3RZOI

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzoI02
4A3JI 3I07A 3HOYI 5IP9I 3I4NI 1N2FA 1TWGI 3HOUI 2VUMI 2DE6A 3S2DI 4A3FI 3GTGI 1TWFI 2JA7I 3U50C 3GTMS 2NVTI 1NUIA 3LUSA 5FLMI 4X6AI 3PO3S 2AKLA 1I6HI 2HF1A 1USPB 2PK7A 4A3II 3D6WA 1ML8A 2BJOA 3HOXI 1ZB9A 1X3ZA 4A3MI 2JA8I 1TWHI 3VMHA 4BY1I 4BXXI 2E2JI 5C3EI 1RO4A 1SFOI 3VMGA 3VB9A 2JA5I 3S2HI 1RLYA 5CM2M 2KPIA 4NBDA 2J6AA 2F4MA 2NVQI 3S1NI 2NVYI 1VLAA 2B63I 1ZB8A 4A3CI 4A3GI 4QTUA 3GTLI 3S16I 2R92I 1DL6A 3CQZI 1TFIA 1TWAI 4NB8A 4A93I 4NBCA 4A3BI 3GTJI 2E2II 1WW9A 3S1RI 1Y1VI 3S17I 1Y1WI 2DE5A 5C4XI 3S1QI 4QTTA 3H0GI 3PO3I 3S15I 3GTQI 4NBGA 2R93I 1PFTA 3FKII 1I3QI 4A3DI 4BBRI 3GCFA 2K5RA 3M4OI 2E2HI 1TWCI 3VMIA 3HOVI 4NBBA 3ESWA 1WCMI 4A3KI 4Y52I 2P3YA 2JS4A 5C4JI 3HOWI 3GTPI 2JA6I 3S1MI 3HOZI 4NBEA 1Y1VS 1K83I 1QYPA 2DE7A 1R9TI 3H3VJ 4A3LI 1L1OC 4NOZA 5C44I 3I4MI 2F4OA 4NB9A 3Q87A 1I50I 4NBHA 1YUAA 2JNYA 3RZOI 3GKQA 4A3EI 4NBAA 4BY7I 2RBLA 3S14I 2JR6A 3EERA 5IP7I 2YU9I 4NBFA 2R7ZI 4Y7NI 4BBSI 1X3WA 4XX2A 1LQLA 3PO2I 4MH4A 3GTOI 3M3YI 3GTKI 3RZDI 2NVXI 3GTMI 3K7AI 1USPA
chains in the Genus database with same CATH superfamily
3IFUA 3HOUI 3CCQZ 2JMOA 2O4HA 3CCM1 2ZAEB 3PO3S 2HF1A 1YIT1 1USPB 3D9XA 1YHQ1 1P9NA 2PK7A 4A3II 1VQ6Z 2JA8I 1ZH1A 1TWHI 5T67A 3NH8A 2PMZA 1NJI2 2VUGA 4E2WA 3VMGA 2NAPA 1RLYA 4NBDA 2EGTA 3G4SZ 2NVYI 3D2LA 3I551 1VLAA 5FLXf 4A3CI 4QTUA 3S16I 2QREB 1TFIA 1TWAI 1VQN1 3J81b 3IR7A 5D1OB 4RVGA 1Q861 1Q821 3T4NB 3CCL1 3S1QI 2QA41 4E30A 3NDIA 4QTTA 3CC21 1YJ9Z 5IT9f 2K5RA 1W2BZ 3VMIA 1FDOA 1WCMI 1VQ7Z 3IF8A 2P3YA 2JS4A 4E32A 1KD11 1YITZ 3GTPI 1VQ81 2VPZA 3KIHA 3CCUZ 3CD61 1VQLZ 1R9TI 3CC7Z 3H3VJ 4A3LI 1YUKA 1L1OC 4NOZA 3NDJA 2F4OA 1VQK1 1I50I 1M1K1 2JNYA 3RZOI 3GKQA 3F3FC 2KI7B 1YJW1 2E9HA 2RBLA 4RVDA 5IP7I 1AA6A 2OTL1 2R7ZI 4HGZA 4Y7NI 2IZ4A 3CME1 1X3WA 4XX2A 4AYBA 3CCQ1 3GTOI 2QEX1 3GTKI 1Q7Y1 3P5JB 3GTMI 2YADA 5D1OA 4MXUA 1Q862 1Q822 3CCR1 1KRLA 1QVFZ 2GTHA 3I07A 4MRIA 5IP9I 4S1TA 2OOYB 2O53A 2VUMI 2VPWA 5IT9b 1NJI1 1TWFI 2JA7I 3U50C 3GTMS 1NUIA 3MONA 3LUSA 4X6AI 1YJN1 3CMAZ 2QRDB 2V8JA 3G711 3HOXI 3G4S1 1X3ZA 3NH5A 4A3MI 3I55Z 4RS4A 3CPWZ 2E2JI 1Q811 3VB9A 2J6AA 3CCS1 2B63I 1ZB8A 3CPWY 2Q4ZA 3CQZI 1RO2A 3CC4Z 1K9M1 4DGLA 1Q812 2E2II 1Y1VI 2G2KA 3S17I 1YI21 5C4XI 1SIWA 2GU2A 3S15I 4NBGA 2R93I 3CCMZ 4A3DI 2E2HI 2IZ3A 3OW2Z 1M1K2 1VQL1 2RT9A 2QRCB 4A3KI 2VPXA 1VQ9Z 2JIMA 2JA6I 2IV2X 1VQPZ 2W03A 2OTJZ 1QYPA 2Q51A 1VQ71 5C44I 2QLVB 4NH1C 1VQ41 1YIJ1 3Q87A 2AYDA 1NP6A 1K732 4A3EI 4NBAA 3CC71 1VQO1 2JR6A 4TNUA 3CCJZ 1VQMZ 2YU9I 1K9M2 2JIQA 2OOXB 1K8A2 3J81f 2E7ZA 1RO0A 2P28A 1QF8A 1Z02A 1LQLA 3PO2I 4MH4A 3CCLZ 3G6EZ 3JAMf 1YJ91 2JIOA 1RQFA 5C4JI 3K7AI 1USPA 4A3JI 2QR1B 3HOYI 1S721 3CCVZ 1N2FA 1VQNZ 3CCEZ 4A3FI 3CMA1 1WIIA 1VQ4Z 1YIJZ 1X0TA 1KQSY 5FLMI 2LFUA 2AKLA 3J80b 4E31A 1I6HI 1VQ91 1FDIA 3CCU1 3CD6Z 3VTNA 4MONA 3D6WA 2VF1A 2BJOA 2RHBA 1VQM1 3CCJ1 1KQSZ 4DQYB 2OTJ1 1Z01A 4BY1I 4BXXI 1N8R2 4E33A 1K731 1SFOI 1JWHC 2JA5I 2Y0SA 5CM2M 2KPIA 2NVQI 3S1NI 4RVFA 3GTLI 3EEDA 2R6MA 5LL6f 3I56Z 2R92I 4NB8A 4A93I 2WAQA 3CCE1 4NBCA 3BG0B 3GTJI 3TE5B 3JAMb 1VQ5Z 5A2Qb 3PO3I 3HKZA 3GTQI 1PFTA 3FKII 1I3QI 2K3RA 3GCFA 4BBRI 1S72Z 1YI2Z 3MZLB 4NBBA 1S7MA 1Q7Y2 3J80f 1YJNZ 4HH4A 3HOWI 3S1MI 3HOZI 1K83I 2DE7A 2OZKA 1VQ61 1WJ2A 2PM9A 3TDHB 2V8KA 4E2ZA 3I4MI 2VPYA 4NBHA 3NH4A 4DK1A 3CCSZ 1KC81 1QVGY 4BY7I 5FLXb 3MZKB 2I3CA 3G71Z 2LIYA 3KIFA 2WB1A 4BBSI 2RIQA 3M3YI 4E2YA 2NVXI 3F3PC 1VQ51 5A2Qf 1QXFA 1Z03A 3I4NI 1TWGI 3IX0A 2DE6A 3BG1B 3S2DI 3GTGI 3CXCY 2NVTI 2GTIA 2JIRA 2RPRA 4NFRA 1VQP1 1ML8A 1VQ8Z 1ZB9A 2QKDA 3QWUA 1Y8CA 3VMHA 1N8R1 3I561 2H85A 4MD8A 1JJ2Y 5C3EI 3CMEZ 1KC82 1RO4A 2JIPA 3S2HI 1VQKZ 2V8IA 5T64A 1KD12 1W2BY 1QVFY 2V3VA 2F4MA 4E2XA 4EWCA 4A3GI 4CL1A 1DL6A 3CXCZ 3J7A4 3CC2Z 3NFZA 4A3BI 1M901 1WW9A 3S1RI 1Y1WI 2DE5A 1QVGZ 2JUBA 4MD7A 1VQOZ 2HU9A 3H0GI 2V45A 1JJ2Z 4MD9A 3M4OI 2OTLZ 1TWCI 3HOVI 4HGYA 2QA4Z 3ESWA 2LEXA 5AN9F 3G6E1 4Y52I 4NBEA 1Y1VS 2M48A 3CCV1 3CCRZ 1Q16A 2W04A 4NB9A 3FQMA 1YUAA 4RV9A 5T6BA 1WZNA 2M6NA 1YHQZ 3S14I 3EERA 2QEXZ 3OW2Y 3FQQA 4NBFA 1K8A1 1YJWZ 3CC41 4RVHA 3RZDI 1M902 1RNIA 5D1PA
chains in the Genus database with same CATH topology
3IFUA 3HOUI 3CCQZ 2JMOA 2O4HA 3CCM1 2ZAEB 3PO3S 2HF1A 1YIT1 1USPB 3D9XA 1YHQ1 1P9NA 2PK7A 4A3II 1VQ6Z 2JA8I 1ZH1A 1TWHI 5T67A 3NH8A 2PMZA 1NJI2 2VUGA 4E2WA 3VMGA 1RLYA 4NBDA 2EGTA 3G4SZ 2NVYI 3I551 1VLAA 5FLXf 4A3CI 4QTUA 3S16I 2QREB 1TFIA 1TWAI 1VQN1 3J81b 5D1OB 4RVGA 1Q861 1Q821 3T4NB 3CCL1 3S1QI 2QA41 4E30A 3NDIA 4QTTA 3CC21 1YJ9Z 5IT9f 2K5RA 1W2BZ 3VMIA 1WCMI 1VQ7Z 3IF8A 2P3YA 2JS4A 4E32A 1KD11 1YITZ 3GTPI 1VQ81 3KIHA 3CCUZ 3CD61 1VQLZ 1R9TI 3CC7Z 3H3VJ 4A3LI 1YUKA 1L1OC 4NOZA 3NDJA 2F4OA 1VQK1 1I50I 1M1K1 2JNYA 3RZOI 3GKQA 3F3FC 2KI7B 1YJW1 2E9HA 2RBLA 4RVDA 5IP7I 2OTL1 2R7ZI 4HGZA 4Y7NI 2IZ4A 3CME1 1X3WA 4XX2A 4AYBA 3CCQ1 3GTOI 2QEX1 3GTKI 1Q7Y1 3P5JB 3GTMI 2YADA 5D1OA 4MXUA 1Q862 1Q822 3CCR1 1KRLA 1QVFZ 2GTHA 3I07A 4MRIA 5IP9I 4S1TA 2OOYB 2O53A 2VUMI 5IT9b 1NJI1 1TWFI 2JA7I 3U50C 3GTMS 1NUIA 3MONA 3LUSA 4X6AI 1YJN1 3CMAZ 2QRDB 2V8JA 3G711 3HOXI 3G4S1 1X3ZA 3NH5A 4A3MI 3I55Z 4RS4A 3CPWZ 2E2JI 1Q811 3VB9A 2J6AA 3CCS1 2B63I 1ZB8A 3CPWY 2Q4ZA 3CQZI 1RO2A 3CC4Z 1K9M1 4DGLA 1Q812 2E2II 1Y1VI 2G2KA 3S17I 1YI21 5C4XI 2GU2A 3S15I 4NBGA 2R93I 3CCMZ 4A3DI 2E2HI 2IZ3A 3OW2Z 1M1K2 1VQL1 2RT9A 2QRCB 4A3KI 1VQ9Z 2JA6I 1VQPZ 2W03A 2OTJZ 1QYPA 2Q51A 1VQ71 5C44I 2QLVB 4NH1C 1VQ41 1YIJ1 3Q87A 1NP6A 1K732 4A3EI 4NBAA 3CC71 1VQO1 2JR6A 4TNUA 3CCJZ 1VQMZ 2YU9I 1K9M2 2OOXB 1K8A2 3J81f 1RO0A 2P28A 1QF8A 1Z02A 1LQLA 3PO2I 4MH4A 3CCLZ 3G6EZ 3JAMf 1YJ91 1RQFA 5C4JI 3K7AI 1USPA 4A3JI 2QR1B 3HOYI 1S721 3CCVZ 1N2FA 1VQNZ 3CCEZ 4A3FI 3CMA1 1WIIA 1VQ4Z 1YIJZ 1X0TA 1KQSY 5FLMI 2LFUA 2AKLA 3J80b 4E31A 1I6HI 1VQ91 3CCU1 3CD6Z 3VTNA 4MONA 3D6WA 2VF1A 2BJOA 2RHBA 1VQM1 3CCJ1 1KQSZ 4DQYB 2OTJ1 1Z01A 4BY1I 4BXXI 1N8R2 4E33A 1K731 1SFOI 1JWHC 2JA5I 2Y0SA 5CM2M 2KPIA 2NVQI 3S1NI 4RVFA 3GTLI 3EEDA 2R6MA 5LL6f 3I56Z 2R92I 4NB8A 4A93I 2WAQA 3CCE1 4NBCA 3BG0B 3GTJI 3TE5B 3JAMb 1VQ5Z 5A2Qb 3PO3I 3HKZA 3GTQI 1PFTA 3FKII 1I3QI 2K3RA 3GCFA 4BBRI 1S72Z 1YI2Z 3MZLB 4NBBA 1S7MA 1Q7Y2 3J80f 1YJNZ 4HH4A 3HOWI 3S1MI 3HOZI 1K83I 2DE7A 2OZKA 1VQ61 2PM9A 3TDHB 2V8KA 4E2ZA 3I4MI 4NBHA 3NH4A 4DK1A 3CCSZ 1KC81 1QVGY 4BY7I 5FLXb 3MZKB 2I3CA 3G71Z 2LIYA 3KIFA 2WB1A 4BBSI 2RIQA 3M3YI 4E2YA 2NVXI 3F3PC 1VQ51 5A2Qf 1Z03A 3I4NI 1TWGI 3IX0A 2DE6A 3BG1B 3S2DI 3GTGI 3CXCY 2NVTI 2GTIA 2RPRA 4NFRA 1VQP1 1ML8A 1VQ8Z 1ZB9A 2QKDA 3QWUA 3VMHA 1N8R1 3I561 2H85A 4MD8A 1JJ2Y 5C3EI 3CMEZ 1KC82 1RO4A 3S2HI 1VQKZ 2V8IA 5T64A 1KD12 1W2BY 1QVFY 2F4MA 4E2XA 4EWCA 4A3GI 4CL1A 1DL6A 3CXCZ 3J7A4 3CC2Z 3NFZA 4A3BI 1M901 1WW9A 3S1RI 1Y1WI 2DE5A 1QVGZ 2JUBA 4MD7A 1VQOZ 2HU9A 3H0GI 1JJ2Z 4MD9A 3M4OI 2OTLZ 1TWCI 3HOVI 4HGYA 2QA4Z 3ESWA 5AN9F 3G6E1 4Y52I 4NBEA 1Y1VS 2M48A 3CCV1 3CCRZ 2W04A 4NB9A 3FQMA 1YUAA 4RV9A 5T6BA 2M6NA 1YHQZ 3S14I 3EERA 2QEXZ 3OW2Y 3FQQA 4NBFA 1K8A1 1YJWZ 3CC41 4RVHA 3RZDI 1M902 1RNIA 5D1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J I;  3I07 A;  3HOY I;  5IP9 I;  3I4N I;  1N2F A;  1TWG I;  3HOU I;  2VUM I;  2DE6 A;  3S2D I;  4A3F I;  3GTG I;  1TWF I;  2JA7 I;  3U50 C;  3GTM S;  2NVT I;  1NUI A;  3LUS A;  5FLM I;  4X6A I;  3PO3 S;  2AKL A;  1I6H I;  2HF1 A;  1USP B;  2PK7 A;  4A3I I;  3D6W A;  1ML8 A;  2BJO A;  3HOX I;  1ZB9 A;  1X3Z A;  4A3M I;  2JA8 I;  1TWH I;  3VMH A;  4BY1 I;  4BXX I;  2E2J I;  5C3E I;  1RO4 A;  1SFO I;  3VMG A;  3VB9 A;  2JA5 I;  3S2H I;  1RLY A;  5CM2 M;  2KPI A;  4NBD A;  2J6A A;  2F4M A;  2NVQ I;  3S1N I;  2NVY I;  1VLA A;  2B63 I;  1ZB8 A;  4A3C I;  4A3G I;  4QTU A;  3GTL I;  3S16 I;  2R92 I;  1DL6 A;  3CQZ I;  1TFI A;  1TWA I;  4NB8 A;  4A93 I;  4NBC A;  4A3B I;  3GTJ I;  2E2I I;  1WW9 A;  3S1R I;  1Y1V I;  3S17 I;  1Y1W I;  2DE5 A;  5C4X I;  3S1Q I;  4QTT A;  3H0G I;  3PO3 I;  3S15 I;  3GTQ I;  4NBG A;  2R93 I;  1PFT A;  3FKI I;  1I3Q I;  4A3D I;  4BBR I;  3GCF A;  2K5R A;  3M4O I;  2E2H I;  1TWC I;  3VMI A;  3HOV I;  4NBB A;  3ESW A;  1WCM I;  4A3K I;  4Y52 I;  2P3Y A;  2JS4 A;  5C4J I;  3HOW I;  3GTP I;  2JA6 I;  3S1M I;  3HOZ I;  4NBE A;  1Y1V S;  1K83 I;  1QYP A;  2DE7 A;  1R9T I;  3H3V J;  4A3L I;  1L1O C;  4NOZ A;  5C44 I;  3I4M I;  2F4O A;  4NB9 A;  3Q87 A;  1I50 I;  4NBH A;  1YUA A;  2JNY A;  3RZO I;  3GKQ A;  4A3E I;  4NBA A;  4BY7 I;  2RBL A;  3S14 I;  2JR6 A;  3EER A;  5IP7 I;  2YU9 I;  4NBF A;  2R7Z I;  4Y7N I;  4BBS I;  1X3W A;  4XX2 A;  1LQL A;  3PO2 I;  4MH4 A;  3GTO I;  3M3Y I;  3GTK I;  3RZD I;  2NVX I;  3GTM I;  3K7A I;  1USP A; 
#chains in the Genus database with same CATH topology
 3IFU A;  3HOU I;  3CCQ Z;  2JMO A;  2O4H A;  3CCM 1;  2ZAE B;  3PO3 S;  2HF1 A;  1YIT 1;  1USP B;  3D9X A;  1YHQ 1;  1P9N A;  2PK7 A;  4A3I I;  1VQ6 Z;  2JA8 I;  1ZH1 A;  1TWH I;  5T67 A;  3NH8 A;  2PMZ A;  1NJI 2;  2VUG A;  4E2W A;  3VMG A;  2NAP A;  1RLY A;  4NBD A;  2EGT A;  3G4S Z;  2NVY I;  3D2L A;  3I55 1;  1VLA A;  5FLX f;  4A3C I;  4QTU A;  3S16 I;  2QRE B;  1TFI A;  1TWA I;  1VQN 1;  3J81 b;  3IR7 A;  5D1O B;  4RVG A;  1Q86 1;  1Q82 1;  3T4N B;  3CCL 1;  3S1Q I;  2QA4 1;  4E30 A;  3NDI A;  4QTT A;  3CC2 1;  1YJ9 Z;  5IT9 f;  2K5R A;  1W2B Z;  3VMI A;  1FDO A;  1WCM I;  1VQ7 Z;  3IF8 A;  2P3Y A;  2JS4 A;  4E32 A;  1KD1 1;  1YIT Z;  3GTP I;  1VQ8 1;  2VPZ A;  3KIH A;  3CCU Z;  3CD6 1;  1VQL Z;  1R9T I;  3CC7 Z;  3H3V J;  4A3L I;  1YUK A;  1L1O C;  4NOZ A;  3NDJ A;  2F4O A;  1VQK 1;  1I50 I;  1M1K 1;  2JNY A;  3RZO I;  3GKQ A;  3F3F C;  2KI7 B;  1YJW 1;  2E9H A;  2RBL A;  4RVD A;  5IP7 I;  1AA6 A;  2OTL 1;  2R7Z I;  4HGZ A;  4Y7N I;  2IZ4 A;  3CME 1;  1X3W A;  4XX2 A;  4AYB A;  3CCQ 1;  3GTO I;  2QEX 1;  3GTK I;  1Q7Y 1;  3P5J B;  3GTM I;  2YAD A;  5D1O A;  4MXU A;  1Q86 2;  1Q82 2;  3CCR 1;  1KRL A;  1QVF Z;  2GTH A;  3I07 A;  4MRI A;  5IP9 I;  4S1T A;  2OOY B;  2O53 A;  2VUM I;  2VPW A;  5IT9 b;  1NJI 1;  1TWF I;  2JA7 I;  3U50 C;  3GTM S;  1NUI A;  3MON A;  3LUS A;  4X6A I;  1YJN 1;  3CMA Z;  2QRD B;  2V8J A;  3G71 1;  3HOX I;  3G4S 1;  1X3Z A;  3NH5 A;  4A3M I;  3I55 Z;  4RS4 A;  3CPW Z;  2E2J I;  1Q81 1;  3VB9 A;  2J6A A;  3CCS 1;  2B63 I;  1ZB8 A;  3CPW Y;  2Q4Z A;  3CQZ I;  1RO2 A;  3CC4 Z;  1K9M 1;  4DGL A;  1Q81 2;  2E2I I;  1Y1V I;  2G2K A;  3S17 I;  1YI2 1;  5C4X I;  1SIW A;  2GU2 A;  3S15 I;  4NBG A;  2R93 I;  3CCM Z;  4A3D I;  2E2H I;  2IZ3 A;  3OW2 Z;  1M1K 2;  1VQL 1;  2RT9 A;  2QRC B;  4A3K I;  2VPX A;  1VQ9 Z;  2JIM A;  2JA6 I;  2IV2 X;  1VQP Z;  2W03 A;  2OTJ Z;  1QYP A;  2Q51 A;  1VQ7 1;  5C44 I;  2QLV B;  4NH1 C;  1VQ4 1;  1YIJ 1;  3Q87 A;  2AYD A;  1NP6 A;  1K73 2;  4A3E I;  4NBA A;  3CC7 1;  1VQO 1;  2JR6 A;  4TNU A;  3CCJ Z;  1VQM Z;  2YU9 I;  1K9M 2;  2JIQ A;  2OOX B;  1K8A 2;  3J81 f;  2E7Z A;  1RO0 A;  2P28 A;  1QF8 A;  1Z02 A;  1LQL A;  3PO2 I;  4MH4 A;  3CCL Z;  3G6E Z;  3JAM f;  1YJ9 1;  2JIO A;  1RQF A;  5C4J I;  3K7A I;  1USP A;  4A3J I;  2QR1 B;  3HOY I;  1S72 1;  3CCV Z;  1N2F A;  1VQN Z;  3CCE Z;  4A3F I;  3CMA 1;  1WII A;  1VQ4 Z;  1YIJ Z;  1X0T A;  1KQS Y;  5FLM I;  2LFU A;  2AKL A;  3J80 b;  4E31 A;  1I6H I;  1VQ9 1;  1FDI A;  3CCU 1;  3CD6 Z;  3VTN A;  4MON A;  3D6W A;  2VF1 A;  2BJO A;  2RHB A;  1VQM 1;  3CCJ 1;  1KQS Z;  4DQY B;  2OTJ 1;  1Z01 A;  4BY1 I;  4BXX I;  1N8R 2;  4E33 A;  1K73 1;  1SFO I;  1JWH C;  2JA5 I;  2Y0S A;  5CM2 M;  2KPI A;  2NVQ I;  3S1N I;  4RVF A;  3GTL I;  3EED A;  2R6M A;  5LL6 f;  3I56 Z;  2R92 I;  4NB8 A;  4A93 I;  2WAQ A;  3CCE 1;  4NBC A;  3BG0 B;  3GTJ I;  3TE5 B;  3JAM b;  1VQ5 Z;  5A2Q b;  3PO3 I;  3HKZ A;  3GTQ I;  1PFT A;  3FKI I;  1I3Q I;  2K3R A;  3GCF A;  4BBR I;  1S72 Z;  1YI2 Z;  3MZL B;  4NBB A;  1S7M A;  1Q7Y 2;  3J80 f;  1YJN Z;  4HH4 A;  3HOW I;  3S1M I;  3HOZ I;  1K83 I;  2DE7 A;  2OZK A;  1VQ6 1;  1WJ2 A;  2PM9 A;  3TDH B;  2V8K A;  4E2Z A;  3I4M I;  2VPY A;  4NBH A;  3NH4 A;  4DK1 A;  3CCS Z;  1KC8 1;  1QVG Y;  4BY7 I;  5FLX b;  3MZK B;  2I3C A;  3G71 Z;  2LIY A;  3KIF A;  2WB1 A;  4BBS I;  2RIQ A;  3M3Y I;  4E2Y A;  2NVX I;  3F3P C;  1VQ5 1;  5A2Q f;  1QXF A;  1Z03 A;  3I4N I;  1TWG I;  3IX0 A;  2DE6 A;  3BG1 B;  3S2D I;  3GTG I;  3CXC Y;  2NVT I;  2GTI A;  2JIR A;  2RPR A;  4NFR A;  1VQP 1;  1ML8 A;  1VQ8 Z;  1ZB9 A;  2QKD A;  3QWU A;  1Y8C A;  3VMH A;  1N8R 1;  3I56 1;  2H85 A;  4MD8 A;  1JJ2 Y;  5C3E I;  3CME Z;  1KC8 2;  1RO4 A;  2JIP A;  3S2H I;  1VQK Z;  2V8I A;  5T64 A;  1KD1 2;  1W2B Y;  1QVF Y;  2V3V A;  2F4M A;  4E2X A;  4EWC A;  4A3G I;  4CL1 A;  1DL6 A;  3CXC Z;  3J7A 4;  3CC2 Z;  3NFZ A;  4A3B I;  1M90 1;  1WW9 A;  3S1R I;  1Y1W I;  2DE5 A;  1QVG Z;  2JUB A;  4MD7 A;  1VQO Z;  2HU9 A;  3H0G I;  2V45 A;  1JJ2 Z;  4MD9 A;  3M4O I;  2OTL Z;  1TWC I;  3HOV I;  4HGY A;  2QA4 Z;  3ESW A;  2LEX A;  5AN9 F;  3G6E 1;  4Y52 I;  4NBE A;  1Y1V S;  2M48 A;  3CCV 1;  3CCR Z;  1Q16 A;  2W04 A;  4NB9 A;  3FQM A;  1YUA A;  4RV9 A;  5T6B A;  1WZN A;  2M6N A;  1YHQ Z;  3S14 I;  3EER A;  2QEX Z;  3OW2 Y;  3FQQ A;  4NBF A;  1K8A 1;  1YJW Z;  3CC4 1;  4RVH A;  3RZD I;  1M90 2;  1RNI A;  5D1P A; 
#chains in the Genus database with same CATH homology
 3IFU A;  3HOU I;  3CCQ Z;  2JMO A;  2O4H A;  3CCM 1;  2ZAE B;  3PO3 S;  2HF1 A;  1YIT 1;  1USP B;  3D9X A;  1YHQ 1;  1P9N A;  2PK7 A;  4A3I I;  1VQ6 Z;  2JA8 I;  1ZH1 A;  1TWH I;  5T67 A;  3NH8 A;  2PMZ A;  1NJI 2;  2VUG A;  4E2W A;  3VMG A;  1RLY A;  4NBD A;  2EGT A;  3G4S Z;  2NVY I;  3I55 1;  1VLA A;  5FLX f;  4A3C I;  4QTU A;  3S16 I;  2QRE B;  1TFI A;  1TWA I;  1VQN 1;  3J81 b;  5D1O B;  4RVG A;  1Q86 1;  1Q82 1;  3T4N B;  3CCL 1;  3S1Q I;  2QA4 1;  4E30 A;  3NDI A;  4QTT A;  3CC2 1;  1YJ9 Z;  5IT9 f;  2K5R A;  1W2B Z;  3VMI A;  1WCM I;  1VQ7 Z;  3IF8 A;  2P3Y A;  2JS4 A;  4E32 A;  1KD1 1;  1YIT Z;  3GTP I;  1VQ8 1;  3KIH A;  3CCU Z;  3CD6 1;  1VQL Z;  1R9T I;  3CC7 Z;  3H3V J;  4A3L I;  1YUK A;  1L1O C;  4NOZ A;  3NDJ A;  2F4O A;  1VQK 1;  1I50 I;  1M1K 1;  2JNY A;  3RZO I;  3GKQ A;  3F3F C;  2KI7 B;  1YJW 1;  2E9H A;  2RBL A;  4RVD A;  5IP7 I;  2OTL 1;  2R7Z I;  4HGZ A;  4Y7N I;  2IZ4 A;  3CME 1;  1X3W A;  4XX2 A;  4AYB A;  3CCQ 1;  3GTO I;  2QEX 1;  3GTK I;  1Q7Y 1;  3P5J B;  3GTM I;  2YAD A;  5D1O A;  4MXU A;  1Q86 2;  1Q82 2;  3CCR 1;  1KRL A;  1QVF Z;  2GTH A;  3I07 A;  4MRI A;  5IP9 I;  4S1T A;  2OOY B;  2O53 A;  2VUM I;  5IT9 b;  1NJI 1;  1TWF I;  2JA7 I;  3U50 C;  3GTM S;  1NUI A;  3MON A;  3LUS A;  4X6A I;  1YJN 1;  3CMA Z;  2QRD B;  2V8J A;  3G71 1;  3HOX I;  3G4S 1;  1X3Z A;  3NH5 A;  4A3M I;  3I55 Z;  4RS4 A;  3CPW Z;  2E2J I;  1Q81 1;  3VB9 A;  2J6A A;  3CCS 1;  2B63 I;  1ZB8 A;  3CPW Y;  2Q4Z A;  3CQZ I;  1RO2 A;  3CC4 Z;  1K9M 1;  4DGL A;  1Q81 2;  2E2I I;  1Y1V I;  2G2K A;  3S17 I;  1YI2 1;  5C4X I;  2GU2 A;  3S15 I;  4NBG A;  2R93 I;  3CCM Z;  4A3D I;  2E2H I;  2IZ3 A;  3OW2 Z;  1M1K 2;  1VQL 1;  2RT9 A;  2QRC B;  4A3K I;  1VQ9 Z;  2JA6 I;  1VQP Z;  2W03 A;  2OTJ Z;  1QYP A;  2Q51 A;  1VQ7 1;  5C44 I;  2QLV B;  4NH1 C;  1VQ4 1;  1YIJ 1;  3Q87 A;  1NP6 A;  1K73 2;  4A3E I;  4NBA A;  3CC7 1;  1VQO 1;  2JR6 A;  4TNU A;  3CCJ Z;  1VQM Z;  2YU9 I;  1K9M 2;  2OOX B;  1K8A 2;  3J81 f;  1RO0 A;  2P28 A;  1QF8 A;  1Z02 A;  1LQL A;  3PO2 I;  4MH4 A;  3CCL Z;  3G6E Z;  3JAM f;  1YJ9 1;  1RQF A;  5C4J I;  3K7A I;  1USP A;  4A3J I;  2QR1 B;  3HOY I;  1S72 1;  3CCV Z;  1N2F A;  1VQN Z;  3CCE Z;  4A3F I;  3CMA 1;  1WII A;  1VQ4 Z;  1YIJ Z;  1X0T A;  1KQS Y;  5FLM I;  2LFU A;  2AKL A;  3J80 b;  4E31 A;  1I6H I;  1VQ9 1;  3CCU 1;  3CD6 Z;  3VTN A;  4MON A;  3D6W A;  2VF1 A;  2BJO A;  2RHB A;  1VQM 1;  3CCJ 1;  1KQS Z;  4DQY B;  2OTJ 1;  1Z01 A;  4BY1 I;  4BXX I;  1N8R 2;  4E33 A;  1K73 1;  1SFO I;  1JWH C;  2JA5 I;  2Y0S A;  5CM2 M;  2KPI A;  2NVQ I;  3S1N I;  4RVF A;  3GTL I;  3EED A;  2R6M A;  5LL6 f;  3I56 Z;  2R92 I;  4NB8 A;  4A93 I;  2WAQ A;  3CCE 1;  4NBC A;  3BG0 B;  3GTJ I;  3TE5 B;  3JAM b;  1VQ5 Z;  5A2Q b;  3PO3 I;  3HKZ A;  3GTQ I;  1PFT A;  3FKI I;  1I3Q I;  2K3R A;  3GCF A;  4BBR I;  1S72 Z;  1YI2 Z;  3MZL B;  4NBB A;  1S7M A;  1Q7Y 2;  3J80 f;  1YJN Z;  4HH4 A;  3HOW I;  3S1M I;  3HOZ I;  1K83 I;  2DE7 A;  2OZK A;  1VQ6 1;  2PM9 A;  3TDH B;  2V8K A;  4E2Z A;  3I4M I;  4NBH A;  3NH4 A;  4DK1 A;  3CCS Z;  1KC8 1;  1QVG Y;  4BY7 I;  5FLX b;  3MZK B;  2I3C A;  3G71 Z;  2LIY A;  3KIF A;  2WB1 A;  4BBS I;  2RIQ A;  3M3Y I;  4E2Y A;  2NVX I;  3F3P C;  1VQ5 1;  5A2Q f;  1Z03 A;  3I4N I;  1TWG I;  3IX0 A;  2DE6 A;  3BG1 B;  3S2D I;  3GTG I;  3CXC Y;  2NVT I;  2GTI A;  2RPR A;  4NFR A;  1VQP 1;  1ML8 A;  1VQ8 Z;  1ZB9 A;  2QKD A;  3QWU A;  3VMH A;  1N8R 1;  3I56 1;  2H85 A;  4MD8 A;  1JJ2 Y;  5C3E I;  3CME Z;  1KC8 2;  1RO4 A;  3S2H I;  1VQK Z;  2V8I A;  5T64 A;  1KD1 2;  1W2B Y;  1QVF Y;  2F4M A;  4E2X A;  4EWC A;  4A3G I;  4CL1 A;  1DL6 A;  3CXC Z;  3J7A 4;  3CC2 Z;  3NFZ A;  4A3B I;  1M90 1;  1WW9 A;  3S1R I;  1Y1W I;  2DE5 A;  1QVG Z;  2JUB A;  4MD7 A;  1VQO Z;  2HU9 A;  3H0G I;  1JJ2 Z;  4MD9 A;  3M4O I;  2OTL Z;  1TWC I;  3HOV I;  4HGY A;  2QA4 Z;  3ESW A;  5AN9 F;  3G6E 1;  4Y52 I;  4NBE A;  1Y1V S;  2M48 A;  3CCV 1;  3CCR Z;  2W04 A;  4NB9 A;  3FQM A;  1YUA A;  4RV9 A;  5T6B A;  2M6N A;  1YHQ Z;  3S14 I;  3EER A;  2QEX Z;  3OW2 Y;  3FQQ A;  4NBF A;  1K8A 1;  1YJW Z;  3CC4 1;  4RVH A;  3RZD I;  1M90 2;  1RNI A;  5D1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...