3RZOF

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
EKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 3rzoF00
2NVTF 3PO2F 3GTMF 2A6EE 4YFXE 2JA7F 3H3VG 5E18E 1I6VE 3GTOF 2R93F 3S1QF 3S1NF 1K83F 5IYCF 3GTJF 2A69E 5IYBF 4XLPE 2B63F 4G7ZE 5C44F 2A6HE 4OIPE 4OIRE 5C4XF 4G7OE 3GTKF 4OIQE 2NVXF 4A3MF 1I50F 3HOWF 2R92F 4XSXE 4BBRF 4YFKE 3GTLF 5C4JF 1WCMF 4MEXE 1TWFF 4X6AF 3S17F 2JA5F 5IPLE 2CW0E 5E17E 1YNJK 4LJZE 3S1RF 4A3FF 4YG2E 3GTGF 4C3HF 4BY1F 5IP7F 2Y0SI 2YU9F 3RZDF 1TWCF 3HOVF 4Y7NF 3H0GF 2JA6F 3RZOF 4A3LF 3GTPF 2JA8F 4C3IF 3S16F 3S2HF 4BXXF 3M4OF 1ZYRE 4A3DF 4LK1E 1I6HF 5FLMF 2WB1I 4KMUE 4A3EF 4AYBK 3I4MF 1IW7E 5IYDF 1TWGF 3K7AF 2NVYF 4YFNE 4A93F 4KN4E 3S1MF 1SFOF 2E2JF 3WODE 4Q5SE 4BY7F 4ZH4E 3S15F 1SMYE 4LLGE 5C3EF 2O5IE 2PMZK 1QKLA 5IP9F 5M5XF 2NVQF 4A3IF 4OIOE 1TWHF 3EQLE 3I4NF 1HQME 5TMFE 2R7ZF 3PO3F 4KN7E 2E2IF 3FKIF 4XLNE 2E2HF 1Y1WF 4A3GF 4MQ9E 3HKZK 2A68E 4A3JF 5D4CE 2WAQK 5TMCE 4A3CF 3M3YF 3GTQF 5BYHE 2O5JE 2VUMF 4GZYE 4OINE 2PPBE 3S2DF 4BBSF 3DXJE 3CQZF 4XSZE 5M3FF 4Q4ZE 4A3KF 1YNNK 4JK1E 5D4EE 4MEYE 5FJ8F 4G7HE 5D4DE 1I3QF 3S14F 5M3MF 1Y1VF 3HOUF 3HOXF 4Y52F 3HOZF 4LK0E 4A3BF 5M5WF 3HOYF 1R9TF 4C2MF 1TWAF 2BE5E 4C3JF 5M5YF
chains in the Genus database with same CATH superfamily
3S2DE 2NVTF 3HKZH 3PO2F 2YU9E 3GTMF 5C4JE 5C3EE 2A6EE 4YFXE 3HOWE 2JA7F 3H3VG 5E18E 3M3YE 1I6VE 2B63E 4A93E 3GTOF 3M4OE 2R93F 5M5YE 3PO2E 3S1QF 3PO3E 3S1NF 1K83F 5IYCF 1I3QE 3GTJF 2A69E 5IYBF 4QIWH 4XLPE 3HOXE 5M5WE 1I50E 2B63F 3HOYE 4G7ZE 5C44F 4A3ME 2A6HE 4OIPE 4OIRE 1K83E 2NVYE 5C4XF 4C3IE 4G7OE 1R9TE 5M5XE 2R7ZE 4OIQE 4C3JE 3GTKF 2NVXF 4A3MF 2JA5E 1I50F 3HOWF 2E2JE 4XSXE 4BBRF 4YFKE 2R92F 5C4JF 2VUME 3GTLF 3FKIE 1WCMF 4MEXE 1TWFF 3CQZE 3S17F 3HOZE 2JA5F 4X6AF 4Y52E 5IPLE 2CW0E 3K7AE 5E17E 1YNJK 2R7ZF 4LJZE 3S1RF 3S1QE 3RZDE 3HOVE 4A3FF 3GTPE 4YG2E 1TWAE 3GTGF 3H0GE 4C3HF 3S17E 5C4XE 4BY1F 2WB1H 5IP7F 2Y0SI 2YU9F 3S2HE 3RZDF 1TWCF 3HOVF 4Y7NF 3H0GF 4C3HE 2JA6F 3S14E 3RZOF 4A3LF 3GTPF 2JA8F 4C3IF 5FLME 3S16F 3S2HF 4BBSE 2E2HE 4BXXF 1DZFA 2WAQH 3GTOE 3M4OF 2R93E 1Y1WE 1ZYRE 4A3BE 4A3DF 4LK1E 4BBRE 1I6HF 5FLMF 3S16E 2KRXA 2WB1I 4KMUE 4A3EF 4AYBK 1TWHE 3I4MF 1IW7E 5IYDF 1TWGF 3K7AF 2NVYF 1I6HE 4YFNE 4A93F 5IP7E 4KN4E 3S1MF 2Y0SH 1SFOF 2E2JF 3GTLE 3WODE 5M3FE 2R92E 2PMZH 3GTJE 4Q5SE 4A3JE 4A3IE 2JA6E 4BY7F 4A3CE 4ZH4E 3S15F 4C2ME 1WCME 1SMYE 3GTME 4LLGE 5C3EF 2O5IE 2PMZK 1QKLA 2E2IE 4QIWK 5IP9F 5M5XF 4A3FE 4A3IF 4OIOE 1TWHF 3EQLE 2NVQF 1HQME 5TMFE 3GTKE 4A3EE 5IYDE 3HOUE 3I4NF 3S15E 5IYCE 3PO3F 4KN7E 3I4ME 3RZOE 2E2IF 4A3LE 3FKIF 2NVQE 4AYBH 4XLNE 2E2HF 4BXXE 5IYBE 1Y1WF 2NVTE 5M3ME 4A3GF 4MQ9E 3HKZK 4A3JF 1Y1VE 5D4CE 3S1RE 2WAQK 5TMCE 4A3CF 3M3YF 1TWCE 3GTQF 5BYHE 2O5JE 4C2MF 2VUMF 4GZYE 4OINE 2PPBE 3S2DF 4BBSF 3DXJE 2JA8E 3CQZF 4XSZE 5M3FF 3H3VF 4Q4ZE 4A3DE 4A3KF 2JA7E 1YNNK 4JK1E 5D4EE 4X6AE 4MEYE 3GTGE 5FJ8F 4G7HE 1TWGE 4A3KE 5D4DE 2NVXE 1I3QF 3S14F 1EIKA 5M3MF 3S1NE 4Y7NE 1Y1VF 3HOUF 5FJ8E 3I4NE 3HOXF 5IP9E 1SFOE 3GTQE 1TWFE 4Y52F 5C44E 4LK0E 3HOZF 3S1ME 4A3BF 4A3GE 5M5WF 3HOYF 4BY1E 1R9TF 2A68E 1TWAF 2BE5E 4C3JF 5M5YF 4BY7E
chains in the Genus database with same CATH topology
2NVTF 3PO2F 3GTMF 2A6EE 4YFXE 2JA7F 3H3VG 5E18E 1I6VE 3GTOF 2R93F 3S1QF 3S1NF 1K83F 5IYCF 3GTJF 2A69E 5IYBF 4XLPE 2B63F 4G7ZE 5C44F 2A6HE 4OIPE 4OIRE 5C4XF 4G7OE 3GTKF 4OIQE 2NVXF 4A3MF 1I50F 3HOWF 2R92F 4XSXE 4BBRF 4YFKE 3GTLF 5C4JF 1WCMF 4MEXE 1TWFF 4X6AF 3S17F 2JA5F 5IPLE 2CW0E 5E17E 1YNJK 4LJZE 3S1RF 4A3FF 4YG2E 3GTGF 4C3HF 4BY1F 5IP7F 2Y0SI 2YU9F 3RZDF 1TWCF 3HOVF 4Y7NF 3H0GF 2JA6F 3RZOF 4A3LF 3GTPF 2JA8F 4C3IF 3S16F 3S2HF 4BXXF 3M4OF 1ZYRE 4A3DF 4LK1E 1I6HF 5FLMF 2KRXA 2WB1I 4KMUE 4A3EF 4AYBK 3I4MF 1IW7E 5IYDF 1TWGF 3K7AF 2NVYF 4YFNE 4A93F 4KN4E 3S1MF 1SFOF 2E2JF 3WODE 4Q5SE 4BY7F 4ZH4E 3S15F 1SMYE 4LLGE 5C3EF 2O5IE 2PMZK 1QKLA 4QIWK 5IP9F 5M5XF 2NVQF 4A3IF 4OIOE 1TWHF 3EQLE 3I4NF 1HQME 5TMFE 2R7ZF 3PO3F 4KN7E 2E2IF 3FKIF 4XLNE 2E2HF 1Y1WF 4A3GF 4MQ9E 3HKZK 2A68E 4A3JF 5D4CE 2WAQK 5TMCE 4A3CF 3M3YF 3GTQF 5BYHE 2O5JE 2VUMF 4GZYE 4OINE 2PPBE 3S2DF 4BBSF 3DXJE 3CQZF 4XSZE 5M3FF 4Q4ZE 4A3KF 1YNNK 4JK1E 5D4EE 4MEYE 5FJ8F 4G7HE 5D4DE 1I3QF 3S14F 5M3MF 1Y1VF 3HOUF 3HOXF 4Y52F 3HOZF 4LK0E 4A3BF 5M5WF 3HOYF 1R9TF 4C2MF 1TWAF 2BE5E 4C3JF 5M5YF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT F;  3PO2 F;  3GTM F;  2A6E E;  4YFX E;  2JA7 F;  3H3V G;  5E18 E;  1I6V E;  3GTO F;  2R93 F;  3S1Q F;  3S1N F;  1K83 F;  5IYC F;  3GTJ F;  2A69 E;  5IYB F;  4XLP E;  2B63 F;  4G7Z E;  5C44 F;  2A6H E;  4OIP E;  4OIR E;  5C4X F;  4G7O E;  3GTK F;  4OIQ E;  2NVX F;  4A3M F;  1I50 F;  3HOW F;  2R92 F;  4XSX E;  4BBR F;  4YFK E;  3GTL F;  5C4J F;  1WCM F;  4MEX E;  1TWF F;  4X6A F;  3S17 F;  2JA5 F;  5IPL E;  2CW0 E;  5E17 E;  1YNJ K;  4LJZ E;  3S1R F;  4A3F F;  4YG2 E;  3GTG F;  4C3H F;  4BY1 F;  5IP7 F;  2Y0S I;  2YU9 F;  3RZD F;  1TWC F;  3HOV F;  4Y7N F;  3H0G F;  2JA6 F;  3RZO F;  4A3L F;  3GTP F;  2JA8 F;  4C3I F;  3S16 F;  3S2H F;  4BXX F;  3M4O F;  1ZYR E;  4A3D F;  4LK1 E;  1I6H F;  5FLM F;  2WB1 I;  4KMU E;  4A3E F;  4AYB K;  3I4M F;  1IW7 E;  5IYD F;  1TWG F;  3K7A F;  2NVY F;  4YFN E;  4A93 F;  4KN4 E;  3S1M F;  1SFO F;  2E2J F;  3WOD E;  4Q5S E;  4BY7 F;  4ZH4 E;  3S15 F;  1SMY E;  4LLG E;  5C3E F;  2O5I E;  2PMZ K;  1QKL A;  5IP9 F;  5M5X F;  2NVQ F;  4A3I F;  4OIO E;  1TWH F;  3EQL E;  3I4N F;  1HQM E;  5TMF E;  2R7Z F;  3PO3 F;  4KN7 E;  2E2I F;  3FKI F;  4XLN E;  2E2H F;  1Y1W F;  4A3G F;  4MQ9 E;  3HKZ K;  2A68 E;  4A3J F;  5D4C E;  2WAQ K;  5TMC E;  4A3C F;  3M3Y F;  3GTQ F;  5BYH E;  2O5J E;  2VUM F;  4GZY E;  4OIN E;  2PPB E;  3S2D F;  4BBS F;  3DXJ E;  3CQZ F;  4XSZ E;  5M3F F;  4Q4Z E;  4A3K F;  1YNN K;  4JK1 E;  5D4E E;  4MEY E;  5FJ8 F;  4G7H E;  5D4D E;  1I3Q F;  3S14 F;  5M3M F;  1Y1V F;  3HOU F;  3HOX F;  4Y52 F;  3HOZ F;  4LK0 E;  4A3B F;  5M5W F;  3HOY F;  1R9T F;  4C2M F;  1TWA F;  2BE5 E;  4C3J F;  5M5Y F; 
#chains in the Genus database with same CATH topology
 3S2D E;  2NVT F;  3HKZ H;  3PO2 F;  2YU9 E;  3GTM F;  5C4J E;  5C3E E;  2A6E E;  4YFX E;  3HOW E;  2JA7 F;  3H3V G;  5E18 E;  3M3Y E;  1I6V E;  2B63 E;  4A93 E;  3GTO F;  3M4O E;  2R93 F;  5M5Y E;  3PO2 E;  3S1Q F;  3PO3 E;  3S1N F;  1K83 F;  5IYC F;  1I3Q E;  3GTJ F;  2A69 E;  5IYB F;  4QIW H;  4XLP E;  3HOX E;  5M5W E;  1I50 E;  2B63 F;  3HOY E;  4G7Z E;  5C44 F;  4A3M E;  2A6H E;  4OIP E;  4OIR E;  1K83 E;  2NVY E;  5C4X F;  4C3I E;  4G7O E;  1R9T E;  5M5X E;  2R7Z E;  4OIQ E;  4C3J E;  3GTK F;  2NVX F;  4A3M F;  2JA5 E;  1I50 F;  3HOW F;  2E2J E;  4XSX E;  4BBR F;  4YFK E;  2R92 F;  5C4J F;  2VUM E;  3GTL F;  3FKI E;  1WCM F;  4MEX E;  1TWF F;  3CQZ E;  3S17 F;  3HOZ E;  2JA5 F;  4X6A F;  4Y52 E;  5IPL E;  2CW0 E;  3K7A E;  5E17 E;  1YNJ K;  2R7Z F;  4LJZ E;  3S1R F;  3S1Q E;  3RZD E;  3HOV E;  4A3F F;  3GTP E;  4YG2 E;  1TWA E;  3GTG F;  3H0G E;  4C3H F;  3S17 E;  5C4X E;  4BY1 F;  2WB1 H;  5IP7 F;  2Y0S I;  2YU9 F;  3S2H E;  3RZD F;  1TWC F;  3HOV F;  4Y7N F;  3H0G F;  4C3H E;  2JA6 F;  3S14 E;  3RZO F;  4A3L F;  3GTP F;  2JA8 F;  4C3I F;  5FLM E;  3S16 F;  3S2H F;  4BBS E;  2E2H E;  4BXX F;  1DZF A;  2WAQ H;  3GTO E;  3M4O F;  2R93 E;  1Y1W E;  1ZYR E;  4A3B E;  4A3D F;  4LK1 E;  4BBR E;  1I6H F;  5FLM F;  3S16 E;  2KRX A;  2WB1 I;  4KMU E;  4A3E F;  4AYB K;  1TWH E;  3I4M F;  1IW7 E;  5IYD F;  1TWG F;  3K7A F;  2NVY F;  1I6H E;  4YFN E;  4A93 F;  5IP7 E;  4KN4 E;  3S1M F;  2Y0S H;  1SFO F;  2E2J F;  3GTL E;  3WOD E;  5M3F E;  2R92 E;  2PMZ H;  3GTJ E;  4Q5S E;  4A3J E;  4A3I E;  2JA6 E;  4BY7 F;  4A3C E;  4ZH4 E;  3S15 F;  4C2M E;  1WCM E;  1SMY E;  3GTM E;  4LLG E;  5C3E F;  2O5I E;  2PMZ K;  1QKL A;  2E2I E;  4QIW K;  5IP9 F;  5M5X F;  4A3F E;  4A3I F;  4OIO E;  1TWH F;  3EQL E;  2NVQ F;  1HQM E;  5TMF E;  3GTK E;  4A3E E;  5IYD E;  3HOU E;  3I4N F;  3S15 E;  5IYC E;  3PO3 F;  4KN7 E;  3I4M E;  3RZO E;  2E2I F;  4A3L E;  3FKI F;  2NVQ E;  4AYB H;  4XLN E;  2E2H F;  4BXX E;  5IYB E;  1Y1W F;  2NVT E;  5M3M E;  4A3G F;  4MQ9 E;  3HKZ K;  4A3J F;  1Y1V E;  5D4C E;  3S1R E;  2WAQ K;  5TMC E;  4A3C F;  3M3Y F;  1TWC E;  3GTQ F;  5BYH E;  2O5J E;  4C2M F;  2VUM F;  4GZY E;  4OIN E;  2PPB E;  3S2D F;  4BBS F;  3DXJ E;  2JA8 E;  3CQZ F;  4XSZ E;  5M3F F;  3H3V F;  4Q4Z E;  4A3D E;  4A3K F;  2JA7 E;  1YNN K;  4JK1 E;  5D4E E;  4X6A E;  4MEY E;  3GTG E;  5FJ8 F;  4G7H E;  1TWG E;  4A3K E;  5D4D E;  2NVX E;  1I3Q F;  3S14 F;  1EIK A;  5M3M F;  3S1N E;  4Y7N E;  1Y1V F;  3HOU F;  5FJ8 E;  3I4N E;  3HOX F;  5IP9 E;  1SFO E;  3GTQ E;  1TWF E;  4Y52 F;  5C44 E;  4LK0 E;  3HOZ F;  3S1M E;  4A3B F;  4A3G E;  5M5W F;  3HOY F;  4BY1 E;  1R9T F;  2A68 E;  1TWA F;  2BE5 E;  4C3J F;  5M5Y F;  4BY7 E; 
#chains in the Genus database with same CATH homology
 2NVT F;  3PO2 F;  3GTM F;  2A6E E;  4YFX E;  2JA7 F;  3H3V G;  5E18 E;  1I6V E;  3GTO F;  2R93 F;  3S1Q F;  3S1N F;  1K83 F;  5IYC F;  3GTJ F;  2A69 E;  5IYB F;  4XLP E;  2B63 F;  4G7Z E;  5C44 F;  2A6H E;  4OIP E;  4OIR E;  5C4X F;  4G7O E;  3GTK F;  4OIQ E;  2NVX F;  4A3M F;  1I50 F;  3HOW F;  2R92 F;  4XSX E;  4BBR F;  4YFK E;  3GTL F;  5C4J F;  1WCM F;  4MEX E;  1TWF F;  4X6A F;  3S17 F;  2JA5 F;  5IPL E;  2CW0 E;  5E17 E;  1YNJ K;  4LJZ E;  3S1R F;  4A3F F;  4YG2 E;  3GTG F;  4C3H F;  4BY1 F;  5IP7 F;  2Y0S I;  2YU9 F;  3RZD F;  1TWC F;  3HOV F;  4Y7N F;  3H0G F;  2JA6 F;  3RZO F;  4A3L F;  3GTP F;  2JA8 F;  4C3I F;  3S16 F;  3S2H F;  4BXX F;  3M4O F;  1ZYR E;  4A3D F;  4LK1 E;  1I6H F;  5FLM F;  2KRX A;  2WB1 I;  4KMU E;  4A3E F;  4AYB K;  3I4M F;  1IW7 E;  5IYD F;  1TWG F;  3K7A F;  2NVY F;  4YFN E;  4A93 F;  4KN4 E;  3S1M F;  1SFO F;  2E2J F;  3WOD E;  4Q5S E;  4BY7 F;  4ZH4 E;  3S15 F;  1SMY E;  4LLG E;  5C3E F;  2O5I E;  2PMZ K;  1QKL A;  4QIW K;  5IP9 F;  5M5X F;  2NVQ F;  4A3I F;  4OIO E;  1TWH F;  3EQL E;  3I4N F;  1HQM E;  5TMF E;  2R7Z F;  3PO3 F;  4KN7 E;  2E2I F;  3FKI F;  4XLN E;  2E2H F;  1Y1W F;  4A3G F;  4MQ9 E;  3HKZ K;  2A68 E;  4A3J F;  5D4C E;  2WAQ K;  5TMC E;  4A3C F;  3M3Y F;  3GTQ F;  5BYH E;  2O5J E;  2VUM F;  4GZY E;  4OIN E;  2PPB E;  3S2D F;  4BBS F;  3DXJ E;  3CQZ F;  4XSZ E;  5M3F F;  4Q4Z E;  4A3K F;  1YNN K;  4JK1 E;  5D4E E;  4MEY E;  5FJ8 F;  4G7H E;  5D4D E;  1I3Q F;  3S14 F;  5M3M F;  1Y1V F;  3HOU F;  3HOX F;  4Y52 F;  3HOZ F;  4LK0 E;  4A3B F;  5M5W F;  3HOY F;  1R9T F;  4C2M F;  1TWA F;  2BE5 E;  4C3J F;  5M5Y F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...