA 3VFLA 1VP5A 3B40A 3WD1A 1E4LA 1DWHM 2V3DA 4HZMA 3BLKA 3M07A 5LIKX 3RLGA 3KLKA 4OJYA 1Q8JA 1MUMA 5GJPA 1OK4A 4DF2A 1SSGA 4REQA 1AW1A 3L4TA 3VGGA 3TSDA 1KGUA 3VKCA 2UWFA 2VC9A 4J27A 4KIRA 4FHAA 1US3A 1EX5A 3WLHA 4OUIA 4RE4A 2B7OA 4AEFA 4UQBA 3C8FA 3GRIA 1P1MA 3LK6A 5CGMA 2KAUC 5G2WA 3WBAA 2WM0A 4X2RA 2HCVA 3NDOA 3SO7A 1GHSA 4JHZA 1XDMA 3L2MA 3IVSA 1EJWC 1ZBCA 2W3ZA 2FTYA 4CKQA 4JICA 1V0KA 3WYZA 4ICMA 3CZ8A 3BG5A 3H7UA 1G67A 1L2UA 1IEWA 4KWUA 3WEMA 1WDSA 4K1GA 3V7PA 2ACSA 2GUYA 2ON3A 4DVOA 2VQUA 3QFWA 4OKDA 2RDUA 2WBKA 4NNBA 3U0HA 2DSUA 4DM1A 1LT7A 3QZAA 3VO0A 5BU9A 4URIA 2HS8A 2OLSA 4AVOA 1FOBA 3OZMA 1FCBA 4AH7A 4Q8PA 4LOCA 2CHOA 3W87A 4B5NA 2NXGA 3T0CA 1TQJA 4JDYA 3AHZA 1G01A 4JNYA 1C7SA 5A2CA 3HM7A 3GXDA 3FCPA 3SCNA 3BL3A 2ZRUA 4PMJA 2W9MA 1WDRA 4N9BA 3SCQA 1QWGA 4LUTB 1XF0A 1W5QA 1XLKA 5DMYA 2VWSA 1OJXA 2E5CA 4WDTA 1B4EA 2QS8A 3MT1A 5LNSA 2DSWA 5IBXA 4RUBA 2OT1A 3ZVHA 5AC4A 2PGFA 1OZQA 4I6VA 1FDZA 1A3XA 3IRSA 3VPLA 3VXGA 5CZKA 2R82A 3DFTA 3CL7A 4MKNA 1K3UA 5A2BA 1I2QA 3CAVA 1VPXA 4NG3A 4ZXOA 2FPTA 4HTYA 5FL0A 3N2CA 2E77A 3IS4A 4Z0JA 1RK6A 3WL1A 1DEDA 1E9ZB 5F7UA 1W9BM 2DSKA 2ZX6A 2AQWA 1WZKA 1G5AA 3UT0A 3I4KA 3RGTA 2JEPA 3SAZA 3STPA 4LWWA 1ZCCA 1XINA 3U9IA 4EKJA 2A7NA 4DIAA 2DW7A 3EWUA 3W1TA 4Z1BA 1KA9F 1S3TC 3FJ4A 1K1DA 2HZGA 2I16A 3RILA 3GO2A 3GG8A 4M6UA 2XSAA 4UTUA 3L0KA 3NL5A 5LHEA 1V02A 4MHBA 4LEQA 3GS6A 3ITYA 1DTUA 3UXIA 4WHBA 3VOFA 2HWGA 1BF6A 2XDFA 4GXWA 4MGGA 1OINA 2WXDM 2Y8UA 1B3XA 3E9AA 2FZ8A 4ZTYA 3QV7A 3PTKA 3RLHA 3GR7A 1FHUA 2QJHA 4HHPA 4UB9A 2ODOA 4O50A 1AW2A 1J79A 1W1TA 3B8VA 1HKIA 4GZ7A 4QG6A 1UWIA 4WGXA 1W91A 3WUFA 3SN4A 3U2OA 3YPIA 1AD4A 2YL5A 3HG3A 1NELA 1Z44A 4U5IA 1KLZA 2Z1XA 3LLXA 9XIMA 3O6YX 5LNRA 2CLMA 1ALDA 1EGMA 4RPQA 1UR0A 3A9BA 4H6EA 1OIMA 1LM1A 2PEVA 1IT7A 4XZWA 3F4NA 1T96A 3E2QA 3P2VA 4R7JA 1V6YA 3VCRA 1SMAA 3UXDA 4ZMGA 4X2PA 3VIPA 3GKFA 3CUHA 3SRHA 3RJXA 1NAL1 3ZSTA 1IXNA 3WQPA 5D2XA 5KZDA 1AA1B 3V4BA 4YYCA 1IXPA 1DIEA 1F4HA 3WK0A 1JCMP 1EA9C 2V3FA 3DBPA 2QDGA 1ISWA 2BASA 3RMEA 1TTQA 2QIIA 1E5NA 2XGBA 3H7VA 3QXBA 4RXGA 4IM4A 1L8PA 1R3SA 4AU0A 4C1LA 5LHFA 3KCLA 3SN0A 1RJQA 1E1FA 4DAIA 1PZ0A 2YLAA 3K13A 5E6ZA 4HMNA 3AS0A 3LCFA 2NSOA 4K6AA 1OF8A 4LUTA 4YHGA 1CT5A 3LA4A 2QULA 5FJOA 4B3ZA 5DXYA 2FFIA 4YCPA 3D46A 2BVTA 3WDRA 4LS2A 4UXDA 2PTDA 4OBSA 3UNDA 5A6BD 3IIXA 3S42A 1CB7B 2EF9A 3T8LA 4M1BA 4GGBA 3W88A 4LYPA 2MANA 1SGJA 3C0QA 5DLCA 3RNDA 1EO5A 4Q4KA 2QMKA 2V5BA 4E2OA 1C8YA 2PFHA 3MUAA 1OFPA 3RAOA 1PIGA 4M80A 4AHOA 4MYXA 2RHGA 4MSSA 3CUFA 3JZEA 3WJZA 3KVJA 4WSHA 3WQ8A 1RPKA 3CQHA 2YDAA 2DEPA 1RCXB 4TVUA 1VYPX 2ZTJA 1E1CB 3LBCA 3BWWA 4GABA 3G1HA 1GKQA 5I77A 4RNHA 3UPWA 2UV8G 5H8PA 4UFLA 3E0VA 3BSGA 2QXWA 1SZGA 1M9HA 3Q94A 4NZ3A 1TX2A 3WQ4A 4O1BA 3SQLA 4LS1A 3N2BA 5CC3A 1UR9A 2HEJA 2WPBA 2GSEA 4KT2A 4GACA 3T07A 2QVHA 2DSZA 1B9ZA 1BYBA 1RP8A 4F2TA 7XIMA 2O7QA 1PKNA 3KHJA 1XKYA 3AYRA 5DY3A 2FZDA 3E0WA 2BXZA 1CPUA 4IZGA 3PTDA 2WKLA 1TCMA 2BGQA 1HKWA 2E6FA 3MSGA 1FH8A 3GIYA 2PLMA 3OZOA 4XKYB 3VNYA 1AVAA 4R9XA 1E55A 1XFCA 4YWIA 2QEZA 2ZQ0A 3LRLA 4CNOA 3IK4A 4L4PA 3DU0A 1SZEA 3KVKA 3FXYA 1QK2A 1I0DA 2J75A 4K36A 1JF6A 5H2ZA 3HGSA 4IIBA 1LG2A 1IEQA 4J28A 7REQB 1M7XA 2YZRA 2O4MA 2DQWA 4MWAE 5CH9A 2E9MA 3IK2A 1QHPA 3I7SA 2Y62A 3UJ2A 2FIQA 3H6OA 2PZNA 3AMLA 3TA6A 3NSNA 2ANUA 3GHUA 4ZSUA 2DQXA 2J7DA 4L9YA 3SADA 5K2ZA 1LBFA 1PSCA 4JTSA 4HN8A 3UU0A 4C6KA 3ZOAA 5TIMA 3L4ZA 2XSBA 3P3BA 1Y65A 4CNSA 2WVVB 4ICNA 1DQUA 5CAHA 3PPHA 4U3AA 1OHLA 3FYOA 1ZAJA 2BMBA 2XZ9A 3TYUA 1SFSA 1E9LA 2Z1WA 3AOFA 1CX9A 3TP4A 1C8QA 1TG7A 2UY5A 4RZ4A 3TMLA 5JVLA 3WUGA 3P5ZA 4GNKB 3K46A 4W89A 4EXBA 4UTFA 3AROA 3ZMRA 1X7IA 3N6JA 5BZAA 3T05A 5EBUA 4IIGA 4H8UA 2W61A 1FFQA 1MQPA 3B3DA 3UCCA 2HDJA 5EPDA 1KWKA 2PCQA 1RR2A 1JYVA 4A3RA 1KGXA 3SUWA 4LW7A 4WDWA 3W27A 3CASA 3SRDA 1GWJA 3OYXA 4Y7EA 1MXGA 3WH9A 4G7EB 4H7VA 1Z6KA 3FX4A 1E1CA 1NP0A 1KFLA 2TODA 4H8HA 2A3HA 2C1GA 1W1VA 4DN1A 3SRFA 3O05A 1VYRA 3FOKA 3B0YA 4TIMA 3WX7A 4JFWA 2FGBA 1ZAHA 3M64A 3CK5A 1Q13A 1ISYA 4KS0A 4HKPA 3GNRA 4IOTA 3TNOA 2QJGA 2X2GA 4W85A 1E72M 2D2GA 1G9HA 3LNPA 2QAFA 2QUUA 2NT0A 4XVDA 1QATA 1IWAA 3MMWA 2KX9A 2VFEA 1CB2A 1XLDA 3CEUA 3IGUA 1Z42A 1VFUA 1ME8A 1UZ1A 1GEQA 5J5RA 3PVFA 1NOFA 3CAWA 2B0MA 1E4NA 1JPHA 2JALA 5A8GA 5EFFA 4GNVA 1FH7A 4O10A 4AZ6A 1RUSA 2AAMA 4KETA 1XICA 4BQ3A 3WCZA 3ORWA 1B30A 4XKYA 4O18A 2HE8A 3UXAA 3QSTA 2PDMA 1ELSA 2VD8A 4H6RA 3ZJKA 4MB3A 1PL9A 3RF9A 3E6EA 2XYLA 1Q7MA 4YVXA 3W7EA 2A3LA 3ARSA 4DI8A 5HPCA 1MRQA 1S5WA 5I6SA 1NWRA 4O11A 7REQA 3SCUA 5AHFA 4DJED 3I3BA 3FN9A 5HNNA 1ZJHA 2G4FA 1VLIA 4RW3A 1F2JA 2GVYA 5CXPA 4RW5A 2Z1KA 1CI1A 3GYEA 2DZXA 3CMFA 5D38A 5M5DA 4JPGA 2ZBTA 2Q8XA 2QUMA 3PWAA 3LPPA 1KRBC 1YE6A 3LPGA 2WVVA 1FDJA 2D0GA 5C9ZA 4WEVX 2ZRYA 4N9CA 3DFOA 4BQ4A 1MYRA 4DNMA 1S1RA 2VO5A 2OQYA 3EDEA 1O6IA 3WMBA 1WV2A 4DWSA 2P10A 3QTGA 2X1IA 1R47A 4FNSA 5AC7A 3QMTA 2Z29A 3VMOA 1B3WA 3IGXA 3NM3A 4QDPA 1EWEA 2QV5A 4Y9NA 1OX6A 1CGYA 5AB3A 3PZQA 1IZJA 4XTDA 4JIQA 5IDZA 1A5SA 4CQCA 1FRBA 5HQEA 3URQA 2C15A 4P7NA 2PRLA 3VNMA 2VX6A 3ZWTA 4WX2A 5DO8A 2YR1A 2CKSA 1PO9A 4O52A 1ZB5A 1P6WA 1OSEA 1JRCA 4G7EA 3RRAA 3GZAA 1LQ0A 1FWCC 4O0ZA 4UMCA 4I5XA 4NJGA 4LQ1A 4Q32A 4XAFA 5XINA 1FWIC 3MZNA 1N8WA 1B90A 1H7RA 1FVPA 1XS2A 4GY0A 2J24A 2ZCGA 3H2AA 3PNUA 2J7GA 3ZYZA 2PA6A 4AD0A 1QK0A 2PD9A 1GEHA 3LG3A 3M44A 3CHCA 4N4QA 1PX3A 4B5WA 1OVDA 3STCA 5I2UA 1HN1A 2VRQA 4C1KA 1GVRA 4IL2A 5EGRA 1EYEA 3W7GA 4QROA 1RCOB 4F48A 3LQLA 3EKGA 2IPFA 3VNIA 2GVJA 2ZRVA 1ITXA 1V02E 5G4HC 1R7OA 3TZFA 2NVCA 2VI0A 3B9DA 4UR9A 3GW0A 2ZC8A 2QW5A 3G1DA 2P8BA 2INEA 5HPOA 1V3HA 4AXKA 1YDOA 5HMSA 2R1KA 2CNCA 2QJNA 3O1NA 4MLJA 4NILA 1CZ1A 1FA2A 4CQ8A 4WOQA 4QDWA 1GQJA 2CC0A 2HROA 2JKPA 3M6YA 3KCOA 5BRBA 1QCWA 1O66A 3VYLA 3T8QA 2E5BA 3VIIA 3LX9A 4IGSA 1XYBA 1AZ1A 5SWUA 2E0PA 4C6DA 4EX4A 2ZRZA 3AMGA 1E71M 2YIHA 4A8NA 4PMYA 3N9RA 2P1FA 3RM9A 2Z28A 5C5YA 1BWVA 1ZJAA 2PMQA 1BEUA 3H8AA 5AC8A 3ELFA 1Q7QA 4HU4A 4NZFA 1WNOA 4IXXA 4DJFA 4PULA 4TX6A 4LANA 1DL3A 3MKVA 1DIDA 1B3YA 2DH3A 5KMYA 4S3AA 1ZLPA 3FAXA 4L5ZA 4IT1A 1K4HA 3RR4A 2ZUMA 4ZO9A 4PRWA 3CT2A 3OJGA 3OEXA 4W84A 3NQBA 2FJKA 3RFAA 1WYIA 2FVKA 2V67A 1H62A 3R1ZA 4UTIA 2WAGA 3AYVA 3MHFA 4UTTA 1MW2A 1XQKA 1W2VA 4Q33A 2W62A 1J0ZA 5XIAA 3MPGA 3L2IA 4K8EA 5I02A 5KZEA 4Y9AA 3BLFA 3UD6A 4UFJA 1W17A 3UCDA 1SM9A 4NX5A 4AWSA 1U2YA 3NZRA 4F2BA 2Q02A 4YU1A 2IKIA 2PLCA 2VZOA 3PR2A 1BYDA 3G24A 1RQEA 4KERA 4DZHA 5KZ6A 1VBRA 3PZVA 3SCVA 5C70A 5CPNA 5G1MA 4Q4OA 4UWMA 3GFYA 5GPRA 3S2MA 4EIVA 4QSFA 1LBMA 1Q7ZA 2XIBA 4H9ZA 4QS5A 2VTFA 1KXQA 1GZGA 3N9SA 2EPOA 1RALA 2IW0A 2PDYA 5CC6A 1EYWA 3IGHX 1P6CA 4WJEA 1GVFA 2Z2UA 7CGTA 3GBDA 1M7JA 2VL4A 3DFYA 4R88A 2ZA3A 2PDBA 3VKAA 4CNUA 5HAOA 4RPPA 3WQDA 2HTMA 5CBIA 1JGIA 1N55A 3CUGA 5IDIA 2OPJA 5KEZA 1GOWA 3ZZ1A 4F2UA 2O9TA 1I9CB 4HCDA 4Q3MA 3LCGA 1SQ7A 2JFEX 3VA8A 3S8HA 1F3WA 2NUWA 1OFRA 2ISWA 1Z89A 3CT7A 1EWDA 4JTAA 2QF7A 2XGZA 2O9RA 3VCNA 3G3DA 1U30A 3HIJA 4RE3A 5PTDA 3S5OA 1XIEA 4M81A 4UFMA 3AICA 5A6SA 1H61A 3W3OA 5A6AA 3MVTA 4A6GA 4ADSA 1X6UA 2E1DA 4ZEPA 2GGEA 1P48A 1XBXA 3VAVA 1H41A 3WBXA 5IFTA 7TIMA 2DT1A 1S46A 3UESA 4WKAA 2OQLA 3CTLA 4NRRA 2R91A 4JTLA 2XFYA 4JQAA 2YOCA 3B06A 1EJSC 3VZYA 4L6DA 3TW9A 5J8LA 1I45A 4OV9A 5EMUA 7A3HA 4NASA 1RBLA 2YCIX 1S2UA 4ZFCA 2YYTA 1O5RA 3UW6A 5KITA 2PGWA 3V35A 4S3DA 5AKQA 3TCSA 2J9ZA 4WUIA 4FB7A 1L8NA 1GOOA 1NY1A 2DVXA 2GJLA 2QCFA 4M51A 3AS2A 4HK5A 2GPTA 2REQB 4E8GA 5E09A 2GDUA 2FHCA 3S46A 2DU2A 3VX1A 3SJNA 4J40A 3CUZA 4B5SA 2G37A 3G1YA 4HNTA 1XYZA 3IJ9A 1ZTVA 4Q8WA 3DFNA 4MNMA 2BSLA 1LCOA 3C52A 3PN8A 1US0A 3VUSA 1YHTA 1YNQA 3NPWA 5CQ1A 5LA1A 3UY7A 1EEPA 3BZJA 3ITGA 1E4MM 4KGJA 2DT0A 3KTXA 1KQZA 4KFOA 4IMFA 4CU6A 3KOZA 3F5JA 2OLHA 2J27A 3W1QA 3Q2DA 5C2XA 1FY6A 1A4LA 1A50A 3G6MA 2GQ3A 3CL8A 3SM0A 3W7OA 3BCDA 5CPOA 1AODA 1CW2A 2QPSA 5AVHA 1LL4A 2CZVA 2DUXA 3TTOA 1DWJM 3VGDA 3NIYA 1FWRA 1FQ0A 5ABTA 5FF4A 1KXTA 1QI2A 1LOQA 3BJTA 3TC6A 3WKZA 1CXKA 4HQVA 3ZM8A 3SGZA 2DZWA 5LGZA 5D2WA 2RJGA 3NQFA 3QF0A 1E6ZA 1UR2A 3AFBA 3K1GA 4E6MA 4LX4A 1UIOA 3IV8A 5FESA 5LNUA 1ZBWA 2Y5JA 3FJ6A 4UOJA 3BC9A 3TYCA 2BV9A 3TLLA 4CCEA 4N6EA 1GUVA 1SZFA 3Q4DA 4P7OA 2PTZA 3SDOA 2Y5EA 4PCFA 4PL2A 2WCAA 4QLJA 3RK8A 1KRAC 5HINA 5H1WA 3S2CA 1ADOA 1TPDA 2OZ0A 3N2XA 4LCQA 2R24A 4H7CA 5F1VA 2BOGX 2HE5A 3FFSA 6PTDA 3AUOA 2QCEA 1YDYA 4QJ5B 5BROA 2TAAA 2ZADA 3GVQA 1NF0A 1TR9A 5F1UA 1KWGA 1GK8A 2NVDA 3L65A 3GW3A 4WF7A 1U5VA 3C2YA 4JTCA 4DUXA 3V16A 1CTNA 4O53A 3R8RA 3ZS4A 1CXIA 2OODA 1I60A 2EKGA 6ENLA 2BHUA 4HP5A 3F4CA 3G77A 3IUDA 1X1NA 3VIOA 3WJYA 1VEPA 3FHAA 3PFMA 2OT0A 4G8TA 2EJ1A 1SJAA 2OO0A 3GH5A 2ALDA 3WJSA 3U2CA 1OYAA 3WY1A 4JEQA 1IGWA 2OSYA 3WUBA 3ES7A 4WQ6A 5AFDA 2XH7A 5JQ9A 1WDWA 3WQVA 4L1GA 5A8QA 3OODA 1YPXA 4DBUA 8TIMA 4YHEA 4CNPA 1R2RA 1V6TA 3P0WA 1N2VA 2B31A 4MAZA 1XIJA 1A5UA 4K7YA 3CPGA 1MFVA 5BRQA 1Q6EA 1RQBA 1R3RA 1FP8A 1TA3B 3IJ7A 4LYRA 4D6FA 2REQA 3ZO9A 3GDBA 1F8MA 5A6KA 1CNVA 3IJIA 2NUYA 3W26A 2B7NA 4HSNA 4AVFA 4EXAA 3M5ZA 1G1YA 3LERA 1RY0A 3LHYA 5IFPA 5REQB 4C6CA 1M41A 2WHKA 2YL6A 1OY0A 2G5WA 1OC6A 3E02A 3WNMA 3UYIA 1MW3A 4Q4SA 1K9FA 1JCJA 3B8SA 1XIHA 1D3CA 4B9ZA 5I00A 3WMLA 3POCA 3M5VA 3F1QA 4GIYA 3IACA 4RKAA 2NQ5A 2PWUA 4N0RA 2XIJA 3V1HA 2FTPA 4RE2A 4HT3A 2NQZA 1Y5VA 2WCGA 1DWIM 3M41A 2WYSA 1W9UA 3ZJ6A 2QUNA 1WDPA 3NQDA 4GHRA 2BOEX 4J1OA 2D0FA 5ABFB 4JX5A 1HVXA 3TR2A 2C1IA 1XCXA 3DOPA 2D73A 1NDVA 3GVVA 3NQCA 4O13A 1NDWA 1KTCA 2IXVA 3NGJA 5A6JA 3QJAA 1TFVA 5E93A 3C2RA 3Q67A 5EKYA 2VCAA 3WF2A 3KOWA 3ITTA 3MMUA 2XZ7A 3O3RA 1OC5A 2BLEA 3GTXA 5DXXA 5AYYA 3NXLA 2YXGA 1J0IA 3TUUA 1RVGA 1LLOA 4HK6A 3W1AA 1TV8A 3K4DA 5KETA 2OKTA 3LMYA 1E6XM 1FP9A 4D1JA 2CFFA 3DI0A 4RZ5A 4ZO7A 5D37A 1ZFJA 5E1QA 2X7VA 1O5KA 4DEFA 3N1AA 3NQ7A 2B7PA 3EMQA 4AC7C 1VAHA 4UCGA 1UMYA 5A2AA 2FPVA 3W23A 2WW5A 4P2VA 5D9NA 3TZNA 1BKHA 3HPAA 1PKYA 2DT3A 1F9CA 3T0TA 2CCRA 1ZUAX 4XG1A 4B90A 3VNZA 1KKOA 1Q4WA 4AIEA 4H19A 4CN1A 3ZR6A 2ZUTA 1BQCA 4H7ZA 4HA1A 3SUSA 1GVOA 2Y6ZA 1ODUA 4KWVA 4YCOA 3O16A 4HZ7A 1H7XA 1W1A1 2EAWA 3BAXA 3T2OA 3QYQA 3V3WA 5A6BA 4PH6A 1GJUA 2IKJA 4BCEA 1WKEA 3QZEA 3WDPP 2YPIA 1KM6A 5LYRA 1GTHA 5C6MA 3ARZA 1RH9A 4Q6XA 1E9YB 1C3FA 2AMXA 3R7MA 4JAWA 1HNYA 3CV7A 4MAVA 4NZ5A 5K4XA 1M65A 2UY3A 4HD5A 4WKHA 4XZNX 2DZTA 3PZIA 4KEUA 1TA3A 4B5TA 4DUVA 3S6OA 2VUNA 2ZA1A 4GZIA 1YKWA 4P8XA 4HU0A 3VU2A 2W67A 5AYZA 4A05A 2XFFA 1IT8A 4Z2JA 4QNWA 4LVFA 5REQA 3STGA 4N2YA 4H1ZA 4PN2A 4JYFA 2BWGA 4UQDA 1N82A 3RLVA 4ZOEA 4HHLA 1KFWA 4JIPA 3HN3A 1FBAA 3UA4A 2C1HA 3WNKA 2R9RA 4KFPA 2GDVA 3IAQA 1DTNA 3FYYA 4R33A 1TJ2A 3ONBA 1XXXA 1XIMA 1GQIA 1H49A 2VWTA 3PULA 4Y9OA 2QJIA 1C8XA 2WJDA 3BXWA 4KKXA 4CD7A 4AY7A 4LY4A 4V28A 3PBWA 4ZO8A 5D2TA 3S1WA 3P60A 5ABFA 4FXRA 1H5VA 4DUWA 3FVDA 5A3HA 4H9VA 4L4OA 3NZPA 1EB3A 4Z2GA 1E6QM 5C2GA 2WLYA 4PCSA 3BOLA 1VQTA 2FFCA 8XIMA 3BSMA 2Z0IA 4GYKA 5LGXA 2Q01A 3GB6A 1UJPA 4GOAA 4UTKA 1EF2A 4GVIA 1R0MA 4GYJA 1HF6A 5DX7A 1VIZA 1PBGA 2QGHA 5GJNA 1QNRA 3WLJA 3PJWA 4QLLA 2C0AA 2NXIA 5C0QA 1LL7A 1QFEA 1TWWA 5BOOA 3EPNA 2FDSA 2DVTA 2ZE0A 3B04A 3WBYA 2W27A 4E5TA 5T8GA 4WD0A 2Z6IA 3VDGA 3LRMA 5LA0A 1Q2RA 1R38A 2W79A 3N2MA 4MJMA 1Q6RA 4KF1A 2ZX8A 2PLJA 3AHVA 3KDOA 3NJ3A 4YTRA 2OKOA 2GGGA 1A0EA 1A80A 3OLIA 1DIOA 4FAMA 3T0DA 3LENA 2EJAA 1JYWA 2VZUA 1O60A 2CXGA 3DESA 1Y5XA 1V93A 2RDWA 2RH9A 3WK3A 4CD6A 5EYWA 3BOXA 1CGUA 2P5NA 1IZKA 1UKQA 1E0VA 1A5AA 1J0JA 2ZZ4A 1HJUA 4MM1A 2NWSA 4HNUA 1E56A 1ZENA 1J4EA 4HNLA 3EX4A 3ARXA 3M0MA 1BVWA 2YW4A 1K02A 3N3MA 1Q66A 3AS1A 2PGRA 4IMCA 2JKAA 1VYSX 3PZGA 4ENLA 4QGCA 4PTMA 3VIHA 2PI6A 3P93A 3GNDA 3ABSA 9CGTA 5CZSA 5LKYA 3HPXA 4N42A 3CU2A 2J78A 4BEQA 1VFOA 4FR6A 2HPMA 4MJZA 2B7QA 3QQ0A 2W5FA 5FOOA 4D9PA 5LIWX 4GINA 3PUGA 2NQHA 1OK6A 4W93A 1GG1A 2AL2B 3AIVA 3EGJA 4OZOA 4LJ3A 1TUXA 1MXDA 3M0HA 1W9VA 5HNRA 4ACYA 3CV6A 4CQDA 1XL9A 2FH8A 3Q65A 5H8MA 3AWOA 1JUEA 3MMTA 2XVKA 1TJPA 5FI8A 4MZYA 4W88A 1TPVA 3WEOA 1T6MA 3W07A 3AHYA 2GGIA 4PTVA 3ARWA 1K8ZA 4S3EA 4QDMA 3O2LA 3OBKA 1CGVA 1BXNA 1Q6DA 2CU0A 3AXXA 3W73A 2PSNA 1U22A 4GIRA 3BLIA 3R79A 2WSPA 2E9LA 5KTLA 2OX4A 1TTPA 4QE1A 2GJPA 1SW3A 3TQKA 4MNJA 1OZMA 4AYSA 3Q37A 4L9ZA 3CYJA 2EPKX 1H60A 3RU8X 1GNXA 3L23A 1VS1A 4JTIA 3IV3A 4PUWA 1TPWA 4NZ1A 3VD9A 1JG9A 1DJXA 5CSUA 3DGBA 2W0UA 4U3CA 3ZQ9A 1T99A 4AD1A 5DFAA 2E40A 1QUMA 3P14A 2XIMA 1BSLA 3I10A 3GD6A 2CW6A 2E8YA 3M0VA 5D2YA 1TJ0A 2XVPA 2Z4GA 3UWVA 4JIHA 4TTUA 5BNKA 4YMZA 1ZALA 2QJMA 2NSXA 3AIUA 1MEWA 3WH8A 1MW0A 3GDRA 4O1DA 2RDTA 4YNGA 4IMGA 4DJEA 4ERAA 2P3EA 4W7VA 1BTCA 3AZSA 4GD0A 3IPWA 4PUJA 3OVGA 1BF2A 1TR1A 4NYUA 3MU7A 4US5D 5HMEA 4PMDA 4FF5A 4I8YA 1C29A 4IFRA 5C9XA 5U4NA 3HJEA 3WLLA 4KWWA 2V9DA 1EJUC 1G6CA 4J3WA 2QAPA 3L4WA 1ECQA 2A1YA 3AIBA 5JH2A 4ZENA 4AIUA 1EA0A 2QJJA 3WMCA 1PX4A 2J13A 3CAQA 1ZP4A 2J8TA 1G4TA 4GI6A 1J2WA 1WKYA 4IPLA 5HA7A 4KFNA 1U1UA 4X0NA 1OYCA 3TTQA 4G56A 2WOQA 1UKTA 4WRHA 3SGUA 2V2DA 4Q8QA 4DRSA 2F84A 4YL2A 1ICPA 1OCNA 2YBUA 3FA4A 3A5VA 4ZE5A 5FEWA 3MI6A 1WX0A 1KFJA 3AO0A 1IV8A 3FAWA 1BXBA 1HL8A 2NXHA 2NQLA 3HGRA 4WOZA 4C6NA 5I3KA 3V36A 2EPHA 1FX6A 3AIWA