3RX4A

Crystal structure of human aldose reductase complexed with sulindac sulfide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase.
pubmed doi rcsb
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 107
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx4A00
2AGTA 3R8GA 4YVXA 2WZMA 4IGSA 4HMNA 5HNUA 1PZ1A 2PF8A 3U2CA 5LIWX 2IPFA 1XGDA 1GVEA 4YVVA 2IKGA 4WDTA 2ISFA 4JTQA 4ZFCA 2PDGA 2HE5A 2FZ8A 1ADSA 1EL3A 3R8HA 5C7HA 3UZXA 3BUVA 3CV7A 2I17A 1PZ0A 2ACUA 2FVLA 1S2CA 3LZ5A 3EAUA 2IQDA 3R6IA 4PRRA 1Z8AA 1JEZA 2R24A 2PFHA 4YU1A 2A79A 3Q65A 2QXWA 4Q7BA 4JTAA 3UZWA 4NKCA 5AZ1A 3FJNA 4XK2A 1VBJA 1FRBA 2NVDA 3LUTA 1QWKA 3ERPA 3C3UA 3COTA 5JH2A 2PDYA 3H7UA 3GUGA 2PDIA 1IHIA 2DV0A 2F38A 1S1RA 5HNTA 3R94A 3H4GA 4DZ5A 2PDMA 4YVPA 3WBYA 2ALRA 3LZ3A 4GACA 4LAUA 4QBXA 4H8NA 3ONCA 1RY0A 4WGHA 4XVDA 1K8CA 1AZ2A 4LBSA 3WG6A 4JIRA 3WBXA 3EB3A 4JIHA 2IPGA 3UZZA 1S2AA 2F2KA 3G5EA 5LIXX 1A80A 2R9RA 4FA3A 1ZQ5A 2HVNA 4JTCA 1S1PA 1Z9AA 3MC5A 2J8TA 4FZIA 1M9HA 1EF3A 3LNMA 4PR4A 2PD9A 2IQ0A 3ONBA 4JQ2A 2PDPA 3DN5A 2IKIA 4PMJA 3LD5A 5M2FX 3LQGA 4GABA 2PDXA 3Q67A 4IJCA 4H7CA 4XZHA 1LQAA 4QR6A 1LWIA 2BGQA 1ZGDA 4JTRA 4PRTA 4ASTA 4IJRA 5AZ0A 1QRQA 2HEJA 1ZUAX 3EB4A 1MRQA 2HDJA 1XJBA 1X98A 3CMFA 3P2VA 5JH1A 4LB3A 1ZSXA 2I16A 2P5NA 4JQ1A 2ACRA 3O0KA 1RY8A 1HQTA 4LAZA 2PDJA 2NVCA 1AH4A 3M4HA 3FX4A 1R38A 4GQ0A 1IEIA 3UYIA 2FZBA 4XO6A 1Q13A 1OG6A 4L1XA 2PDFA 4AUBA 3QKZA 4QX4A 5LIUX 3VXGA 2IPWA 4WDWA 4FAMA 1HW6A 3V36A 3DOPA 3N2TA 4HBKA 5HA7A 1Q5MA 4Q3MA 4XZNX 2INZA 5KETA 1VP5A 2IKJA 2IKHA 2HV5A 3WCZA 1SM9A 1MZRA 2PDNA 3B3DA 2PDKA 4JQ3A 2PDLA 3O3RA 3RX3A 2INEA 3LEPA 3V35A 2IS7A 4XZMX 5LIKX 3V0TA 3MB9A 1X96A 4JQAA 2PD5A 4DBUA 3UGRA 1J96A 2BGSA 3GHSA 1EKOA 3G1RA 4XAPA 1AFSA 3RX4A 4WDXA 1X97A 4DBWA 4XVEA 1YNPA 4QXIA 2VDGA 4G5DA 2PDHA 3GHTA 3N6QA 4EXBA 3M64A 4GA8A 2DUZA 2WZTA 4ICCX 4F40A 1PWMA 3CASA 3UZYA 4GCAA 1US0A 1YNQA 3LENA 1PYFA 4I5XA 3NTYA 4XZLX 3GHRA 4PUWA 2PDWA 3UWEA 4WDUA 3F7JA 1C9WA 3RX2A 4XO7A 1AZ1A 2CLPA 3LBOA 5LIYX 4MHBA 1PWLA 3BV7A 2HVOA 4L1WA 1T41A 4LBRA 3KRBA 4WRHA 2PEVA 4DBSA 4FALA 2FZDA 2FZ9A 4GIEA 1UR3M 4R9OA 3H7RA 1Z89A 4JIIX 2PDUA 2BP1A 3LN3A 1AH0A 1YE6A 1T40A 5DANA 3R7MA 3R58A 3D3FA 3UG8A 4JQ4A 3M0IA 4XZIA 3CAQA 3T42A 1EXBA 4EXAA 4YS1A 3CV6A 4LB4A 3BCJA 3UP8A 2ACQA 4PUUA 2C91A 2DUXA 3UFYA 2HE8A 2ACSA 3V0UA 4JTDA 3R43A 1AH3A 1Z3NA 1RALA 2FGBA 4GQGA 3CAVA 1MI3A 3V0SA 1XF0A 2PZNA 4WEVX 3BURA 3S3GA 4OTKA 3GHUA 2PDQA 2PDCA 3WBWA 1YE4A 2PDBA 3LQLA 2IPJA 4RPQA
chains in the Genus database with same CATH superfamily
4U2YA 1HL2A 1XLDA 1H51A 4L80A 3WQ8A 3QHNA 2WZMA 3GTIA 8A3HA 2ZXQA 3OIHA 4DZHA 4PTVA 1VJSA 1DXIA 1IXNA 3S83A 2XIBA 3BOLA 2QJJA 3TQKA 1Q4WA 1F8MA 1M53A 2BS9A 5MF5A 4Z42C 3H26A 2BVWA 2PWVA 3QPZA 1U33A 4BS0A 3B8TA 2B81A 2WHMA 4AISA 4S3JA 2QYGA 2GWNA 1V7AA 3CV7A 1TPDA 3WH9A 1VF8A 1FWCC 3HM7A 5BXRA 3AIWA 5FF4A 4HHMA 1N55A 2HS8A 1JR1A 2WSYA 3LZ5A 4K7VA 3DFPA 5C9RA 4P7OA 1KR0A 2GGHA 4HHHA 3QFWA 4HZ8A 1S2UA 3Q65A 1J10A 4F0LA 3N2OA 4H9TA 5EMJA 3NPWA 3TVAA 1S3HA 4AZGA 3TZFA 4B4FA 1ZY9A 1XLCA 3VNYA 3W26A 4E4UA 4JTGA 1P0BA 5DRIA 5JH2A 3WUFA 3EEZA 3EDDA 3K46A 2QCNA 5DXYA 4C6BA 3RJYA 3B8VA 1LG2A 3N4AA 2XINA 4DF1A 5CGMA 3ITXA 2PP3A 5D02A 1L9WA 2J7DA 1AD4A 1IGWA 1R3SA 4MLJA 4I9TA 3M0VA 1XYLA 1I8JA 2J7BA 3AFBA 3MKCA 4LBSA 4C6JA 4JIRA 3RU8X 5AY7A 3A64A 4S1FA 1ISVA 1BG4A 3HPSA 4IPJA 3G1DA 3GNXA 1CXLA 2OMAA 4MADA 2ZDSA 3I6TA 5EMUA 3E0WA 4DJFA 3CM4A 3QV9A 3CAWA 2X1TA 3OGSA 4QGCA 3QMSA 3QQ0A 3W70A 4ZVJA 3KRUA 1CXHA 5I7GA 1ICPA 3L65A 3ONBA 3WLOA 5BWFA 1EEPA 1MUWA 3OTRA 4D6IA 2E68A 4PCNA 4QRNA 3H4XA 4O50A 5BW6A 4Q8NA 3ARSA 7REQB 3OU8A 4U28A 5I3JA 3UA4A 1MFVA 4JL2A 3WUEA 3OVGA 1WZKA 1J01A 1EO7A 1H7OA 1QRQA 3AIBA 1JYVA 3NQEA 4OBRA 3IGUA 3NL5A 5IHSA 4E2VA 1WPCA 4MY9A 1WQ5A 3P0XA 4LVBA 4GYKA 3O0KA 4PMOA 4N6EA 4CKQA 1JZ7A 4Q33A 6REQB 1HQTA 3LNPA 4LX4A 1N7KA 4IX2A 1DJQA 3ITCA 3GH7A 2YBTA 4IG2B 3W75A 4KCWA 3PTQA 5CPQA 1OG6A 1KD0A 1RBOB 3NZRA 3SN1A 3GVVA 4HHLA 4Q6JA 4S3DA 2I9EA 5BWAA 2XFFA 1V6UA 3MSGA 5FL1A 3IGSA 2IPWA 1PIGA 2ZXDA 3WH7A 1OJXA 1ZBKA 4PZVA 3OVRA 1GTEA 2YCJA 4DYJA 3NPUA 3C2OA 1KNWA 3BANA 5LHEA 3MP4A 1ZP4A 4CQCA 4R5EA 4M3PA 1XG4A 1XUZA 5K4XA 1K7EA 4FOKA 4PSRA 1W9BM 4WGXA 2ZA2A 1SPQA 3ZLGA 4JQ3A 2Z7KA 3BOXA 3LHVA 1OT1A 3NDYA 4L5ZA 3MS8A 1K9FA 5GNYA 1KM1A 2C1GA 2QV5A 2EPMX 2HNHA 2OEKA 4QS6A 4JQAA 3EWYA 3LCLA 5ABTA 2CZDA 1GJPA 2PD5A 4LYPA 1VGAA 3OODA 2J9XA 2H3DA 3RX4A 1ZENA 1YKWA 1B54A 4PTMA 1YNPA 1IXPA 1UJQA 4G5DA 1SVDA 3CTLA 2BWGA 5BNKA 3GHTA 3XISA 1SJAA 1BWLA 4L6DA 4J3VA 3ZT7A 4TU1A 3TJLA 4GVFA 3B9AA 4N02A 5HMDA 1PAMA 4BHYA 3HOJA 4CCCA 1YDOA 1GVOA 1LQ0A 2F2HA 1ML1A 1Q7QA 1J9YA 1OIMA 1NARA 3FXYA 1F74A 3UWEA 2HK1A 1YIXA 4XO7A 1OX4A 4D6EA 4B5VA 3EKZA 2CLPA 1W1YA 3LB0A 3M16A 4C90A 3UQNA 2Y24A 3WQFA 2F84A 3GAKA 4UTHA 4QP0A 2ZUUA 4JIQA 1RLCL 3GQYA 3KRBA 3REQA 1O5QA 4DBSA 1BHGA 2VENA 4PEKA 3KWXA 3U5YA 2E9MA 4ZL1A 4MWAA 1B3XA 3OQEA 4ZQRA 4UTLA 2ATMA 1YE6A 3GD6A 1RXOB 3VUPA 1MW0A 1GNXA 3GIYA 3GG1A 4JTTA 4X22A 4UMBA 4LB4A 3C0LA 3ITTA 3NNTA 3A4JA 2GGGA 2E5DA 1R5YA 3AIVA 2C91A 4J3TA 3UZ5A 1GUVA 5CPTA 1QU4A 3R25A 4YTQA 3ARPA 4CU8A 1V51A 4QFUA 3BPWA 1I4NA 2VGBA 2Y8UA 4GJIA 3LSCA 2GDUA 4Z0JA 5GVJA 1W9DM 2OYMA 1NDZA 2VO5A 3HQNA 2XVLA 1X7IA 2ZICA 1YE4A 4YWSA 2UZ9A 4M7TA 3TXVA 1UUQA 2QHAA 2C15A 3T40A 3E0FA 3BGGA 5CPNA 2AL1A 5B7YA 2YXGA 2DQXA 3C8NA 3G8RA 2XFWA 4Q4MA 1VB9A 3RGTA 3W86A 1S5MA 1XR2A 1JDCA 1DIEA 3EOLA 1LBFA 2WMKA 1LG1A 4YVVA 1IR1A 3BVJA 3BZJA 3TOPA 4F66A 1XD1A 3MJYA 4DM1A 4JTQA 1KBIA 2HXTA 3I4KA 2FVMA 3TYUA 1H4PA 3TA9A 1XUUA 1ADSA 4K8EA 2X1IA 2BMBA 3NO1A 2I17A 4JYEA 4XZWA 2Z6IA 5I5RA 2YGYA 2YL6A 2ZCGA 1Y5VA 2IQDA 3QJAA 1JULA 4HYRA 4O53A 5I3DA 1O66A 3MQTA 3UJFA 3SCRA 5C71A 3VDAA 4GMEA 3M0ZA 3MUY1 5AZ1A 2QCLA 3AMKA 5JVLA 3DYMA 1HN1A 1XIDA 1D8CA 4O1DA 2W62A 3C56A 1UBSA 2VT0A 3AMCA 4XKMA 3B05A 2O55A 3ARTA 1FUYA 3OB8A 2JQXA 1V3HA 4DUWA 5AYYA 3H8AA 1QW9A 3BTNA 3JS3A 4HSNA 3UXKA 3S5SA 1V6WA 4HMDA 2X09A 1KV5A 1QI0A 3UXIA 3ZT5A 1FH8A 5CAHA 1K7XA 3ARXA 4ICMA 4CNSA 4FNQA 1JCJA 4GISA 3T8LA 4FXRA 1YXDA 5AYXA 4HU8A 2ZOXA 3QOMA 3W07A 3UZZA 3TN6A 3PHAA 1UPMB 4Y9MA 3WDQA 4O18A 3RR1A 4JBRA 2DSVA 2R9RA 1ZQ5A 4UBPC 4XD3A 4C6LA 1RPKA 1UIOA 4QLLA 4AX7A 4PN2A 3MMTA 2W79A 3S5YA 2CBUA 4WKFA 1SR0A 4IIBA 2Z1VA 2YOCA 1SZEA 3GDTA 3GTHA 3GU9A 3WNKA 4LFYA 3MCMA 4FS9A 3V16A 2EAWA 1CGVA 5ECVA 3WYZA 5E6ZA 4MLRA 4JTJA 5CPLA 1NVMA 3T0CA 3PTKA 6REQA 2RAGA 4NZ4A 1ZAHA 3I10A 2V5DA 3ZLFA 3L5AA 3MI3A 3AXKA 1Z32X 1Q2RA 3WJWA 3FJ6A 4XKYB 4IG2A 4EX4A 4MIMA 4C1LA 1UD6A 1U22A 5DFAA 5EPDA 3UG3A 5TD4A 5IOBA 2NW0A 3VU2A 2PWFA 1W1A1 1EWDA 3S2LA 3GW3A 2BV9A 3SQSA 1LROA 2XVPA 5DEZA 1L6SA 3TZNA 1VHCA 2Z25A 1E0UA 2GZXA 1AH4A 1IEIA 2E6DA 3PZNA 3WD3A 1JRCA 3CK5A 1HP4A 3I65A 1TPH1 5D8WA 5K4ZA 4ZOCA 1UWAA 5CKSA 2WNZA 1IT8A 3GR7A 4I5RA 2QCFA 3FXGA 2Y61A 1R8LA 2YPIA 1E70M 1HW6A 3QHOA 3NZGA 3VDGA 3G1VA 4HMCA 2E0PA 4CD7A 1SJBA 3GVQA 3GUWA 3PM6A 3FHAA 4NXSA 3AXHA 2J6VA 2V67A 1B4EA 3UT0A 4HVXA 1GKQA 4R85A 4R7OA 1JG9A 1YBQA 4BF9A 5FCZA 4Q8VA 2J8GA 1SM9A 3CUXA 1TVNA 1WDSA 3W7EA 3CZJA 1GG0A 4X63A 1EJRC 5CGTA 1LLOA 2VMFA 1NOFA 5F2GA 5KTLA 4AHQA 4TMBA 4CVWA 1DJNA 4Q4OA 2WBGA 4RE0A 5BU9A 4KETA 4IUGA 2OTDA 3SCTA 5CC7A 4QCFA 1DP0A 2XH4A 2CLKA 1J0IA 2YKKA 4WDXA 3L4UA 2GFTA 4IMGA 2PF0A 1I75A 1TKKA 4HQVA 3USZA 3WK1A 3HFYA 1IT0A 2YDAA 1UROA 1ADOA 3DZ1A 3AIUA 2VELA 1A5KC 2V5JA 3WNLA 4AYGA 3CGTA 3GNRA 4FF7A 3MKKA 3W1PA 4GJ1A 3BH4A 1GQKA 1C9WA 2GUUA 3VIHA 1W8SA 2YFOA 3LHTA 3RX2A 4KGLA 1P1XA 2WZIA 2F6UA 2PS2A 1C8YA 2R1KA 2YXOA 5DQPA 3MDWA 5IFPA 4AD1A 1XGZA 3C86A 5AOUA 5FJUA 1NU5A 3UWZA 1FXPA 3AXIA 3CHCA 2BASA 3O6CA 3ITOA 3L23A 1P6CA 3K8MA 2GVEA 1TZZA 1BYDA 1XLIA 4E6MA 1V8EA 1MFUA 2ISWA 1LYXA 1R3YA 4B5TA 3M5ZA 3IAQA 3VIGA 5DCEA 3FS2A 1XLEA 4DI9A 1EXBA 4KCVA 1REQB 2BY0A 4JHZA 4GXPA 1BVNP 3RILA 3FKRA 2ACQA 3LBCA 3S1VA 3SQLA 2CETA 3A24A 2V5CA 1YPIA 3EA2A 2I5GA 3S1UA 3WLSA 2XIIA 4D72A 3TW7A 5FEXA 3VCCA 3AI0A 2EXOA 3B9OA 3F4DA 2G41A 1GOWA 3VFLA 5T9CE 2P8CA 1RCOB 1V0LA 3EWZA 2CYGA 4R34A 3PPFA 3EDEA 4IL0A 4NZ1A 3GHUA 1PX3A 3VGBA 3OIXA 2OQHA 1XS2A 5LXEA 2OT1A 4RDVA 2WKLA 2XVGA 3WSUA 3BLKA 4LUJA 3D6NA 2R91A 1WDRA 1TX2A 2W4XA 1XGDA 1OCQA 2A21A 1UD3A 4J7RA 4XAZA 1EDQA 3EEGA 2G95A 1BGGA 2BNJA 4ZBCA 1OFDA 5KZEA 4MMWA 3TTYA 3VDBA 2DZPA 5B80A 5BOEA 1L2UA 1ICQA 4O52A 3OYXA 3KVLA 1VRXA 3YPIA 3DHPA 1T0OA 3ARYA 4UFLA 4IMCA 5D04C 2D0HA 3ZWSA 5A6AA 5C7HA 2PBGA 3V75A 2PRMA 3URNA 2VFIA 1QOXA 1UR1A 4G2DA 4O1EA 3SUSA 2OX4A 1MVYA 2V5LA 3AHYA 4L65A 3TLLA 3P80A 1HJUA 4YCPA 4Q7BA 1VEOA 1P48A 4P61A 3WNOA 1TZ9A 1S5WA 3EA3A 1QWKA 3LTPA 3RLVA 3GC4A 4Z08A 4JFWA 5E70A 2IXVA 3TDFA 4EPBC 2Z2AA 5EKYA 2QULA 1WUEA 5FF0A 1TB3A 2YZ5A 4N6FA 2WB5A 2XFYA 2I9UA 1XGEA 3EZ4A 2AKZA 5EMLA 2DT3A 2OZ0A 3HMJG 2V2DA 3W74A 4Q4SA 2PTDA 4GD0A 1W3IA 3TTEA 1QATA 3S9ZA 3VKCA 3B8WA 3CIVA 3FIGA 3EPOA 1UWQA 1ENUA 3BXWA 3H21A 5C0QA 1L2QA 4H8HA 5E6YA 3LGGA 5H8UA 5D2XA 1E9YB 2X30A 3DFQA 4GH3A 1RUSA 1K6AA 4XKYA 2DEPA 2VNCA 3PC0A 1WV2A 4DJDC 4ATDA 4GABA 1WNOA 4IJCA 2B7OA 3D47A 2EO7A 4JTRA 5FESA 4FXJA 4GX8A 2YJQA 1I45A 3RU6A 2BZNA 2PE4A 1LLZA 3GZAA 1SO5A 3BLIA 1WDPA 4NIRA 1Q8AA 2VEIA 2RDTA 2HEJA 1TTIA 1MRQA 4V1XA 1R3TA 3MWAA 2HDJA 1LCOA 4IXXA 1WP6A 5M03A 4PTWA 1EGVA 1X98A 2VDIA 5D2TA 2GPTA 1MNZA 3JUGA 1LM1A 4K68A 5DXXA 3CUGA 4FX7A 3RK8A 1XPGA 1FWEC 2VFGA 1GQIA 2QCCA 2XUCA 2QR6A 4OJYA 1FY6A 1SO6A 3TYCA 5AECA 4PUJA 2W5FA 1H1NA 2CWNA 3WMSA 3LLXA 3LSBA 1P0EA 4S3GA 4J3SA 2XG9A 2Q6ZA 4OQVA 4FAMA 1CGYA 1XHGA 5G2IA 2V69A 3DOPA 3GVRA 4ORMA 3PPGA 2TPSA 1F6PA 3TEVA 1A5SA 3E0LA 3QY8A 1XCWA 3BG9A 4PMNA 4IWWA 2Y85A 4EK7A 3N3MA 4B5XA 3CUIA 4Y9OA 2NLIA 2WSPA 1ONXA 3K8KA 1VKFA 1JZ5A 1V0MA 1KFEA 2BXVA 5AVHA 1K6WA 4JN7A 1H3GA 1CLVA 4JTEA 4CVUA 1OGBA 4BJHA 3LI0A 4TX8A 1Z44A 3G18A 4ZOEA 3LPPA 3ITGA 3ZWTA 1CENA 1GT8A 1N8WA 2WVVB 2C14A 3ZZ1A 4HNVA 5I02A 5A6TC 1TZ7A 3K1GA 4HZMA 3BGJA 4CLMA 1D3GA 3Q2DA 2XTKA 1QXLA 3P8JA 4BFAA 5G1MA 1IZKA 1J96A 3SCUA 3W28A 3VGFA 1KCXA 4XAPA 3AU6A 2WM0A 2YZRA 4X9SA 3F5KA 2V3FA 4UTTC 5AVNA 4GX9A 2WSRA 1DXFA 1TPWA 1IGSA 2DZXA 5AYZA 1WDQA 2VZOA 4QLKA 1GVIA 3FN9A 4BK9A 1J0KA 4KT2A 2VR2A 2ESCA 2J27A 5IFTA 3CEUA 4FX8A 1SW3A 1GZGA 3QR1A 5I23A 1NIUA 2V5BA 4UIOA 1GEHA 2PSNA 2Z4GA 4WX2A 1JCXA 1NAL1 1Z6KA 4JX6A 4ZODA 4GI8A 3W81A 4PODA 4AAJA 4IPLA 3M6YA 1LDCA 1GOKA 3QH2A 4PMRA 3AIRA 1W8GA 3WZ0E 4WJ8A 2VM8A 2YL5A 1REQA 2OQLA 2YR1A 1DWIM 2A5HA 1JCLA 3CJPA 2PEVA 5RUBA 1YX1A 1SO3A 3MO4A 3U7BA 5A6KA 2ABAA 2J77A 4O8RA 2OFJA 1A5NC 4IFKA 2ISVA 1ONRA 1A50A 2OT0A 4IPNB 4N0RA 4AZIA 3CV6A 4DXXA 4IGMA 2JIEA 1G9HA 1THFD 2V8ZA 2H8ZA 3WQCA 2DH2A 3M0JA 3L68A 4JTDA 3T05A 1E0WA 1RALA 4H2HA 4GBUA 3VZXA 4MNJA 3WD2A 2QS8A 4AD4A 1Q45A 3AHZA 1US2A 3FFSA 4P7LA 1QUMA 5A6BD 1E4IA 1VPQA 4LBUA 3LGDA 4L64A 4W9TA 3VKDA 3A4AA 2QNEA 1GVRA 3PZ9A 2OEMA 4HYVA 3V7PA 1DXEA 1FWSA 2ATSA 2BOGX 3T8QA 1OC5A 1WYIA 1KXVA 2OB3A 4IOTA 3W38A 5DMYA 3AYVA 2Z6JA 3WDIA 3KVKA 2Q3OA 1UJPA 1O12A 2EF9A 1G6CA 4D6GA 3U2CA 5LIWX 4YN5A 4ZZ9A 1GVEA 4E2DA 3MU7A 4WDTA 1UP2A 4NJKA 2WPGA 3TWAA 4DWSD 3IIPA 2C19A 5E5CA 3E2SA 2PDGA 2HRWA 2VX7A 3PB2A 1QI4A 2GVJA 2E1DA 5J5DA 5M17A 2HE5A 3N25A 1EL3A 1V6TA 3GC2A 4F0KA 3PZVA 1W6TA 4Y9NA 5CZSA 4ZMGA 2FVLA 1V6XA 1OABA 2VRJA 3O6YX 4J4KA 1ONWA 2SFPA 4B9YA 2YYUA 5PTDA 4FR6A 4Z2KA 1QHZA 1Z8AA 4BKNA 1UWUA 4JKLA 4EWND 4TR9A 1ZS2A 1QNQA 3A9BA 3T0BA 1TV4A 4KFNA 3NPXA 3COTA 4NJJA 4D6FA 3E6EA 1TWIA 2D3LA 1DVJA 2XISA 4ZE5A 1Y5WA 2B7PA 2VZSA 4U33A 3AROA 1D3HA 1QPOA 3VOFA 3NVTA 3P84A 4H9ZA 5AHEA 4F79A 2VD8A 3HGJA 4ECLA 3BSMA 4YHGA 4MY1A 3TN3A 3NVDA 3E38A 5C9UA 2UY4A 4HA1A 1X6LA 2QCGA 4X9YA 1SFJA 4A3UA 1NDWA 3PUOA 3QGAC 3DHDA 1LRTA 4KWUA 3K4DA 4UTKA 3QBUA 5TAOA 3E2RA 3KS6A 2F2KA 4Q8MA 2FB3A 4GKTA 2V2CA 4UNLA 5HAOA 1OCJA 1HKKA 2ICSA 2BVTA 4JCLA 1KFCA 4V28A 4AVOA 3IJLA 3LI1A 1M9HA 4AEEA 3VGDA 1ZJAA 4UTWA 2BY1A 2NUXA 2YBVA 2XZ9A 2NT1A 1PKMA 1TE6A 2FB2A 2VC7A 1NDVA 2IKIA 4REQB 3SDOA 2Q02A 5D38A 2G3FA 4D6HA 3IACA 3LD5A 4GQBA 1EBHA 4Q4KA 2HROA 3VPLA 1O6IA 4UQEA 4AZ5A 1HJSA 1R85A 1V02A 3GBDA 3G6LA 5LA1A 3SUTA 1BTMA 4AY8A 4JS3A 4R88A 3EX3A 4A05A 3BCDA 1R9XA 4RX0A 4ZGYA 4AYSA 4IP5A 3TFCA 2Z1XA 2PPGA 4DUVA 4G7FA 4YNGA 1BVWA 3WLQA 5E9XA 1KQZA 3TSDA 4HNOA 4DB7A 1R38A 4JTHA 2V3DA 4WR3A 1P0KA 1UBPC 4KWVA 3V1HA 2H3BA 3HBLA 2F8QA 1R87A 1EEXA 4PBEA 4H9MA 3N9SA 1X38A 3SRDA 2J6XA 4IISA 1AMYA 5F4WA 3OLGA 4S3EA 3M41A 3OHIA 1F3EA 4DZIA 4UOQA 1G01A 4KFOA 2BY2A 1K03A 5HK4A 4HBKA 3VIFA 5C54A 1DV7A 2VOMA 2WVVA 3QZEA 3POHA 1QW8A 2FHFA 2NQZA 2WMFA 1ZCCA 4GO9A 3MW7A 2RH9A 4AZHA 1CZ1A 3QMRA 3W76A 6PTDA 3VOHA 1MZRA 4IUOA 4PTDA 3RO6A 2JE8A 2PDKA 4IZGA 4JY9A 1JZ8A 4LC8A 4HCDA 3W23A 4PE8A 3HV9A 4DJED 1KCKA 4GFIA 3NWRA 3TKFA 1FHVA 4HOZA 2G50A 2D2GA 5LIKX 1AUSL 2CXEA 4U5KA 4U31A 2Z27A 5DY2A 1X97A 3MMDA 1TVPA 2WWCA 1CYGA 3LG3A 3KLLA 5A8NA 1QT1A 1IZJA 5EMYA 4LNCA 3RUBL 2GWGA 2VGGA 1EIXA 2DW7A 2WZTA 2RFGA 1YNQA 3QV6A 4GYPA 1PYFA 3OZOA 1C7TA 1ZRQA 1OX6A 3ABSA 3HTWA 4PUWA 4EACA 3CB3A 1JNEA 3F7JA 2PA6A 3KFTA 1V7YA 1KGWA 1NWUA 1MRAA 3MPGA 1GKPA 3ZVHB 4ZTYA 1V77A 5FSEC 4JYDA 4X0NA 2MUCA 4XIAA 4M0XA 4PEEA 3MKVA 5JUVA 1B4KA 1N8IA 1EOKA 4R9OA 3NIYA 4JNZA 2C13A 2Z2UA 2TRSA 1PIFA 3W85A 2PDUA 5HXMA 2X2GA 5I78A 2WMHA 2EJAA 4GH1A 3QYSA 1Z7AA 3URBA 1L8PA 1PCKA 2NQJA 3R58A 3WMBA 4CGTA 3M9YA 1RJRA 4YYCA 4RE4A 4GZ7A 5HPCA 2I1OA 2QPSA 1K3UA 2PBOA 1UP0A 4ZB2A 3RRXA 3VE7A 4Q8TA 4GIYA 3R5EA 2YYTA 1F5ZA 4RZ6A 3U2ZA 4O0ZA 7ODCA 4MJZA 3UFYA 2XIJA 4ML4A 2G3IA 2BHUA 3UZJA 1AH3A 2RUSA 4MB3A 1GYMA 3A21A 4G6CA 4CD4A 4MY8A 1W5NA 1W54A 3UESA 1YDYA 5JQ9A 1ITUA 3AHVA 3IAPA 3TQPA 1JF6A 3ZJ7A 2VZVA 4NHVA 1BXNA 2VKZG 1RD5A 1VEMA 4GYFA 4IMAA 3T78A 4LC6A 4B3ZA 1YYAA 2P88A 1Q3NA 2FVKA 2H6RA 1MUCA 4DBEA 1KRBC 3GR4A 5HMFA 3TWBA 2TYSA 3WD1A 5CG7A 5C7VA 1K70A 4HPGA 1KKRA 3CO4A 3H22A 5I03A 1I6NA 3VOCA 3IJ8A 1W2PA 1JUKA 2WVUA 1OFBA 3NYDA 2EGZA 2ISFA 3W2LA 1RQHA 1DHKA 4Z2JA 1SQ7A 1A5BA 1ZJIA 5A3HA 3UU0A 4QROA 5H1WA 1QW7A 3R2GA 1Q8JA 1VFTA 1FDZA 1XQLA 2D20A 1FWNA 2FZ8A 5HQLA 2ZA1A 2F7FA 3CO8A 2GJPA 2QUTA 2OWXA 3K13A 3KAOA 4B2DD 1LF1A 3L2LA 1AODA 1XI3A 1HX0A 2QXWA 4MYAA 4FXFA 3OLIA 5H6HA 5CPSA 4G7EB 3FJNA 4CNTA 2Y1HA 3AMDA 1AK5A 2DJLA 5CLWA 1KFKA 5G2WA 1DQXA 4H8VA 2ZXAA 3RLGA 3B8SA 4IPIA 5D4YA 1PJ9A 3NQ6A 2ZTJA 3PG9A 3GUGA 2D24A 1R9ZA 4QJ3B 2P0IA 1WZAA 1BXCA 1DWFM 1OYAA 6XIAA 3WL0A 2GVGA 2FTWA 1HKIA 3BICA 1UYQA 2WYSA 1V3JA 4P8VA 5BU6A 1VC4A 3N17A 3DERA 1W0MA 4YTTA 3HJEA 2ZX7A 3AO0A 4REQA 1W1TA 1TREA 1XIBA 4O28A 4ALDA 1HKWA 2QGYA 3G5EA 2BTMA 1V3MA 3T2QA 1LORA 4GI9A 1H63A 2W9MA 4OVXA 2GOKA 4AEFA 2P3ZA 3WJXA 3QTPA 3T0TA 2QAFA 4BQ5A 3LNMA 2QCDB 3AHTA 4JHOA 5AHIA 3GB6A 1SZFA 4O1AA 2WANA 1XIHA 4QDWA 2F9RA 1O7AA 2WMIB 1CECA 4BF5A 1LWJA 2OGYA 3WLPA 4QM1A 3EA1A 2ZWZA 1C92A 4FMVA 2YLAA 4FOJA 1TPC1 4X61A 4GUHA 1E40A 2UV8G 3OZPA 3ZO9A 1KGXA 2PC4A 1KM2A 4ENLA 3B8IA 1EJTC 3LCHA 2XIMA 1ZUAX 5BMWA 3WLNA 2Y6ZA 1OZMA 1QNSA 1BQGA 1DOSA 4ZQCA 1X6UA 3W7GA 4FSAA 2ZC8A 1EJUC 2OVLA 5D03A 3ZR5A 4MOZA 4EWJA 1LRNA 5FI8A 2VYOA 4JX4A 1Q13A 1Y0EA 4J3UA 3SIZA 5AHFA 4WJEA 3U2EA 2A3EA 3QKZA 5DMMA 3HPXA 3QY6A 4Y8EA 2ON3A 5HNRA 1GQNA 4WDWA 3ZOAA 1D9EA 3FSTA 2PTWA 3G6MA 2E1WA 3GXPA 1H60A 1GK8A 4LH8A 1A0DA 1C8QA 1FHLA 3MUZ1 3LMYA 5AC7A 4J1OA 4NZCA 1ZBCA 5A94A 3UWYA 2R1NA 3WCZA 1UD2A 4IIHA 3TQVA 2VWTA 3SIMA 3HFTA 3ISIX 2XGBA 3O3RA 1CWYA 3WEOA 3B0VC 4PCSA 4XIMA 3V35A 3TR2A 2ZZ4A 3IUDA 4ES4A 1X96A 2XH2A 2Y88A 5CBBA 1KGUA 1JXJA 4C6CA 1AFSA 4H7ZA 1RK5A 3H12A 3VILA 1W3TA 5AHLA 3WFAA 4JCMA 3N6QA 4Y9AA 3ZVHA 1QFEA 2DUZA 4CU6A 3GNOA 4UQDA 4W7WA 2BGNE 3W7KA 1F6KA 3NTYA 1TPFA 1VPYA 1RHCA 3GY1A 3CMGA 3P82A 1EHAA 1OHLA 3THCA 1AZ1A 1UOKA 5L9FA 3LBOA 1R0MA 4CNNA 1N2VA 3LXAA 3M0XA 4F9DA 2I5IA 1U1JA 1RBLA 4MDPA 4UFJA 1PWLA 3SCWA 3OZYA 5EYWA 4CN6A 1MQQA 5D9NA 4LUSB 1CB7B 3THUA 2JBMA 3B8DA 4FOUA 2FZ9A 1EPVA 5I09A 1G4TA 3KEHA 4E4FA 2NX9A 4ICNA 1RP9A 2V82A 1H0GA 2BY3A 3LN3A 4K1WA 4LAKA 5DANA 2GGEA 5A2AA 2E25A 3M0IA 1H11A 3I7SA 3L21A 3LHYA 5AN7A 4CD5A 3ZJ6A 2Y2WA 1CPUA 5F2MA 2DVTA 4HK5A 2HTMA 4DAFA 4XZBA 2DZAA 3HG3A 4V27A 3WQPA 1T7LA 1PTDA 2WCSA 1BQCA 3WD0A 1J79A 4C6KA 3GXIA 3W1LA 2QJHA 1PIIA 4E38A 3WK3A 1PL9A 2PZNA 2DJXA 4W5ZA 3FKKA 4ZQMA 3A4XA 4ZQNA 4H9YA 1F05A 4X2RA 3GO2A 1PDYA 1CTNA 4WY0F 4H4IA 4MUPA 2W61A 2E5BA 3GFYA 5LNWA 2PGRA 1TTJA 3EB2A 4FLOA 3HMCA 4YVXA 3WQ4A 3NZ1A 3TV8A 3WNPA 5DCBA 1BVZA 1NQKA 1VFLA 4X3ZA 1ZLPA 4JKMA 1CXEA 1MQPA 2VEKA 1EFZA 1XFBA 4KRTA 2A7PA 3URAA 1KV8A 4L4MA 2PLKA 3K2GA 4XBKA 4D8LA 2ZZ3A 3VFCA 4G7EA 1UP3A 2W6RA 5LNUA 3EX6A 2YCEA 1WUFA 4XX6A 3PF3A 3UZXA 2NUYA 1POKA 3S1WA 1H7NA 4O11A 2OLHA 3KBSA 4GBDA 2A3HA 4QAIA 3KCOA 5C6MA 1XBVA 2V0TA 5CPOA 4ZQOA 3VGGA 1F8IA 4IIEA 2GQ9A 3DFOA 3R1ZA 3EBVA 1XPYA 3EMQA 4PCTA 1H5YA 2CC0A 5CBIA 4JGDA 5JBEA 1M41A 2J25A 1E9ZB 3LUTA 3LCFA 4CD6A 4C7GA 2BBFA 1FHUA 2YCLB 3PN8A 3H7UA 1EP1A 1R7AA 3WLRA 7TAAA 1Z42A 2QIIA 2XM2A 2GJLA 3QM3A 2ZRYA 1K7FA 1EJ7L 4NJHA 3R94A 3RN6A 4DZ5A 1OIFA 1TJ0A 5G2HA 4YWIA 1LQ2A 2QCDA 1P0DA 2HBVA 1UKOA 2BOFX 3H54A 5H8MA 3WBXA 4B90A 3ARRA 3EB3A 4A2RA 3KS5A 2F6XA 4BR1A 1XIEA 3IK4A 2WMIA 4A8LA 4LF1A 1MEHA 3O16A 1CGTA 4O0KA 2HVNA 1FCUA 4RZBA 1ZTVA 4E2OA 5CBJA 5FJRA 3MC5A 3TAOA 4E2BA 4M8UA 3AYRA 1OG0A 2GQ8A 3M44A 5LNSA 3LRLA 1V6YA 4CD8A 4NVTA 2D2JA 3GTFA 4K7YA 4AC1X 2WKJA 2ANUA 2EKCA 5AC4A 3LLFA 1GVFA 1J12A 3HJZA 1DWAM 2OR2A 4IIGA 4XBSA 3UCDA 5A6SA 2P10A 2AAMA 2BDQA 5CG0A 4ASTA 1YEYA 3CUZA 1O60A 1BF2A 2OPJA 2EG7A 4KCUA 4ZENA 3BAYA 1QAPA 4O17A 4HSHA 3DGBA 4M29A 3L0GA 5E9AA 1YLVA 1W17A 2GDVA 2QVNA 3UF9A 4KKXA 4UCFA 3H6OA 4JEJA 4NZJA 1GG1A 1Q6GA 1SR9A 1PZ2A 4PMXA 3MSYA 4C5ZA 3WMLA 1O5RA 3APGA 1QPKA 3PBVA 5D05A 3WF4A 1WAWA 2YB4A 4PFHA 2G4JA 3THAA 1YDNA 3R79A 4N9CA 5HWJA 4CNOA 2GJRA 2H90A 3WEZA 2OKTA 3NL2A 2Z1KA 1TIWA 4O57A 1UZDA 2V63A 1KBBA 4AZCB 1RZMA 2PP1A 3SQMA 1X8CA 4EOUA 1IYXA 4S39A 2A2IA 1AQFA 2PUZA 3B0PA 3SCVA 2IKHA 3O63A 3W1MA 3SB0A 3D46A 3UYCA 3W6LA 1Y65A 4L9YA 3BAJA 1QDSA 3S0CA 1UMYA 3ATZA 3RX3A 4A29A 2VQUA 2INEA 1A0CA 3KW3A 3NOEA 1V08A 5KMYA 3CL6A 1NELA 3IIZA 4QEHA 3AS1A 1VFOA 4IJBA 2OWWA 4DBWA 2PRHA 4XVEA 4LVAA 1E9IA 1QNPA 1I2RA 4N42A 1XDJA 1EP3A 3BV4A 4A3YA 1JD9A 1TPUA 3LERA 4EXBA 3QKEA 3LCIA 3PUGA 1YXYA 1ZZMA 4G1NA 3WUGA 2OSWA 4XD4A 1P0NA 1US0A 2XIQA 4PMUA 2BODX 3LENA 5DRCA 2I5QA 2NWRA 2WJEA 4C6EA 4MZ8A 3EOUA 4ERGA 1UZHA 2O4MA 4NRRA 1F6YA 1V0NA 4L6HA 4EKJA 2D2OA 1ODZA 3AHXA 5BOFA 1V93A 4G9PA 5KEZA 1P6WA 1Q63A 4D6DA 4Q8UA 2J74A 4FIRA 1VLWA 1SZGA 3PJTA 9XIMA 2XZ7A 2B7NA 2QCMA 2VRQA 2C6QA 2RDUA 5M5DA 4ZXOA 1S5VA 3LTYA 4J2PA 4LYRA 3CL7A 1T41A 3PJWA 2FYMA 3ES8A 3IV3A 1QI2A 5FJTA 1RAKA 4ZO9A 2VCCA 3W0KA 3NO3A 4JN8A 3VABA 3CQHA 2BP1A 4INFA 3W1NA 3FEMA 3OP2A 1GPWA 4IQJA 2ONEA 1E15A 1B9BA 3MI6A 1JFHA 2CITA 3INPA 3SI9A 3ZQ9A 4QITA 1H5VA 2V9DA 3CAQA 1I2NA 3VMPA 4YS1A 1ZBVA 3NO5A 1PTGA 3DU0A 5FEWA 3BCJA 2VTFA 7PTDA 3P7YA 3UCCA 4S3BA 3P0WA 3CQJA 4PUUA 4ZA0A 2OOGA 2OG9A 1HJXA 3ELFA 4IHCA 3U5UA 2BLEA 1UKQA 5SWUA 2WW5A 1X1ZA 3A3XA 2YW3A 4TTGA 2VDHA 2POTA 4L7ZA 3NGJA 4HSOA 1MI3A 1OFQA 4M1BA 1OFRA 1W5MA 2VR5A 3AS0A 1Q6DA 1IZCA 6CGTA 2FIQA 4OU1A 1A5LC 3SN4A 3H2CA 4Q4RA 4RW3A 3VOIA 3R8GA 3VM5A 3VDCA 5FEZA 3BJSA 4DJFD 3PBMA 4CCDA 2XM1A 3WEMA 1J4EA 1OM0A 4N9DA 4Z2IA 3OYZA 3G1FA 4IH3A 5I06A 3ARVA 3G8EA 2OLAA 2VCAA 3O07A 4L1GA 2Y5EA 2XH7A 5D9PA 4ACZB 1DJXA 4J9JA 1ECEA 4QS5A 4RK8A 1W3KA 3SY5A 1W3NA 1VQTA 3A3WA 2ZZ5A 4W88A 4LQ1A 3CIXA 1YADA 2YCLA 3ZMRA 1UIPA 2E28A 1O95A 1XBXA 4FR1A 1Z41A 3EGJA 4WD0A 1LBLA 1XC4A 4MWAE 1CGWA 4HD5A 1VH7A 2PFHA 3NFUA 5ECUA 4D2JA 1J0ZA 1AW2A 2Y89A 2WQDA 2Y62A 3DFTA 1GOIA 4GZIA 1R3RA 1DKWA 3M0LA 5D8ZA 4AC7C 1V3LA 3G2GA 4W85A 4DJDD 4R7WA 4DN1A 1KBJA 3WLIA 2BOEX 4ZO8A 2Z1BA 1OQFA 3CHVA 4TV6A 1NF0A 3N1AA 3DFHA 2ADAA 1XKJA 2FFIA 2WK2A 3ME3A 3VMNA 1HKJA 4OWGA 3AJXA 1FXQA 3PR2A 3M0HA 3NSNA 4GWEA 1I60A 4MNKA 4LVFA 3PB0A 3UETA 4MTVA 4L4LA 1S2AA 1SJDA 5HMSA 1KWKA 3KDNA 2DZUA 2DZSA 3BLOA 1X1OA 3CTTA 3IARA 3O0FA 1ELSA 3GXMA 5BMXA 4FZIA 1XINA 4R27A 2OELA 3SCQA 2V2HA 4AMAA 2W66A 3OPSA 1C8XA 2E9BA 2XIOA 4C1NB 3ZT6A 3GYEA 3CZEA 2E77A 3FAXA 4O4WA 4H9XA 3TJ4A 3SRHA 4GGHA 1QVBA 4H7CA 5E0KA 1QPNA 2BHZA 4JZ5A 4ZO6A 1QBBA 4E0CA 3EKGA 4TVDA 2Y7GA 2V5KA 4PMVA 4JKKA 1EBGA 7CGTA 3W7PA 3KHJA 4ML9A 4FK9A 3EB4A 4DLMA 1O4UA 1MZHA 1P1MA 1V79A 1BSLA 1TMLA 2P5NA 5T91A 3VNDA 1UMLA 2WMGA 3QC0A 1A53A 3E9AA 4LVGA 4LAZA 3PWIA 1PX4A 4JHMA 5LKYA 2BX7A 1MXGA 3M4HA 4CCZA 4AZCA 1FCVA 4GNVA 4QDMA 1CNVA 1EPXA 3WQ6A 3ZVIA 2Y5SA 1QK2A 5LHFA 2J24A 4U10A 2OGJA 2DW6A 2PDFA 3FA5A 3VZZA 4OT7A 2GDQA 4MWAD 1KQYA 1CGUA 3OOQA 2WO5A 5KZMA 4BWLA 1WB0A 5FD0A 3WK0A 1TPB1 4H6KA 4F8XA 2X0HA 2DP3A 3K8LA 4Q7NA 3L4VA 3ATYA 5D30A 3LS9A 4OOUA 2IKJA 4XV0A 1GVYA 2HV5A 3FGCA 3LBMA 2PDNA 3N2BA 1XLAA 3M5XA 4A3HA 4NAFB 1W9XA 3W01A 5LXXA 2REQB 3Q45A 1DE5A 1Q85A 1GGOA 1VFHA 1ZAJA 2WPBA 3VNZA 1I2PA 2D2HA 3I3DA 1BSIA 3G77A 4NL1A 4E3TA 1W3HA 2FJKA 4ERAA 3TAKA 2BGSA 3BGAA 5EMMA 4IGNA 3LV6A 4M56A 3LHZA 2A7NA 1B90A 1DEDA 4HJWA 1SFLA 4LGXA 2AQVA 4B5UA 4FB7A 3AZRA 3MBFA 3M0YA 3PTDA 2PC8A 4GCAA 1P7TB 2KAUC 3HO8A 4JL1A 4AF0B 2AQOA 2OQYA 4LU0A 1C9DA 2O9PA 2Y4SA 3WQEA 4GGBA 5CSRA 4FEZA 1W91A 4LEQA 1Q6QA 1FDJA 1GOOA 4JPGA 1TQXA 4LPCA 4BI7A 2NQ5A 1E4MM 5IHRA 3W02A 2HPMA 4QJ5B 2VEMA 1GZ1A 3DYOA 4TTUA 1CBGA 5CLTA 3F1QA 3UG8A 4JQ4A 3S4TA 2DORA 4XZ9A 1F3WA 3ZJ8A 3QPEA 1D8WA 2J7EA 2R1LA 4MG4A 2AGKA 2DUXA 3NEVA 4D8ZA 2PLMA 3NDOA 4E5TA 3SEPA 4M51A 3AU2A 1OFOA 3JW7A 3THDA 2E5CA 1X7FA 1LOQA 3TW6A 3E96A 1R3WA 1XLGA 3SECA 3TTQA 4GQGA 2VRKA 1O68A 3L67A 2WZEA 1UQYA 2GVLA 1TJRA 4XQ6A 4DX3A 4URIA 4O1FA 3NAVA 2C79A 1TUXA 4ACZA 4H9VA 2J88A 2OSYA 3NSMA 1ZJHA 1SZNA 3RG6A 1FWHC 1F3XA 4R9XA 1XLFA 1DIKA 4CN1A 2PAJA 3N9RA 4LVDA 3BARA 6TAAA 2VUYA 3RFAA 4RR4A 1PYMA 5A69A 1CX9A 1KWGA 1H09A 1BGAA 2VHLA 4ZFCA 1QI5A 4AX6A 1W5OA 2V30A 3ANUA 5AYBA 4DXKA 3C2FA 1SMDA 5C2XA 4EE9A 3PY2A 4I8YA 3S5ZA 1LT7A 3FW6A 1XBZA 2QAPA 3HURA 3WK2A 4GJJA 2FDSA 3RJXA 1JEZA 1CCWB 2R24A 3MJMA 3N6HA 4QIUA 1HIZA 4DO7A 4XK2A 5M3WA 1VCGA 2LLEA 3QEZA 4GUIA 6ALDA 4WJXA 1GYLA 4YTUA 1EQCA 4DJDA 4PBGA 3OG2A 4UFIA 3LOTA 4C6OA 2CBVA 1B3WA 2D3NA 3KOFA 4DO5A 2NV1A 1F76A 4RV3A 3SADA 3E0IA 5GNZA 3UVIA 5HNTA 1NM9A 3H4GA 4PYSA 3NXLA 4DF0A 3IJ6A 2VCBA 5EGRA 2X7WA 3KTCA 4HCLA 3CWHA 2WXDM 3L5LA 3GNPA 1IIHA 4C1NA 2IPGA 3WO8A 2ODOA 4CUCA 7TIMA 2AL2B 4B92A 3GXFA 1CB2A 3C0QA 4ZCWA 3PAOA 1CGXA 4NZFA 1S1PA 3B0UX 1EXPA 2IUZA 4IIDA 3PZUA 3UXDA 2WJZA 2EPNA 4UR9A 3FCPA 1YBQB 1ZAIA 4RDYA 1I0DA 3GH5A 1K8ZA 4L61A 1DL3A 5JU6A 5M2FX 4JTFA 1HTIA 1Q6CA 4E4PA 1QHOA 5CAKA 2BGQA 3WQ5A 3S5OA 2AAAA 5CZJA 3GH4A 4MZYA 3GX9A 6XIMA 1PUDA 4M6UA 5DMLA 1YNYA 4NJGA 4PB4A 3MP5A 3L9CA 3KXQA 3BZGA 4FNPA 3UA3A 4RDWA 5JH1A 2I16A 3DIPA 1S38A 1GORA 1F73A 2GJXB 4LS0A 1PO9A 4TUFA 2PDJA 1XLJA 1G94A 3Q58A 2XVNA 2VVSA 3QW4B 1UD4A 3P5YA 2J78A 3SGUA 4MDOA 1B3VA 3FHQA 1YPXA 4UTTA 5LIUX 2QDDA 1EH9A 3VMOA 5BRPA 3H2OA 4NAFA 2J79A 2REQA 4R33A 1FCBA 4JN6A 1JZ2A 2YL9A 2NX3A 5ENLA 4RL3A 2E40A 5F4XA 4BEQA 4MKVA 4L56A 3R8RA 3RLUA 4NNAA 1TR1A 2V81A 1E6NA 3ZR6A 3QN3A 1IF2A 4GVIA 1NDYA 4LUIA 4ZE4A 1UHVA 4MAZA 2PWUA 2I57A 1KCLA 1WX0A 2JKEA 2OO6A 1IEWA 3KL5A 4NF7A 3AXXA 1TYGA 3KL0A 4ROQA 1OC7A 2Y7FA 1JPMA 1XYZA 1P7TA 1SGJA 4JNYA 4FF5A 3IJQA 4I9AA 2WC4A 4AF0A 1JZ6A 2KZHA 4Z1AA 3GHSA 2GK1B 2J7FA 3E49A 4GOAA 1M04A 1VS1A 3DKJA 2EPHA 3W87A 1XYBA 2R1MA 4X0VA 3VC5A 1KM5A 3WENA 1T8XA 3CLWA 4LEFA 1PE1A 3M7WA 1M6JA 3WUBA 2D22A 3UPBA 4XG1A 2ZRUA 2PP0A 4S3AA 3BDKA 1ZALA 3GHRA 2A85A 2JIWA 3IIXA 3QFEA 1EHNA 4BA0A 3B8UA 3LDVA 1EB3A 3WDRA 2HZGA 4MNMA 2G5WA 4PTNA 4QG8A 2EPOA 4TO8A 3LA4A 4MSSA 3LX9A 5DX7A 4GIEA 5I77A 3L4XA 2GSJA 3U4AA 3H7RA 1DJIA 3N11A 3VZYA 4POCA 3M46A 2EJ1A 1BRLB 3G1YA 2X41A 3T09A 3CAKA 3R7MA 1EA9C 2WC3A 2WLZA 5HOSA 3W37A 4JIPA 3KOYA 1C29A 3W2JA 3W2KA 5CPMA 2Z2BA 1YTEA 4KW2A 3OW1A 5AYIA 2YLLA 4QJ1A 3V0UA 3C2VA 3JVAA 2C7FA 3TUUA 3GTNA 1TCMA 5T8GA 3H2NA 2NWSA 3MANA 3PTMA 1GZJA 3V0SA 1FTXA 1RJQA 2QVHA 1G0CA 3UCQA 3HPFA 2EPKX 1HJQA 3MCNA 4HHPA 3CUJA 2J62A 3BSGA 4GUJA 3IJIA 1J93A 4XB3A 4K37A 1UKTA 4OV9A 4PUDA 5I3FA 3U7VA 4F3HA 1IIGA 4UZUA 3F2CA 1EGMA 5AFDA 4CQDA 1AQMA 3VK5A 3OZMA 2AMGA 1OEPA 3WN6A 2YA0A 1E0XA 4AD0A 3IGHX 4XSLA 2WZHA 1DTUA 4AIEA 4J3ZA 4GYJA 1Q6OA 5BRQA 3RLHA 2CWXA 3N04A 1W1PA 1VCFA 3LHUA 1JPDX 3ABXA 3VAVA 3R8HA 4AW7A 1KXQA 2P0OA 1OGSA 4DHGA 1PZ0A 3CS2A 2ACUA 3W71A 1QO2A 6ENLA 5KITA 1JZ3A 1KFWA 3BAWA 4LV4A 1A49A 5HR6A 1SW7A 3W72A 4IXHA 5HULA 1J2WA 2WVSA 1VBJA 5D9OA 1YQ2A 1G4PA 2NVDA 3VIMA 5A1AA 2JGYA 2ZQ0A 1J18A 1JPHA 3NSXA 4O12A 3SY1A 9XIAA 1J11A 4Q4QA 5BXTA 2DPEA 3MBDA 3IUHA 1IHIA 1OFAA 4MNLA 5EBAA 4DXVA 2AL2A 3TE9A 1E6ZA 3F4WA 3MP3A 4RKAA 3SRFA 4S3FA 5CXPA 5LZLA 5CZ0A 4LAUA 3MV01 3TFXA 3IWPA 4UTUA 2QDGA 2L5HA 3SZ8A 2XJ7A 1F3TA 3VC6A 3LHWA 3UY7A 1V3IA 2HJPA 3E02A 5EA9A 2QEZA 4Z1CA 1KRAC 1JCTA 3PJUA 1XLMA 3H2EA 3RXZA 4CQ9A 1OF6A 2OEJA 3OLEA 1TFVA 4E8DA 4W93A 3KP0A 1XDMA 3I6RA 4PULA 3VNJA 5G4WA 3RNDA 3PNZA 2Y5JA 3NL3A 3OBAA 4UQCA 3DH7A 4C7DA 1E3XA 3IJ7A 2FZNA 3APTA 4EF9A 1IR2A 2OLSA 3ALGA 3JRKA 5FKYA 4XZHA 3SW6A 3AJ7A 1S5NA 3H7VA 1W56A 1K9EA 3QRHA 1L6WA 2GJXA 5CC6A 1H41A 2CU0A 1UPPA 5DF0A 4R7JA 3RAOA 3WL1A 4BWLC 3MYPA 1R2RA 4WXYA 5AZ0A 5CQ1A 4D6JA 5C9WA 3K30A 3WLLA 1U5JA 4ZXLA 5HJYA 1S2VA 4Z1YA 3NR0A 2X0YA 3SJ3A 3S47A 1KFLA 1XJBA 4EPEC 2GJNA 1JCNA 2CBIA 1H7RA 4M1RA 3WKZA 2ACRA 4UFKA 3ECQA 1XBYA 5D32A 3EDJA 3H53A 2EEXA 4FXSA 1G4SA 5KZ6A 3BW2A 4AY1A 3T6CA 3CPGA 3ZS4A 1R9YA 1VBRA 4WSHA 5TF0A 1ODUA 3NM3A 3CL8A 3CWOX 5HANA 1K02A 4PUNA 3STCA 4JDBA 4XD6A 2VI0A 3LPOA 4DWSC 3PBUA 4MKNA 3RPMA 2INFA 3KX6A 4TMCA 2DDXA 1UWSA 2VC9A 1TE1A 4Q3MA 3PPHA 4B3LA 3TMQA 1DHPA 5G4HC 1TV5A 1K4HA 2Z1SA 1VP5A 3TC3A 3CIWA 3SN0A 3BWWA 1EX1A 1UWTA 2GK1A 4J28A 1WXYA 1XC6A 4QG6A 2XVKA 4WF7A 4IFKB 5E09A 2VX5A 1B3OA 1TA3B 1G1YA 3E5BA 4PMQA 2XN1A 4I6KA 4LYQA 2WSKA 3OLDA 1Q6LA 2IS7A 3DG6A 3VUSA 3QW3A 4ZFMA 4DBUA 1EJSC 1JPKA 5MKGB 2DUAA 3G1RA 4GXMA 4L9ZA 4Z1BA 1GVSA 1XRFA 1M7PA 1K9DA 2JGQA 5HBFA 1NY1A 1HL9A 4PFMA 2CCRA 3G0SA 3HIJA 4ICCX 2GSEA 1BLIA 4XAYA 5LYRA 4TX6A 3CUFA 2G4FA 1OB0A 3GU1A 3MCOA 2FTPA 1MXSA 5L6UA 1X39A 4K8GA 4KCTA 4GY7A 3NQMA 3P8IA 4P5UA 2VR4A 4LRTA 1KM6A 1BRLA 1UWRA 5DCDA 2O9OA 1FFRA 1S39A 3DESA 2RKXA 2W27A 3HB9A 3WJSA 5D2VA 3GFZA 3S9YA 4HN4A 4FP1A 3UNDA 1IEVA 4HU3A 3FOKA 4D8AA 1PZ3A 2Z28A 1TO3A 4M82A 5JMUA 5BOOA 1XCFA 3PULA 3GDBA 3HN3A 1HXJA 3TSMA 4OUIA 2GVYA 1B5TA 2PTZA 3W7CA 2CNCA 1DJGA 4US5A 3MVIA 3WY1A 4DF2A 1NQ6A 2OWCA 3GU2A 1ISYA 4MZ1A 2WVTA 3H4WA 1XYCA 2ZFAA 2OYLA 2A3AA 4K6AA 4XZIA 4Q4PA 3ABQA 1LOSA 1LWHA 3E2VA 4CNPA 4NY2A 5HINA 1ZL1A 2FH8A 3WJYA 1UUOA 2FGZA 4WKHA 4AWEA 3AUJA 3C4UA 3WLTA 4JDYA 4PB5A 1BPLB 1B9ZA 1HKVA 5IDZA 3EMZA 3K4AA 1KXHA 1MNSA 2WLYA 1BXBA 3VM7A 1JCYA 2YA1A 3BURA 1TMHA 1W1ZA 3S3GA 3W1AA 2ZWYA 5CEWA 5DMNA 3WX7A 1Q7ZA 2YCIX 4WVXA 1P5BA 4GUFA 3W6YA 3AYSA 4UOJA 5F4SA 3VDHA 4TVCA 4EAMA 2NQLA 4US6A 2CHOA 3KLKA 4CEXC 3HG4A 1ITXA 2QJMA 1Z69A 3N2MA 2FDMA 4MFDA 2IKGA 3CPUA 3TJXA 2DZBA 4I6VA 4IL2A 2F6KA 4IQEA 2PWGA 1Q4NX 2V3EA 3E2QA 1FFQA 4OE7A 2C1HA 2CHNA 3NQCA 1YXCA 3W00A 1EJWC 5FJJA 2NZLA 3O06A 4DJEC 3BUVA 3TA6A 2BB0A 1GW1A 2PGWA 4I3GA 4I7WA 1KA9F 1N8FA 2VX4A 3P93A 4E3VA 2OU4A 3RYSA 4I90A 4LYKA 4DELA 3CUHA 4TV5A 3BMVA 3T1GA 1GCYA 1FWAC 5HNNA 4HNNA 3BLPX 4KFPA 4AMCA 4W4QA 3ZYZA 4AH7A 1TRIA 1OC6A 3GVWA 1P43A 1TX0A 3WLHA 4DYKA 5DO8A 1TMQA 2AMXA 3DECA 4HKPA 4A3QA 3II1A 3SSJA 4GC4A 3W4RA 4BQ2A 2BVDA 1JI2A 4DRSA 1D3CA 4RCXA 2HK0A 4HA4A 3NQ2A 3KVMA 3CPRA 3FK4A 3UWQA 3S2NA 5G1YA 2ISSA 5CSYA 2X05A 4YIWA 3LZ3A 1ZJBA 4JIEA 4WGHA 4C1KA 4FNRA 1A4MA 1IWPA 2XSBA 3TN4A 4IM4A 3C5QA 1O94A 3NQ7A 3KOXA 1S5TA 2FJUB 5IRPA 1XM3A 4U5IA 4OGZA 3OA3A 2J8TA 4X60A 4Q7IA 4PR4A 3EPNA 3GYCA 2EQDA 3PZMA 4WSKA 2J66A 1DE6A 2ABBA 3U8GA 3R0KA 2WNNA 5DT5A 4JOMA 1W3LA 3E5PA 3P5ZA 3WH8A 2HNEA 1UR4A 2HS6A 1TWDA 4WUIA 2PDXA 5CZKA 1KTNA 1LQAA 1TV8A 3JZEA 2WJFA 1JVNA 1A3XA 2OX1A 1XSIA 3A9IA 3NEHA 3CLMA 3O1NA 4G56A 2OKOA 4HCHA 1PS9A 1FHDA 4AFYA 4HTYA 1A5CA 5G1TA 1RCXB 1L6YA 2WHKA 1J0HA 1Q7MA 4B91A 7XIMA 2PLCA 3B4UA 1JYWA 1KTCA 4EPDC 2PURA 2ZRVA 4A35A 4DVOA 3BAKA 1MEIA 3GNDA 3UYIA 3AOFA 1XKYA 4Z1DA 1WXJA 4NT0A 2P3EA 4NZ3A 4DO6A 3NG3A 4MAVA 4QX4A 4GZJA 4S23A 4J35A 3N34A 3LU2A 2OSXA 1TA3A 3SUVA 1H50A 4S3KA 5HA7A 1F9CA 4EANA 4C5YA 5C8BB 2DY3A 3EXSA 2J7GA 2ZZ7A 3HF3A 2D0GA 5KETA 4QHRA 5MKGA 3C2EA 2C0AA 3DUGA 3C2YA 4OUEA 3TYBA 3RM9A 4DYEA 1GTHA 3BSHA 4K3ZA 1MW3A 3CZGA 3MZ2A 1YTDA 4I9MA 4ZSUA 4W86A 4MKSA 3QHMA 4RW5A 1AMKA 3EOOA 1W3JA 4DI8A 4IPPA 3MB9A 2BXZA 1ZCOA 3O6DA 5GJMA 4GHRA 4RNFA 1A5UA 3RCMA 2C16A 3I7RA 3MT1A 3WQOA 4FNTA 4R53A 3LPFA 1E55A 2VX6A 5F7UA 3B06A 1V0KA 1XLBA 1XRSA 4KGJA 3M64A 4IQLA 4R3UA 4M80A 2E7FA 5CCZA 2JALA 1JDAA 3ITYA 2TSYA 2YCKX 4MGGA 1KR1A 3U4FA 2VWSA 4U3CA 3HPZA 4I5XA 5H2ZA 2QUNA 1XWYA 3DHUA 3CEPA 2PDWA 4QE5A 3C8FA 2ZZ2A 3VNMA 4WDUA 3AMGA 4WK9A 1M7JA 2XN2A 4JTIA 1UR9A 1RH9A 4LNYA 2WMJA 3A3HA 4L1WA 3N13A 3BG5A 4WHBA 1G7VA 3VO0A 1R30A 4CNUA 2HWGA 2H8XA 3DFSA 4M6PA 3SUWA 3LV5A 1VRDA 2XSXA 5H91A 4O1CA 3O7UA 1K1DA 4GY1A 1JRBA 1WKYA 1DQWA 3UW6A 3PSWA 3I3BA 1AH0A 2RHGA 3RMEA 1E6SM 4I7UA 4JFVA 3EOSA 2DGAA 1FWBC 4KMQA 4H2CA 2XWDA 2I14A 2QCEA 1B30A 2WAGA 4RNIA 4NX0A 2GQ3A 1FKWA 1FVPA 2ZUWA 1UCWA 2GGIA 3N12A 1KFJA 4O4VA 3SRKA 2HE8A 3V1PA 5GJNA 4J2MA 1Q65A 4A6GA 2DSKA 3TXZA 4GLEA 2O9RA 2UY5A 3AC0A 5LGZA 1UR8A 4AXNA 2X7VA 3CH9A 4WLCA 1IEXA 1RLDA 3O05A 5D2YA 2OZ3A 3W7JA 1RA0A 4OTKA 2D1ZA 3FA3A 3FJ4A 2O4QA 3S2CA 5C55A 2NX1A 2HMCA 3DC8A 4RPQA 3F2DA 3W88A 2NVAA 3MHGA 3SGGA 1V4YA 3GLCA 2TMDA 2YXXA 3TR9A 3TROA 3WDHA 2ZRXA 1TSIA 1W31A 1B57A 1AJ2A 3EDFA 1ALDA 1M65A 1A0EA 3RR4A 4NI8A 1TWWA 3A4WA 3QSTA 3B04A 1JNDA 4WCJA 4LS2A 4Y2WA 4WZHA 2VFEA 2PI6A 3MI2A 2UY3A 5AB3A 1U2YA 4GNKB 1VFMA 2MANA 3UY8A 2PZ0A 3POCA 2ZX6A 4DY1A 5FJPA 4FI4A 1XH0A 3ITVA 1I2OA 3BO9A 1T99A 5CZTA 1SYTA 4NKCA 4GG9A 3LCGA 5EU9A 2VFDA 5IBXA 4DBDA 1ZP3A 1QHPA 4IX0A 3U6WA 2PCEA 4ZEPA 3TX9A 7ENLA 1G7UA 3GG0A 3SAZA 3QPYA 3TYEA 4HPNA 4LANA 1MSSA 1VIZA 1B1YA 3HV8A 2RDXA 2JF6A 1M03A 3MA8A 2CLHA 2J7CA 3DX5A 2ZUNA 1H1ZA 4LS1A 3B9NA 3H24A 1XRVA 3IVSA 2CLFA 2V6AA 1MDRA 2JKPA 2PTXA 4RPPA 4DUOA 3WG6A 4V2XA 1OK6A 3TYZA 4ADTA 2J13A 2FH6A 3V18A 5AC8A 1VR6A 3ARZA 1K4GA 2G96A 3ABOA 1UA3A 2DT0A 1A5MC 2G3JA 3VA8A 1POJA 3ZSSA 3PUDA 3UXAA 2AQWA 2QLYA 4LOCA 2JF7A 4MJMA 2DQWA 4UR7A 1DWHM 3BC9A 8CGTA 4AHOA 3UJRA 3RRAA 3O6AA 4JQ2A 3AQUA 2RJGA 1WBHA 2PDPA 3W9ZA 4B5NA 3RPTA 1FWDC 1TWSA 3O15A 5CSUA 1XCXA 1V03A 1R3VA 3EMCA 4W8BA 3PWGA 1ZGDA 3P3BA 4XTIA 2A3CA 4F2UA 3KCJA 1XYFA 3CHEA 4Y90A 1VIWA 3FSUA 4RUBA 1NP2A 5AHMA 2Y7DA 1S2WA 2DSZA 1U5VA 1XD0A 3WBEA 3LK6A 3QR0A 3EX4A 4IMDA 3U3HA 1OYBA 4HJFA 4W8AA 1E72M 1A47A 4H8UA 3IJDA 2QJIA 3CMFA 2ZUTA 3PNUA 3EYPA 1KRMA 1U83A 4CQ8A 2YSWA 4HB7A 4PA8A 4AXKA 4HYWA 1JQXA 3B0XA 3S6DA 1WKFA 2B4GA 3PANA 2ZDRA 4MUZA 3GDRA 3DC0A 3VX0A 2GLKA 3KOWA 4B15A 1LJYA 4UMCA 3BG3A 5A8QA 1MYRA 4NAEB 1VBHA 3VXGA 4O13A 3OHMB 3ID7A 3VD9A 2R6OA 1FH7A 1EYWA 1U5HA 2QPXA 3MUAA 3UVAA 4KIRA 1UA7A 3Q94A 4IMFA 4NXKA 4EVZA 1TWZA 1F4AA 3EWDA 4PRWA 2INZA 3MSRA 1H2JA 3FV9A 1G69A 3G1AA 1EQPA 5KSWA 4XBJA 2DIJA 2YIHA 4YL2A 2J75A 3I4EA 1ZU8A 4GZEA 7REQA 1QOPA 3MMUA 3KZSA 2EPLX 1E51A 1ISXA 4RJEA 3KHDA 2GL5A 3NZPA 1ZB5A 3A12A 3VCRA 1GYNA 3NJ3A 3EOEA 1HJWA 2R14A 1KM3A 4AIOA 4XAGA 2FZMA 3K4WA 2VXNA 1BWKA 3B9EA 1BD0A 3L4WA 5F1UA 3G22A 3MO7A 4JR5A 2P76A 3S42A 2NT0A 3N4FA 2PDHA 4S2CA 1E6PA 3HGRA 5CC3A 1UR0A 3R4IA 4ILSA 3IS4A 3N4EA 1PWMA 2Q01A 3P67A 3R11A 3E0VA 3BW4A 2Z24A 3NCOA 3F4NA 2TODA 2QUMA 3OVQA 1IV8A 1QI3A 2A6LA 4O16A 4BQ3A 3KCLA 3TP4A 3W29A 3GVGA 4DNMA 3RPDA 1EC7A 1W32A 4S3CA 5K9XA 3SBFA 3EWBX 2BXYA 1R86A 2FPVA 4K38A 3S2JA 3TC6A 2FZDA 1W1VA 4BQ4A 2JEPA 4OHQA 5GNXA 3I7QA 1ZNNA 3QY7A 2DIEA 4A3RA 1ESWA 5JXQA 1DQUA 3IJ9A 2XSAA 4RXGA 5HJXA 3GZ3A 5FSDC 2QIWA 1FDYA 3KRZA 3VNKA 3T08A 1J2BA 2CIPA 3ARWA 1LLWA 1Y8BA 1X8FA 3L2MA 3CV1A 2ZUMA 4PUEA 1TELA 1EDTA 1LBMA 3DFYA 2DT2A 4EAYA 3XINA 4LTSA 5FF3A 4KF1A 3PFRA 4IIFA 2VC6A 4C6DA 3B9DA 5E0CA 4BCEA 4UWMA 1DIDA 3MHFA 4IMEA 1I1XA 3WBWA 2IPJA 2HBXA 3M0MA 5FL0A 1Q66A 1ZFJA 4KPLA 2ZXBA 4UFMA 4DWDA 2VZUA 5XINA 1Q6EA 4B4HA 2JKAA 1UOZA 2O7QA 1DYSA 5F2IA 1PZ1A 2CBJA 3QQWA 2PF8A 3TQ0A 3M43A 3S6TA 1FWWA 2X40A 3TSBA 3RCNA 4C6PA 2C1IA 4WQ6A 4ZR8A 3A5VA 1A3WA 3W7NA 1DJWA 3CYJA 3G0XA 2G3NA 3ZXWA 5BXSA 3PSVA 1OBAA 3GG8A 2VJXA 2ZX8A 4GCXA 3IRDA 2VUNA 4YHEA 4LY8A 4ZB0A 2VURA 2PWDA 4RLIA 1D7KA 3VD3A 3PP7A 3R6IA 3DAQA 4A2SA 1JI1A 3ZLHA 1PCWA 3W1QA 3UPWA 3L4TA 1AW1A 3GE7A 3I6EA 3O9NA 4ZOBA 3UZWA 1MW2A 3AIEA 3KWSA 3TCEA 2X1SA 1HVQA 3M0KA 1DWJM 2WWDA 4RDZA 2GSHA 1OINA 3RDKA 5T26A 4GVGA 1I2QA 2TAAA 3WNNA 3PS7A 4QCEA 2UY2A 3MMWA 1XIGA 2Y8VA 5I3HA 3KBJA 4IT1A 2NXIA 1DJZA 1E0VA 4WOZA 5JIPA 4PMDA 3L0KA 2DV0A 3IIVA 3OO2A 1SZRA 2ZZ1A 2RGMA 4OECA 4UZSA 1BYAA 1SFSA 1O5KA 2ALRA 2W91A 1M01A 2ZKMX 2E6FA 3KBWA 4Y7EA 3KBVA 1FOBA 1RY0A 3S5NA 3STEA 5HUPA 3SGZA 3C0JA 1WXZA 4JIHA 3BE7A 1M7OA 1RR2A 2QQ6A 1RCQA 3N18A 2DFAA 1A80A 2D23A 5F2LA 4FA3A 4UNIA 3VD7A 3DBNA 4KEMA 1TJPA 1Y7VA 1BKHA 4IICA 4B16A 3UG5A 2PD9A 1PVNA 2A3LA 4O19A 2CLEA 3KTSA 6A3HA 3NURA 3OVPA 1PKNA 1ZBWA 2Z26A 4YTRA 4C6IA 1AA1B 2P53A 4HZ7A 5EMKA 1L6FA 3RIKA 1KLZA 3SFKA 1AQHA 3WD4A 4QR6A 4KH2A 4PSPA 4V15A 1EA0A 4HU0A 1U30A 3QSRA 3T4WA 1E43A 5CH9A 5A95A 1PKLA 1YMYA 2J4GA 5EFDA 4NX5A 4ROPA 5FAGA 3F03K 1LUCB 1BFNA 2BVYA 2ZA3A 5I07A 1L8NA 2KX9A 1HP5A 2Z00A 3NZQA 4NAEA 4TX9A 4ATLA 3E3HA 1TR9A 4NJIA 1E6XM 1Q6FA 3WQDA 2P1FA 4H6QA 3T7VA 5LSMA 4PB3A 2CLLA 3D3AA 4HIBA 4WY0B 3DGRA 2QF7A 1BF6A 4DJFC 1AW5A 3IK2A 1E71M 4CQAA 3NPVA 4Q32A 3SO7A 3GDKA 1XICA 1LTDA 2VD9A 3NYZA 1XLKA 3VIPA 1W9VA 3QMTA 4KS0A 4A8NA 1NTHA 3GKAA 1XH2A 4EF8A 4H01A 4QQUA 3BQ5A 4O15A 3WJZA 2DZWA 3GKFA 4JFUA 4PC8A 3H70A 3TYAA 1HVXA 5BRBA 2WSQA 3P60A 2PTYA 2DVXA 1V6VA 1XW8A 1FP8A 3C0SA 3G3MA 3WELA 3D0CA 1XH1A 1YPFA 5CJNA 4M5PA 3GIPA 1XX1A 5BXPA 4LCQA 2R82A 1B2YA 2PGFA 4N4PA 1EUAA 4LY4A 1NFBA 2XPKA 4IP7A 2FHBA 3EDKA 3QZAA 1QWGA 4GINA 4B9ZA 2CHRA 3OGRA 1FWTA 3TOYA 3UR5A 5HQMA 3UGRA 2ZTKA 3CHFA 1EKOA 1F61A 5D9MA 5K2ZA 3S46A 5FJIA 5CGQA 4GI4A 2A3BA 2ASHA 3AS2A 4QEEA 5C2GA 1XISA 2FTYA 3AIQA 5DT7A 2A7RA 1D7FA 4HNCA 4BEUA 5I3KA 2GGJA 1GQJA 5K7JA 3U57A 3TTOA 4AU0A 3BMWA 2G37A 3CZKA 3H2MA 4ONVA 3WH6A 4PGLA 2A1YA 3CQ0A 1FP9A 1ISWA 4UQBA 4LCRA 4MB4A 4W89A 4DPQA 1HT6A 3NQFA 3GTXA 3C3NA 1R6WA 4LBRA 2DZVA 1M7XA 3I68A 1QR7A 4HTBA 4FALA 2V68A 3MUIA 3DG7A 1O1HA 3EWXA 3RF9A 5A2CA 1NOWA 4JXCA 2HVMA 3DI1A 4Y8FA 4H6EA 3S6OA 3ORWA 1E3ZA 3AAMA 3BK0A 3E1F1 4RZ4A 2Q8LA 3B03A 4O10A 1R7OA 4GI6A 2CESA 4TOQA 2GUYA 4RE2A 5TNVA 1H7XA 3PUEA 3ES7A 2C8NA 3S1XA 3L66A 1CXKA 1XFCA 5ABEA 5K9DA 2FLIA 4ZTXA 1FWJC 4U2ZA 5HMEA 1ME7A 3NDZA 1S46A 3VVGA 4KWSA 4A8IA 5F1VA 4OV4A 3C6CA 5XIMA 1TUFA 1HO1A 1T5AA 3TTSA 4GK8A 3V5CA 1D2KA 3ZM8A 2RJHA 5HR7A 1M5WA 5JBDA 1SJCA 2ZZ6A 1C93A 2HISA 4P7NA 3LQLA 1EYEA 3VYLA 2AGTA 2P50A 1KTBA 1WO2A 2C0HA 3W82A 4P7QA 2YB1A 4MWAC 5A2BA 4FPSA 5HNUA 3L7RA 5IBXC 2Q3RA 2X0SA 3E74A 2EBNA 4NNBA 4AWTA 2D69A 4DQWA 3ARQA 3IIOA 1OSEA 4FO4A 5BZAA 3OGVA 2YL8A 3EKLA 4S38A 3MSDA 2WBKA 4M81A 5J8LA 4DM2A 5LNVA 4GY0A 4XD5A 2QF8A 2FFCA 3VOGA 4LSBA 3M1ZA 2NSOA 1W5QA 1RPXA 2E4TA 2HCVA 4QDPA 3W84A 3SCOA 1L0PA 4O8AA 3N29A 2ZE3A 2Y70A 4YTSA 4YU1A 5BCAA 3U2OA 1T96A 3V3WA 1OWQA 4JTAA 4DIAA 4V33A 3GXNA 1E4NA 3CT7A 3FLUA 3B4YA 3PFMA 1EIBA 3UEQA 3ZSTA 4M24A 5M1TA 4FLRA 3OQ8A 4ATWA 5LGXA 4K39A 4C60A 1HL8A 1XP3A 3WLJA 2CZ5A 5G4EA 3WQWA 1HJVA 2PDIA 4J27A 1TV2A 3V5FA 5HQEA 3AMLA 1LZOA 1JL8A 1P4CA 1AD1A 1W9UA 1XYAA 2E6YA 3R10A 4C6FA 5CJMA 4GACA 4AZ7A 1KBKA 4B5SA 1KCZA 1CIUA 4C91A 1LL4A 4QG9A 1K8XA 3FVDA 2Y0FA 1A4LA 1SMAA 1B0IA 5LIXX 3QV8A 3HG2A 3KTXA 2IXUA 3LTSA 1PV8A 1R46A 4FLQA 1HO4A 3ENLA 1EF3A 2UBPC 3DDMA 1UW9A 4KRZA 3WQGA 1CT5A 3G1XA 3FVMA 5EB8A 2PMQA 4ADUA 3VD5A 3DN5A 1LUCA 1VZWA 3NQGA 4QE1A 3FGCB 4B5WA 4PMJA 5BROA 1GJUA 3KVJA 4O14A 4RNJA 1OD8A 3PG8A 1RJPA 4WY0A 4UMAA 2VFHA 2MNRA 4PRTA 3GBEA 2ZUVA 4AEOA 1WDDA 3RM8A 4A22A 4L6OA 1EWEA 3G0UA 1R47A 2WNWA 3MHUA 3T81A 2J9ZA 1TPEA 4AVNA 1JGMA 4QSHA 4DWSB 3BOFA 4AD3A 3QLDA 2ZC1A 3P2VA 3N14A 4LB3A 1UC5A 1QPRA 1OGGA 3WF2A 4NILA 5I3IA 3UJSA 2A6NA 1W1B1 1GW9A 3FX4A 4KEUA 4RE3A 4NYYA 3UR7A 1UH3A 3P6LA 4AIUA 4AWUA 3CQIA 3P62A 1YTKA 4KIEA 3A13A 5C9ZA 3EPMA 4XTDA 4PUKA 1WOBA 5H8PA 4F9JA 1J5TA 2OCZA 2DU2A 4UUIA 1HZYA 4W84A 5AC5A 4NI3A 4PL2A 3G3DA 1MDLA 4WKAA 3CH0A 3NQBA 3V36A 1JPIA 2DT1A 2XH0A 3QV7A 5A6MA 1MQRA 1QBAA 4OBTA 2Y7EA 1EX5A 3A22A 5T9BG 4QE4A 4C7FA 4GKLA 1PBGA 1H62A 3F4CA 5EFFA 3LGEA 4JTKA 3VIJA 4C65A 4IQDA 5TIMA 3DHFA 1T8QA 1H7PA 3DEQA 3IUIA 1UG6A 3PZOA 1H49A 4X2PA 1UC4A 1AVAA 1LL6A 1JF5A 5HWNA 4NNCA 3VI2A 3SURA 3LEPA 1LP6A 3H23A 2X1RA 1RVGA 4FIQA 5HWMA 1HFBA 5MHBA 3BJFA 4MJ4A 1XL9A 1WA3A 3QYQA 1KB3A 3TW9A 3QOKA 3S8HA 3K1DA 2VDGA 3CC1A 1OCBA 4GO8A 2WV8A 3TH6A 1WCGA 4B3KA 3EWCA 3N2XA 1A5OC 4GA8A 3QC3A 3CASA 3UZYA 1RV8A 2GOUA 5IDIA 1C90A 1UB3A 3SCPA 1K8YA 2QPUA 2VL4A 1T6MA 4Q6XA 4ZOAA 2Z7GA 3IRSA 4Q22A 4PTXA 2QDEA 5ABFB 1OD0A 8XIAA 8XIMA 3QLLA 3WDJA 1FH9A 4IP4A 4LXFA 3UERA 1OT2A 2HQAA 5C2CA 1GONA 3VKBA 4OKDA 4P7RA 5LIYX 3FDGA 1ITCA 4LUTB 2NQHA 2OZTA 3BV7A 4LW7A 1KC7A 4HZ6A 4KBXA 1EC8A 1BYBA 1J5SA 2NV2A 3FJLA 1UR3M 4ORIA 1GPFA 4NP7A 4D71A 2FHCA 4LALA 2O0TA 1XYMA 3NXFA 2YX0A 7A3HA 1EZ2A 3AXMA 5FEPA 2AOSA 1TJ2A 3D3FA 1ITQA 3UNTA 4DUXA 2E8ZA 4UB9A 1S2TA 3BLFA 2NLYA 4Z17A 4MB1A 4H3DA 1RD6A 3WLMA 5HDRA 2P8BA 5DN1A 3A6OA 3FEQA 4BY3A 3A47A 1PKYA 4DEFA 1VYSX 1WDWA 1U1UA 1VENA 2ZE0A 2J7HA 5FIPA 3CU2A 4MFEA 2ACSA 1EP2A 1YRRA 3VIKA 3W1XA 3CHDA 3TNBA 1R2TA 3GDMA 4H7VA 1XSJA 3KL3A 2CZEA 4N9BA 2A0NA 4JTUA 2QMJA 1UD5A 2EG8A 3Q37A 4N4QA 3C61A 2ZVIA 3DBPA 4KERA 3URQA 4PUMA 1H7WA 2CKRA 1IXOA 5AHNA 1ME9A 5D33A 1K77A 4KQNA 1KKOA 3FNDA 2XHYA 3CQKA 1ME8A 3UR8A 1E1CB 4HU4A 3MY9A 5CSSA 4NRSA 1ISZA 3W7HA 1PHWA 1CDGA 3L0NA 3N9KA 3FDKA 3BAXA 1GOQA 3WDPP 2CFFA 3C52A 1QJWA 3OG3A 2IQTA 3DXIA 1ECQA 4AQLA 3F4VA 3R12A 3MVTA 3BLEA 1OX5A 5GPRA 4NQ1A 3W7RA 3W7DA 1TCDA 3W1TA 4ZSTA 4Z2HA 4PRRA 5K3VA 1W2VA 2RGLA 4FNUA 5HPOA 1KM4A 2G97A 4EPKA 3PAJA 3O8AA 4PCFA 3IEBA 4W8LA 3PZTA 4HK7A 1FRBA 3WFZA 3CWNA 4KEZA 4GXWA 1PXGA 3F5JA 3N15A 3LMZA 1VJZA 4FLSA 4NSBA 5A6JA 3HG5A 4AY7A 4LAMA 4W5UA 4CN4A 3W7MA 1JIBA 1JUBA 1F07A 1S1RA 1AJ0A 1XIIA 1GQLA 1X1NA 2BFGA 4G8TA 1ONEA 1L6GA 4GFSA 2XFRA 4JEQA 2QKFA 3TYDA 3MZNA 4QLJA 1Q6RA 1B3YA 1TTQA 5A6LA 5A6BA 2ZADA 2OODA 1GHSA 2I7GA 3RITA 3AUOA 2X2YA 3GSMA 3WF3A 2QJNA 1NF7A 1XLLA 2Q71A 1PTAA 2Z29A 2X8RA 4FNSA 4MPQA 4AWSA 1XIMA 3LLDA 1SO4A 2XGIA 3NL6A 3UG4A 5I24A 1KBLA 2IQ0A 2O9TA 2FGLA 2CLIA 2J47A 3EX1A 4Y96A 1VAHA 3VKAA 4I8DA 2X1UA 4YCOA 1EZWA 4UTIA 5EL1A 2H9AB 1TV7A 4K8HA 4DWSA 2W0UA 1SUXA 3LQGA 3M7SA 1MW1A 4P2VA 5AKQA 1IXQA 1J6PA 3N6JA 2XYLA 4HPXA 3L2IA 1BAGA 1KLYA 1LOLA 4H6RA 1H0IA 2ZBTA 3R0DA 3P74A 4ERIA 5JBFA 3V4BA 4Z2GA 6TIMA 4U4MA 1QPQA 4YLWA 3JZUA 3FA4A 3VINA 1E0TA 3L4YA 2HSAA 2Q09A 2R8WA 2G3MA 1GOMA 2NVCA 4O54A 4LV9A 2NXGA 2B0MA 1VBGA 4NZ5A 3MTWA 5TQLA 1OK4A 3DCPA 2BHYA 3L12A 2YDQA 3V5OA 4AUBA 1NFPA 3M07A 1DBTA 4UCGA 3HGSA 4H1ZA 4NASA 4W87A 2YFNA 1UZ4A 1X6NA 3VKJA 3CV2A 4GIRA 3UWUA 3PZQA 1DWGM 2FMNA 2OXNA 3HQPA 1UWIA 4LCSA 1QOQA 1QTWA 4N2YA 2GUBA 1EF2A 1FQ0A 3G24A 3LM3A 2VOTA 3SUUA 5IM51 2IW0A 1JFXA 1HG3A 1XRTA 3VNLA 3G1HA 4K36A 2C71A 1IQ8A 3UR2A 4HN8A 3AICA 3AZTA 2EG6A 4MF4A 3W6MA 1VYRA 4XUGA 4D1JA 3DG3A 4HA0A 1FCQA 5REQB 4UTMA 5FF2A 1K9TA 1DTNA 1VFFA 1XXXA 4XZMX 3QQ1A 1J0YA 3L5MA 1EJVC 1XDLA 4O1BA 5D37A 2YW4A 2WHLA 1W37A 1GWJA 1EC9A 4D9PA 5ABFA 1UD8A 4K2SA 1WZMA 1G4EA 3W3OA 4BI6A 2PU0A 4NUWA 4CQBA 1NEYA 4JICA 4HP5A 1AJZA 2QT3A 4LUTA 3N2CA 4QAWA 3W24A 1C7SA 1IWBA 5DY3A 4CEUC 2ALDA 3C2RA 1WKDA 3P81A 1N82A 1VHNA 4XZLX 3W1UA 4A4AA 4PL1A 3QTGA 2FMOA 4AB4A 3M47A 5I2UA 1UUMA 2C18A 4KESA 2D0FA 3UJ2A 4P8XA 2QJGA 3NQAA 3FYPA 2ZRWA 3N73A 4RV8A 4BI5A 1OFEA 4WRHA 2Z0IA 3S2MA 1WAUA 3GK0A 4UQ9A 3NQVA 3BLLA 1Z89A 2VVNA 2WHJA 4JX5A 4KWOA 1NOUA 4AIBA 4DZAA 3KUMA 2QDHA 3FYOA 3H2FA 3T42A 4I9JA 3LXCA 2QGHA 4JY8A 3I3EA 4QTGA 1EJXC 1CXIA 1QNVA 3W53A 2CPUA 4HNLA 3QZ6A 2CLOA 4CU7A 5DLCA 3F5LA 4MB5A 4DJEA 1CW2A 3APYA 2VEPA 3H55A 3U9IA 2JK2A 2PWEA 3PBWA 3CAVA 1Z48A 4UFHA 1E1CA 2V3GA 4KWWA 2WC7A 3W2UA 1TG7A 3N19B 4WEVX 3OBEA 1AQ0A 1B31A 1BKSA 3HPAA 1HGYA 3EWWA 2DZTA 4O0QA 2YDSA 5CJ5A 3QGKC 4F0RA 3R89A 4HMNA 2QUUA 3LYEA 2CLMA 2POZA 1OCNA 5A8GA 3B0YA 1DJHA 2FPYA 1MEWA 1JGIA 5E93A 4TQTA 1M68A 3W7QA 1HKMA 1LL7A 3D5HA 1AG1O 1VYPX 1C3FA 4QNWA 3JU2A 2F61A 3VTRA 4Z2LA 1MXDA 3FAWA 2C3ZA 4H00A 1GEQA 4FHAA 1UKSA 3N3TA 3U0HA 5DBUA 1HF6A 4LWWA 5XIAA 1JJKA 1I0BA 1S2CA 4UNKA 4L4OA 4YXGA 5A5WA 3W7LA 3OEXA 5HATA 2J8FA 2EKGA 4K1GA 4F0HA 4M7SA 3PZGA