3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
2JR6A 4A3GI 4QTUA 4A3JI 3RZDI 2NVYI 1ZB8A 1RO4A 2E2II 2E2JI 3CQZI 2VUMI 1NUIA 3S2DI 3I4MI 3HOWI 3D6WA 3EERA 3GKQA 4BY7I 3FKII 4A3MI 1R9TI 2JS4A 1ML8A 2F4OA 2HF1A 2PK7A 1WW9A 3S1RI 1DL6A 4A3KI 4A3BI 1TWHI 3GTKI 1I6HI 5C44I 4A3LI 4NB8A 2JA8I 4BBRI 4NOZA 3GTGI 2AKLA 4BBSI 1Y1VS 3S16I 4NBGA 3S15I 1PFTA 4NBFA 1Y1WI 3I07A 5IP7I 4A3II 3VMIA 3HOVI 4A3DI 1TWCI 2NVTI 4BY1I 1TWGI 3HOUI 2KPIA 4A93I 3Q87A 3GTOI 2P3YA 5IP9I 3GTMI 1ZB9A 1SFOI 1QYPA 4NBEA 4A3CI 2JA5I 1RLYA 1YUAA 3VB9A 3S2HI 3GCFA 3M4OI 5C4XI 1TWAI 2YU9I 5C4JI 1USPA 1L1OC 4MH4A 1USPB 3GTMS 3HOXI 3U50C 3PO2I 1TFIA 3S1QI 3VMHA 3HOZI 1WCMI 1X3ZA 2R7ZI 5FLMI 1LQLA 5CM2M 3S1MI 4NBAA 2JA7I 2K5RA 2B63I 2F4MA 1X3WA 4A3EI 3S14I 3I4NI 1K83I 3GTJI 4A3FI 3GTLI 3PO3S 3S1NI 4NB9A 4XX2A 2BJOA 1VLAA 1I50I 2DE7A 3VMGA 1Y1VI 3H0GI 2JNYA 4NBDA 2RBLA 2R92I 4NBCA 1TWFI 3RZOI 2E2HI 3PO3I 4Y7NI 3GTQI 4X6AI 2DE6A 4BXXI 1N2FA 2DE5A 4NBHA 4QTTA 1I3QI 3LUSA 2J6AA 5C3EI 3H3VJ 2NVQI 3GTPI 2JA6I 4NBBA 3S17I 3ESWA 3M3YI 3HOYI 2R93I 2NVXI 3K7AI 4Y52I
chains in the Genus database with same CATH superfamily
2E7ZA 4QTUA 2NVYI 1YITZ 2YADA 4BY7I 4MD8A 3S1RI 2OOYB 4A3BI 1KD11 3QWUA 3EEDA 5C44I 2JIPA 3F3PC 4BBRI 3GTGI 1Y1VS 3CXCY 3S16I 5FLXb 2WAQA 4NBGA 3CCUZ 5IP7I 1FDOA 1VQ8Z 1VQ71 1VQ41 5IT9f 3G6EZ 3TDHB 5IP9I 3GTMI 5IT9b 1QYPA 2OTLZ 3MZKB 3M4OI 3NDJA 3CCVZ 1TWAI 1K731 1Q7Y2 1W2BZ 1L1OC 4MH4A 5T64A 3U50C 3FQMA 3PO2I 1YI2Z 4E32A 1WZNA 3CCQZ 2O4HA 2Y0SA 1KQSY 3MZLB 5CM2M 1NP6A 1Y8CA 2VF1A 2F4MA 1X3WA 4A3EI 3S14I 4A3FI 1YIT1 3I56Z 3S1NI 2GTIA 2OOXB 2JUBA 3CC21 1Y1VI 1N8R2 3VTNA 2JNYA 4NBDA 3RZOI 2V8KA 2E2HI 3NFZA 2QRDB 3G71Z 4Y7NI 4X6AI 3CCEZ 2DE6A 4NBHA 3NH8A 2QEXZ 3TE5B 2J6AA 3I561 1YHQZ 2NVQI 2E9HA 2OTJ1 3M3YI 4E2YA 3HOYI 2R93I 1S7MA 4E30A 2JR6A 4A3GI 3MONA 2ZAEB 3J7A4 1VQMZ 2E2JI 1NUIA 3GKQA 4NH1C 3OW2Z 1YJ9Z 2EGTA 3CMEZ 3FKII 2HU9A 2HF1A 1YJW1 1WW9A 1Z02A 3CC4Z 1DL6A 4A3KI 3GTKI 4E33A 4E2ZA 3G711 4DQYB 4NOZA 2V8IA 2AKLA 4BBSI 2OTL1 2LFUA 3S15I 4NFRA 1NJI2 1YHQ1 1YJN1 3I07A 1Y1WI 1VQ81 4MXUA 1AA6A 2NVTI 2OTJZ 4BY1I 2O53A 1TWGI 3HOUI 1VQNZ 3JAMf 3P5JB 1YJWZ 1ZB9A 2W04A 1SFOI 2QREB 1RLYA 1YUAA 2PMZA 3VB9A 3S2HI 1KQSZ 3CCM1 2OZKA 4RVHA 3CCU1 4RVFA 2JMOA 2QRCB 4S1TA 3S1MI 4AYBA 3NH5A 1JWHC 2V3VA 1QVFZ 2JIMA 2VPZA 5A2Qf 3HKZA 3FQQA 1K8A2 3J80f 1Q861 3CMAZ 2JIRA 1K9M1 3PO3S 4NB9A 2VUGA 1VQ4Z 1VQ5Z 1VLAA 2GTHA 2GU2A 4HH4A 4E2WA 2DE7A 1YI21 4CL1A 3NH4A 1JJ2Y 1VQ91 1Q812 3CCS1 1SIWA 1VQP1 1YUKA 5T6BA 4MRIA 3GTQI 3CME1 4BXXI 1QVFY 2W03A 4RVDA 4HGZA 1I3QI 3LUSA 1Q16A 4RV9A 3CCJ1 3GTPI 1VQLZ 3S17I 3J81b 1VQPZ 2NVXI 4Y52I 1NJI1 3J81f 3BG1B 4A3JI 3RZDI 1ZB8A 1RO4A 1WIIA 3CQZI 3S2DI 3I4MI 2VPYA 3EERA 1YJ91 2M48A 4A3MI 2QEX1 2JS4A 2F4OA 1Q7Y1 2PK7A 1KD12 2V45A 3OW2Y 3JAMb 2M6NA 3BG0B 1K8A1 2H85A 1RO2A 1M1K2 1KRLA 1PFTA 1YIJ1 3D2LA 2PM9A 4A3II 3VMIA 4MONA 1TWCI 2JIOA 4E31A 2QR1B 3F3FC 4A93I 3Q87A 2P3YA 3G6E1 1P9NA 1S72Z 3GCFA 5C4XI 5D1OA 1FDIA 5D1OB 1USPA 2AYDA 1USPB 3HOXI 1WCMI 1VQO1 5LL6f 1X3ZA 2R7ZI 2Q4ZA 1LQLA 1VQL1 4NBAA 1X0TA 1M901 2JA7I 1VQ6Z 4MD9A 2B63I 3IR7A 3NDIA 5FLXf 1YIJZ 2G2KA 1QVGY 4HGYA 1Q811 1QXFA 2BJOA 1I50I 2RPRA 3VMGA 1M902 1VQ9Z 2RBLA 2R92I 1S721 4NBCA 3PO3I 3CCMZ 1RNIA 3CPWZ 1M1K1 1VQ61 3J80b 2DE5A 2RHBA 1Z01A 5C3EI 1Q821 3H3VJ 2JA6I 4NBBA 3ESWA 3K7AI 1Z03A 3CCL1 5D1PA 3CXCZ 2E2II 1VQM1 2JIQA 2VUMI 5A2Qb 3KIHA 3I551 1VQK1 3HOWI 3IFUA 3D6WA 5T67A 1R9TI 1W2BY 1ML8A 2V8JA 3CC41 3G4S1 1TWHI 3IF8A 4RS4A 3CC71 2RT9A 3I55Z 2K3RA 3CPWY 1I6HI 4A3LI 3CCV1 2Q51A 4NB8A 2JA8I 3T4NB 3CCE1 2LIYA 2VPXA 4EWCA 3CMA1 4NBFA 4A3DI 3HOVI 3KIFA 3CC7Z 4RVGA 1VQN1 2KPIA 3GTOI 1RO0A 3IX0A 4NBEA 4A3CI 3G4SZ 2JA5I 2LEXA 1KC82 4E2XA 1Q822 2KI7B 1K9M2 4DK1A 1K732 2QKDA 2YU9I 5C4JI 2QLVB 2IZ4A 3CCR1 3CCRZ 2VPWA 1KC81 3GTMS 1TFIA 5AN9F 3VMHA 3CD61 3S1QI 2I3CA 3HOZI 1VQOZ 1WJ2A 3CC2Z 2R6MA 3CCJZ 5FLMI 2P28A 2RIQA 4MD7A 2K5RA 3CD6Z 1QVGZ 4TNUA 3I4NI 1K83I 3GTJI 3GTLI 1Q862 4DGLA 4XX2A 1YJNZ 2QA41 3D9XA 1VQ51 1N8R1 2WB1A 3H0GI 3CCQ1 3CCSZ 1TWFI 2IZ3A 2IV2X 1ZH1A 1N2FA 4QTTA 1JJ2Z 1VQKZ 1RQFA 1QF8A 2QA4Z 2NAPA 1VQ7Z 3CCLZ
chains in the Genus database with same CATH topology
4QTUA 2NVYI 1YITZ 2YADA 4BY7I 4MD8A 3S1RI 2OOYB 4A3BI 1KD11 3QWUA 3EEDA 5C44I 3F3PC 4BBRI 3GTGI 1Y1VS 3CXCY 3S16I 5FLXb 2WAQA 4NBGA 3CCUZ 5IP7I 1VQ8Z 1VQ71 1VQ41 5IT9f 3G6EZ 3TDHB 5IP9I 3GTMI 5IT9b 1QYPA 2OTLZ 3MZKB 3M4OI 3NDJA 3CCVZ 1TWAI 1K731 1Q7Y2 1W2BZ 1L1OC 4MH4A 5T64A 3U50C 3FQMA 3PO2I 1YI2Z 4E32A 3CCQZ 2O4HA 2Y0SA 1KQSY 3MZLB 5CM2M 1NP6A 2VF1A 2F4MA 1X3WA 4A3EI 3S14I 4A3FI 1YIT1 3I56Z 3S1NI 2GTIA 2OOXB 2JUBA 3CC21 1Y1VI 1N8R2 3VTNA 2JNYA 4NBDA 3RZOI 2V8KA 2E2HI 3NFZA 2QRDB 3G71Z 4Y7NI 4X6AI 3CCEZ 2DE6A 4NBHA 3NH8A 2QEXZ 3TE5B 2J6AA 3I561 1YHQZ 2NVQI 2E9HA 2OTJ1 3M3YI 4E2YA 3HOYI 2R93I 1S7MA 4E30A 2JR6A 4A3GI 3MONA 2ZAEB 3J7A4 1VQMZ 2E2JI 1NUIA 3GKQA 4NH1C 3OW2Z 1YJ9Z 2EGTA 3CMEZ 3FKII 2HU9A 2HF1A 1YJW1 1WW9A 1Z02A 3CC4Z 1DL6A 4A3KI 3GTKI 4E33A 4E2ZA 3G711 4DQYB 4NOZA 2V8IA 2AKLA 4BBSI 2OTL1 2LFUA 3S15I 4NFRA 1NJI2 1YHQ1 1YJN1 3I07A 1Y1WI 1VQ81 4MXUA 2NVTI 2OTJZ 4BY1I 2O53A 1TWGI 3HOUI 1VQNZ 3JAMf 3P5JB 1YJWZ 1ZB9A 2W04A 1SFOI 2QREB 1RLYA 1YUAA 2PMZA 3VB9A 3S2HI 1KQSZ 3CCM1 2OZKA 4RVHA 3CCU1 4RVFA 2JMOA 2QRCB 4S1TA 3S1MI 4AYBA 3NH5A 1JWHC 1QVFZ 5A2Qf 3HKZA 3FQQA 1K8A2 3J80f 1Q861 3CMAZ 1K9M1 3PO3S 4NB9A 2VUGA 1VQ4Z 1VQ5Z 1VLAA 2GTHA 2GU2A 4HH4A 1YI21 2DE7A 4E2WA 4CL1A 3NH4A 1JJ2Y 1VQ91 1Q812 3CCS1 1VQP1 1YUKA 5T6BA 4MRIA 3GTQI 3CME1 4BXXI 1QVFY 2W03A 4RVDA 4HGZA 1I3QI 3LUSA 4RV9A 3CCJ1 3GTPI 1VQLZ 3S17I 3J81b 1VQPZ 2NVXI 4Y52I 1NJI1 3J81f 3BG1B 4A3JI 3RZDI 1ZB8A 1RO4A 1WIIA 3CQZI 3S2DI 3I4MI 3EERA 1YJ91 2M48A 4A3MI 2QEX1 2JS4A 2F4OA 1Q7Y1 2PK7A 1KD12 3OW2Y 3JAMb 2M6NA 3BG0B 1K8A1 2H85A 1RO2A 1M1K2 1KRLA 1PFTA 1YIJ1 2PM9A 4A3II 3VMIA 4MONA 1TWCI 4E31A 2QR1B 3F3FC 4A93I 3Q87A 2P3YA 3G6E1 1P9NA 1S72Z 3GCFA 5C4XI 5D1OA 5D1OB 1USPA 1USPB 3HOXI 1WCMI 1VQO1 5LL6f 1X3ZA 2R7ZI 2Q4ZA 1LQLA 1VQL1 4NBAA 1X0TA 1M901 2JA7I 1VQ6Z 4MD9A 2B63I 3NDIA 5FLXf 1YIJZ 2G2KA 1QVGY 4HGYA 1Q811 2BJOA 1I50I 2RPRA 3VMGA 1M902 1VQ9Z 2RBLA 2R92I 1S721 4NBCA 3PO3I 3CCMZ 1RNIA 3CPWZ 1M1K1 1VQ61 3J80b 2DE5A 2RHBA 1Z01A 5C3EI 1Q821 3H3VJ 2JA6I 4NBBA 3ESWA 3K7AI 1Z03A 3CCL1 5D1PA 3CXCZ 2E2II 1VQM1 2VUMI 5A2Qb 3KIHA 3I551 1VQK1 3HOWI 3IFUA 3D6WA 5T67A 1R9TI 1W2BY 1ML8A 2V8JA 3CC41 3G4S1 1TWHI 3IF8A 4RS4A 3CC71 2RT9A 3I55Z 2K3RA 3CPWY 1I6HI 4A3LI 3CCV1 2Q51A 4NB8A 2JA8I 3T4NB 3CCE1 2LIYA 4EWCA 3CMA1 4NBFA 4A3DI 3HOVI 3KIFA 3CC7Z 4RVGA 1VQN1 2KPIA 3GTOI 1RO0A 3IX0A 4NBEA 4A3CI 3G4SZ 2JA5I 1KC82 4E2XA 1Q822 2KI7B 1K9M2 4DK1A 1K732 2QKDA 2YU9I 5C4JI 2QLVB 2IZ4A 3CCR1 3CCRZ 1KC81 3GTMS 1TFIA 5AN9F 3VMHA 3CD61 3S1QI 2I3CA 3HOZI 1VQOZ 3CC2Z 2R6MA 3CCJZ 5FLMI 2P28A 2RIQA 4MD7A 2K5RA 3CD6Z 1QVGZ 4TNUA 3I4NI 1K83I 3GTJI 3GTLI 1Q862 4DGLA 4XX2A 1YJNZ 2QA41 3D9XA 1VQ51 1N8R1 2WB1A 3H0GI 3CCQ1 3CCSZ 1TWFI 2IZ3A 1ZH1A 1N2FA 4QTTA 1JJ2Z 1VQKZ 1RQFA 1QF8A 2QA4Z 1VQ7Z 3CCLZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR6 A;  4A3G I;  4QTU A;  4A3J I;  3RZD I;  2NVY I;  1ZB8 A;  1RO4 A;  2E2I I;  2E2J I;  3CQZ I;  2VUM I;  1NUI A;  3S2D I;  3I4M I;  3HOW I;  3D6W A;  3EER A;  3GKQ A;  4BY7 I;  3FKI I;  4A3M I;  1R9T I;  2JS4 A;  1ML8 A;  2F4O A;  2HF1 A;  2PK7 A;  1WW9 A;  3S1R I;  1DL6 A;  4A3K I;  4A3B I;  1TWH I;  3GTK I;  1I6H I;  5C44 I;  4A3L I;  4NB8 A;  2JA8 I;  4BBR I;  4NOZ A;  3GTG I;  2AKL A;  4BBS I;  1Y1V S;  3S16 I;  4NBG A;  3S15 I;  1PFT A;  4NBF A;  1Y1W I;  3I07 A;  5IP7 I;  4A3I I;  3VMI A;  3HOV I;  4A3D I;  1TWC I;  2NVT I;  4BY1 I;  1TWG I;  3HOU I;  2KPI A;  4A93 I;  3Q87 A;  3GTO I;  2P3Y A;  5IP9 I;  3GTM I;  1ZB9 A;  1SFO I;  1QYP A;  4NBE A;  4A3C I;  2JA5 I;  1RLY A;  1YUA A;  3VB9 A;  3S2H I;  3GCF A;  3M4O I;  5C4X I;  1TWA I;  2YU9 I;  5C4J I;  1USP A;  1L1O C;  4MH4 A;  1USP B;  3GTM S;  3HOX I;  3U50 C;  3PO2 I;  1TFI A;  3S1Q I;  3VMH A;  3HOZ I;  1WCM I;  1X3Z A;  2R7Z I;  5FLM I;  1LQL A;  5CM2 M;  3S1M I;  4NBA A;  2JA7 I;  2K5R A;  2B63 I;  2F4M A;  1X3W A;  4A3E I;  3S14 I;  3I4N I;  1K83 I;  3GTJ I;  4A3F I;  3GTL I;  3PO3 S;  3S1N I;  4NB9 A;  4XX2 A;  2BJO A;  1VLA A;  1I50 I;  2DE7 A;  3VMG A;  1Y1V I;  3H0G I;  2JNY A;  4NBD A;  2RBL A;  2R92 I;  4NBC A;  1TWF I;  3RZO I;  2E2H I;  3PO3 I;  4Y7N I;  3GTQ I;  4X6A I;  2DE6 A;  4BXX I;  1N2F A;  2DE5 A;  4NBH A;  4QTT A;  1I3Q I;  3LUS A;  2J6A A;  5C3E I;  3H3V J;  2NVQ I;  3GTP I;  2JA6 I;  4NBB A;  3S17 I;  3ESW A;  3M3Y I;  3HOY I;  2R93 I;  2NVX I;  3K7A I;  4Y52 I; 
#chains in the Genus database with same CATH topology
 2E7Z A;  4QTU A;  2NVY I;  1YIT Z;  2YAD A;  4BY7 I;  4MD8 A;  3S1R I;  2OOY B;  4A3B I;  1KD1 1;  3QWU A;  3EED A;  5C44 I;  2JIP A;  3F3P C;  4BBR I;  3GTG I;  1Y1V S;  3CXC Y;  3S16 I;  5FLX b;  2WAQ A;  4NBG A;  3CCU Z;  5IP7 I;  1FDO A;  1VQ8 Z;  1VQ7 1;  1VQ4 1;  5IT9 f;  3G6E Z;  3TDH B;  5IP9 I;  3GTM I;  5IT9 b;  1QYP A;  2OTL Z;  3MZK B;  3M4O I;  3NDJ A;  3CCV Z;  1TWA I;  1K73 1;  1Q7Y 2;  1W2B Z;  1L1O C;  4MH4 A;  5T64 A;  3U50 C;  3FQM A;  3PO2 I;  1YI2 Z;  4E32 A;  1WZN A;  3CCQ Z;  2O4H A;  2Y0S A;  1KQS Y;  3MZL B;  5CM2 M;  1NP6 A;  1Y8C A;  2VF1 A;  2F4M A;  1X3W A;  4A3E I;  3S14 I;  4A3F I;  1YIT 1;  3I56 Z;  3S1N I;  2GTI A;  2OOX B;  2JUB A;  3CC2 1;  1Y1V I;  1N8R 2;  3VTN A;  2JNY A;  4NBD A;  3RZO I;  2V8K A;  2E2H I;  3NFZ A;  2QRD B;  3G71 Z;  4Y7N I;  4X6A I;  3CCE Z;  2DE6 A;  4NBH A;  3NH8 A;  2QEX Z;  3TE5 B;  2J6A A;  3I56 1;  1YHQ Z;  2NVQ I;  2E9H A;  2OTJ 1;  3M3Y I;  4E2Y A;  3HOY I;  2R93 I;  1S7M A;  4E30 A;  2JR6 A;  4A3G I;  3MON A;  2ZAE B;  3J7A 4;  1VQM Z;  2E2J I;  1NUI A;  3GKQ A;  4NH1 C;  3OW2 Z;  1YJ9 Z;  2EGT A;  3CME Z;  3FKI I;  2HU9 A;  2HF1 A;  1YJW 1;  1WW9 A;  1Z02 A;  3CC4 Z;  1DL6 A;  4A3K I;  3GTK I;  4E33 A;  4E2Z A;  3G71 1;  4DQY B;  4NOZ A;  2V8I A;  2AKL A;  4BBS I;  2OTL 1;  2LFU A;  3S15 I;  4NFR A;  1NJI 2;  1YHQ 1;  1YJN 1;  3I07 A;  1Y1W I;  1VQ8 1;  4MXU A;  1AA6 A;  2NVT I;  2OTJ Z;  4BY1 I;  2O53 A;  1TWG I;  3HOU I;  1VQN Z;  3JAM f;  3P5J B;  1YJW Z;  1ZB9 A;  2W04 A;  1SFO I;  2QRE B;  1RLY A;  1YUA A;  2PMZ A;  3VB9 A;  3S2H I;  1KQS Z;  3CCM 1;  2OZK A;  4RVH A;  3CCU 1;  4RVF A;  2JMO A;  2QRC B;  4S1T A;  3S1M I;  4AYB A;  3NH5 A;  1JWH C;  2V3V A;  1QVF Z;  2JIM A;  2VPZ A;  5A2Q f;  3HKZ A;  3FQQ A;  1K8A 2;  3J80 f;  1Q86 1;  3CMA Z;  2JIR A;  1K9M 1;  3PO3 S;  4NB9 A;  2VUG A;  1VQ4 Z;  1VQ5 Z;  1VLA A;  2GTH A;  2GU2 A;  4HH4 A;  4E2W A;  2DE7 A;  1YI2 1;  4CL1 A;  3NH4 A;  1JJ2 Y;  1VQ9 1;  1Q81 2;  3CCS 1;  1SIW A;  1VQP 1;  1YUK A;  5T6B A;  4MRI A;  3GTQ I;  3CME 1;  4BXX I;  1QVF Y;  2W03 A;  4RVD A;  4HGZ A;  1I3Q I;  3LUS A;  1Q16 A;  4RV9 A;  3CCJ 1;  3GTP I;  1VQL Z;  3S17 I;  3J81 b;  1VQP Z;  2NVX I;  4Y52 I;  1NJI 1;  3J81 f;  3BG1 B;  4A3J I;  3RZD I;  1ZB8 A;  1RO4 A;  1WII A;  3CQZ I;  3S2D I;  3I4M I;  2VPY A;  3EER A;  1YJ9 1;  2M48 A;  4A3M I;  2QEX 1;  2JS4 A;  2F4O A;  1Q7Y 1;  2PK7 A;  1KD1 2;  2V45 A;  3OW2 Y;  3JAM b;  2M6N A;  3BG0 B;  1K8A 1;  2H85 A;  1RO2 A;  1M1K 2;  1KRL A;  1PFT A;  1YIJ 1;  3D2L A;  2PM9 A;  4A3I I;  3VMI A;  4MON A;  1TWC I;  2JIO A;  4E31 A;  2QR1 B;  3F3F C;  4A93 I;  3Q87 A;  2P3Y A;  3G6E 1;  1P9N A;  1S72 Z;  3GCF A;  5C4X I;  5D1O A;  1FDI A;  5D1O B;  1USP A;  2AYD A;  1USP B;  3HOX I;  1WCM I;  1VQO 1;  5LL6 f;  1X3Z A;  2R7Z I;  2Q4Z A;  1LQL A;  1VQL 1;  4NBA A;  1X0T A;  1M90 1;  2JA7 I;  1VQ6 Z;  4MD9 A;  2B63 I;  3IR7 A;  3NDI A;  5FLX f;  1YIJ Z;  2G2K A;  1QVG Y;  4HGY A;  1Q81 1;  1QXF A;  2BJO A;  1I50 I;  2RPR A;  3VMG A;  1M90 2;  1VQ9 Z;  2RBL A;  2R92 I;  1S72 1;  4NBC A;  3PO3 I;  3CCM Z;  1RNI A;  3CPW Z;  1M1K 1;  1VQ6 1;  3J80 b;  2DE5 A;  2RHB A;  1Z01 A;  5C3E I;  1Q82 1;  3H3V J;  2JA6 I;  4NBB A;  3ESW A;  3K7A I;  1Z03 A;  3CCL 1;  5D1P A;  3CXC Z;  2E2I I;  1VQM 1;  2JIQ A;  2VUM I;  5A2Q b;  3KIH A;  3I55 1;  1VQK 1;  3HOW I;  3IFU A;  3D6W A;  5T67 A;  1R9T I;  1W2B Y;  1ML8 A;  2V8J A;  3CC4 1;  3G4S 1;  1TWH I;  3IF8 A;  4RS4 A;  3CC7 1;  2RT9 A;  3I55 Z;  2K3R A;  3CPW Y;  1I6H I;  4A3L I;  3CCV 1;  2Q51 A;  4NB8 A;  2JA8 I;  3T4N B;  3CCE 1;  2LIY A;  2VPX A;  4EWC A;  3CMA 1;  4NBF A;  4A3D I;  3HOV I;  3KIF A;  3CC7 Z;  4RVG A;  1VQN 1;  2KPI A;  3GTO I;  1RO0 A;  3IX0 A;  4NBE A;  4A3C I;  3G4S Z;  2JA5 I;  2LEX A;  1KC8 2;  4E2X A;  1Q82 2;  2KI7 B;  1K9M 2;  4DK1 A;  1K73 2;  2QKD A;  2YU9 I;  5C4J I;  2QLV B;  2IZ4 A;  3CCR 1;  3CCR Z;  2VPW A;  1KC8 1;  3GTM S;  1TFI A;  5AN9 F;  3VMH A;  3CD6 1;  3S1Q I;  2I3C A;  3HOZ I;  1VQO Z;  1WJ2 A;  3CC2 Z;  2R6M A;  3CCJ Z;  5FLM I;  2P28 A;  2RIQ A;  4MD7 A;  2K5R A;  3CD6 Z;  1QVG Z;  4TNU A;  3I4N I;  1K83 I;  3GTJ I;  3GTL I;  1Q86 2;  4DGL A;  4XX2 A;  1YJN Z;  2QA4 1;  3D9X A;  1VQ5 1;  1N8R 1;  2WB1 A;  3H0G I;  3CCQ 1;  3CCS Z;  1TWF I;  2IZ3 A;  2IV2 X;  1ZH1 A;  1N2F A;  4QTT A;  1JJ2 Z;  1VQK Z;  1RQF A;  1QF8 A;  2QA4 Z;  2NAP A;  1VQ7 Z;  3CCL Z; 
#chains in the Genus database with same CATH homology
 4QTU A;  2NVY I;  1YIT Z;  2YAD A;  4BY7 I;  4MD8 A;  3S1R I;  2OOY B;  4A3B I;  1KD1 1;  3QWU A;  3EED A;  5C44 I;  3F3P C;  4BBR I;  3GTG I;  1Y1V S;  3CXC Y;  3S16 I;  5FLX b;  2WAQ A;  4NBG A;  3CCU Z;  5IP7 I;  1VQ8 Z;  1VQ7 1;  1VQ4 1;  5IT9 f;  3G6E Z;  3TDH B;  5IP9 I;  3GTM I;  5IT9 b;  1QYP A;  2OTL Z;  3MZK B;  3M4O I;  3NDJ A;  3CCV Z;  1TWA I;  1K73 1;  1Q7Y 2;  1W2B Z;  1L1O C;  4MH4 A;  5T64 A;  3U50 C;  3FQM A;  3PO2 I;  1YI2 Z;  4E32 A;  3CCQ Z;  2O4H A;  2Y0S A;  1KQS Y;  3MZL B;  5CM2 M;  1NP6 A;  2VF1 A;  2F4M A;  1X3W A;  4A3E I;  3S14 I;  4A3F I;  1YIT 1;  3I56 Z;  3S1N I;  2GTI A;  2OOX B;  2JUB A;  3CC2 1;  1Y1V I;  1N8R 2;  3VTN A;  2JNY A;  4NBD A;  3RZO I;  2V8K A;  2E2H I;  3NFZ A;  2QRD B;  3G71 Z;  4Y7N I;  4X6A I;  3CCE Z;  2DE6 A;  4NBH A;  3NH8 A;  2QEX Z;  3TE5 B;  2J6A A;  3I56 1;  1YHQ Z;  2NVQ I;  2E9H A;  2OTJ 1;  3M3Y I;  4E2Y A;  3HOY I;  2R93 I;  1S7M A;  4E30 A;  2JR6 A;  4A3G I;  3MON A;  2ZAE B;  3J7A 4;  1VQM Z;  2E2J I;  1NUI A;  3GKQ A;  4NH1 C;  3OW2 Z;  1YJ9 Z;  2EGT A;  3CME Z;  3FKI I;  2HU9 A;  2HF1 A;  1YJW 1;  1WW9 A;  1Z02 A;  3CC4 Z;  1DL6 A;  4A3K I;  3GTK I;  4E33 A;  4E2Z A;  3G71 1;  4DQY B;  4NOZ A;  2V8I A;  2AKL A;  4BBS I;  2OTL 1;  2LFU A;  3S15 I;  4NFR A;  1NJI 2;  1YHQ 1;  1YJN 1;  3I07 A;  1Y1W I;  1VQ8 1;  4MXU A;  2NVT I;  2OTJ Z;  4BY1 I;  2O53 A;  1TWG I;  3HOU I;  1VQN Z;  3JAM f;  3P5J B;  1YJW Z;  1ZB9 A;  2W04 A;  1SFO I;  2QRE B;  1RLY A;  1YUA A;  2PMZ A;  3VB9 A;  3S2H I;  1KQS Z;  3CCM 1;  2OZK A;  4RVH A;  3CCU 1;  4RVF A;  2JMO A;  2QRC B;  4S1T A;  3S1M I;  4AYB A;  3NH5 A;  1JWH C;  1QVF Z;  5A2Q f;  3HKZ A;  3FQQ A;  1K8A 2;  3J80 f;  1Q86 1;  3CMA Z;  1K9M 1;  3PO3 S;  4NB9 A;  2VUG A;  1VQ4 Z;  1VQ5 Z;  1VLA A;  2GTH A;  2GU2 A;  4HH4 A;  1YI2 1;  2DE7 A;  4E2W A;  4CL1 A;  3NH4 A;  1JJ2 Y;  1VQ9 1;  1Q81 2;  3CCS 1;  1VQP 1;  1YUK A;  5T6B A;  4MRI A;  3GTQ I;  3CME 1;  4BXX I;  1QVF Y;  2W03 A;  4RVD A;  4HGZ A;  1I3Q I;  3LUS A;  4RV9 A;  3CCJ 1;  3GTP I;  1VQL Z;  3S17 I;  3J81 b;  1VQP Z;  2NVX I;  4Y52 I;  1NJI 1;  3J81 f;  3BG1 B;  4A3J I;  3RZD I;  1ZB8 A;  1RO4 A;  1WII A;  3CQZ I;  3S2D I;  3I4M I;  3EER A;  1YJ9 1;  2M48 A;  4A3M I;  2QEX 1;  2JS4 A;  2F4O A;  1Q7Y 1;  2PK7 A;  1KD1 2;  3OW2 Y;  3JAM b;  2M6N A;  3BG0 B;  1K8A 1;  2H85 A;  1RO2 A;  1M1K 2;  1KRL A;  1PFT A;  1YIJ 1;  2PM9 A;  4A3I I;  3VMI A;  4MON A;  1TWC I;  4E31 A;  2QR1 B;  3F3F C;  4A93 I;  3Q87 A;  2P3Y A;  3G6E 1;  1P9N A;  1S72 Z;  3GCF A;  5C4X I;  5D1O A;  5D1O B;  1USP A;  1USP B;  3HOX I;  1WCM I;  1VQO 1;  5LL6 f;  1X3Z A;  2R7Z I;  2Q4Z A;  1LQL A;  1VQL 1;  4NBA A;  1X0T A;  1M90 1;  2JA7 I;  1VQ6 Z;  4MD9 A;  2B63 I;  3NDI A;  5FLX f;  1YIJ Z;  2G2K A;  1QVG Y;  4HGY A;  1Q81 1;  2BJO A;  1I50 I;  2RPR A;  3VMG A;  1M90 2;  1VQ9 Z;  2RBL A;  2R92 I;  1S72 1;  4NBC A;  3PO3 I;  3CCM Z;  1RNI A;  3CPW Z;  1M1K 1;  1VQ6 1;  3J80 b;  2DE5 A;  2RHB A;  1Z01 A;  5C3E I;  1Q82 1;  3H3V J;  2JA6 I;  4NBB A;  3ESW A;  3K7A I;  1Z03 A;  3CCL 1;  5D1P A;  3CXC Z;  2E2I I;  1VQM 1;  2VUM I;  5A2Q b;  3KIH A;  3I55 1;  1VQK 1;  3HOW I;  3IFU A;  3D6W A;  5T67 A;  1R9T I;  1W2B Y;  1ML8 A;  2V8J A;  3CC4 1;  3G4S 1;  1TWH I;  3IF8 A;  4RS4 A;  3CC7 1;  2RT9 A;  3I55 Z;  2K3R A;  3CPW Y;  1I6H I;  4A3L I;  3CCV 1;  2Q51 A;  4NB8 A;  2JA8 I;  3T4N B;  3CCE 1;  2LIY A;  4EWC A;  3CMA 1;  4NBF A;  4A3D I;  3HOV I;  3KIF A;  3CC7 Z;  4RVG A;  1VQN 1;  2KPI A;  3GTO I;  1RO0 A;  3IX0 A;  4NBE A;  4A3C I;  3G4S Z;  2JA5 I;  1KC8 2;  4E2X A;  1Q82 2;  2KI7 B;  1K9M 2;  4DK1 A;  1K73 2;  2QKD A;  2YU9 I;  5C4J I;  2QLV B;  2IZ4 A;  3CCR 1;  3CCR Z;  1KC8 1;  3GTM S;  1TFI A;  5AN9 F;  3VMH A;  3CD6 1;  3S1Q I;  2I3C A;  3HOZ I;  1VQO Z;  3CC2 Z;  2R6M A;  3CCJ Z;  5FLM I;  2P28 A;  2RIQ A;  4MD7 A;  2K5R A;  3CD6 Z;  1QVG Z;  4TNU A;  3I4N I;  1K83 I;  3GTJ I;  3GTL I;  1Q86 2;  4DGL A;  4XX2 A;  1YJN Z;  2QA4 1;  3D9X A;  1VQ5 1;  1N8R 1;  2WB1 A;  3H0G I;  3CCQ 1;  3CCS Z;  1TWF I;  2IZ3 A;  1ZH1 A;  1N2F A;  4QTT A;  1JJ2 Z;  1VQK Z;  1RQF A;  1QF8 A;  2QA4 Z;  1VQ7 Z;  3CCL Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...