3S1MI

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI02
2E2HI 3CQZI 1TWHI 4QTTA 2PK7A 4A3DI 3GTMI 3PO3S 4A3GI 3VMIA 1SFOI 3VMHA 3GTLI 2R93I 5CM2M 4A3II 4A3CI 3I4NI 3GTPI 1TWCI 5IP9I 5IP7I 2B63I 3GTMS 3PO3I 3VB9A 1X3WA 3H0GI 1WW9A 3U50C 2AKLA 3EERA 4A3LI 2NVTI 1I50I 3I4MI 1PFTA 4NBAA 2JA6I 4NBFA 1X3ZA 3M3YI 1NUIA 1RO4A 2HF1A 1QYPA 2R7ZI 3S2DI 3PO2I 4A93I 3HOXI 4NBEA 5C4XI 3VMGA 2NVYI 3GTQI 2DE5A 4BY7I 1I6HI 4A3BI 4NBGA 4X6AI 2E2II 2JA7I 2JA8I 4MH4A 4A3EI 2E2JI 2JA5I 3HOUI 2JNYA 1YUAA 4Y7NI 2NVQI 3S16I 1Y1WI 5C4JI 4A3FI 3GTGI 3RZDI 1TFIA 1WCMI 2BJOA 3GKQA 1ZB9A 3S14I 2DE6A 1USPB 3ESWA 1TWGI 1DL6A 2J6AA 3Q87A 2F4OA 2K5RA 2RBLA 3HOVI 3GTKI 3HOYI 1Y1VS 4A3MI 1RLYA 1ZB8A 1USPA 3LUSA 3S1RI 3S1QI 3RZOI 4NBBA 3FKII 4NBCA 1Y1VI 2P3YA 3S1NI 2NVXI 1TWAI 3HOWI 1LQLA 4NBDA 3D6WA 2R92I 1L1OC 2JR6A 3I07A 4BY1I 2DE7A 4NB8A 3GTJI 3S1MI 2KPIA 1R9TI 1N2FA 5C44I 5C3EI 3GCFA 4NOZA 4Y52I 4NB9A 4QTUA 3S2HI 1ML8A 4A3JI 4A3KI 3S15I 2JS4A 3GTOI 1K83I 2YU9I 1VLAA 2VUMI 1I3QI 4NBHA 3HOZI 4BBSI 4BBRI 5FLMI 2F4MA 3M4OI 4BXXI 4XX2A 1TWFI 3H3VJ 3S17I 3K7AI
chains in the Genus database with same CATH superfamily
2OTLZ 5FLXf 4DK1A 1JWHC 2E2HI 1QVGY 4A3GI 3CCL1 3G711 3CME1 3CC2Z 2LFUA 3NH4A 1Q821 1TWCI 5IP7I 2B63I 3OW2Z 3GTMS 2QKDA 1VQOZ 3NFZA 1X3WA 3CC71 3H0GI 4DGLA 4A3LI 5LL6f 2NVTI 3F3FC 2JA6I 1RO4A 1YI21 3NDIA 1QXFA 2QA4Z 3PO2I 3S2DI 3IFUA 3HOXI 3J7A4 4S1TA 5T67A 2NVYI 3GTQI 1VQL1 2DE5A 1I6HI 3I56Z 4HGYA 4MH4A 2JA5I 3HOUI 2JNYA 1YUAA 4Y7NI 4HH4A 1Y1WI 1YJWZ 4A3FI 1K731 4RVGA 2BJOA 2GTHA 5FLXb 1FDIA 2VPZA 3S14I 2Q51A 3FQQA 4E2ZA 2RPRA 2E9HA 1YITZ 1ZH1A 1VQLZ 1NJI1 2LIYA 3TDHB 3I551 1Y1VS 1Q7Y2 1USPA 3LUSA 3RZOI 3BG0B 3FKII 4EWCA 3VTNA 4RV9A 2P3YA 3JAMb 1TWAI 2OTJZ 2W03A 2R6MA 3NDJA 1K9M1 3CC7Z 1L1OC 3CCVZ 3GTJI 3S1MI 3NH8A 2QR1B 2VUGA 3KIHA 1VQPZ 3GCFA 4NOZA 3J80b 4NB9A 4QTUA 4A3KI 3S15I 1RQFA 3GTOI 2YU9I 2G2KA 1Z01A 4BBSI 4NBHA 5FLMI 2F4MA 2RHBA 2EGTA 2W04A 4RS4A 3H3VJ 3K7AI 5D1PA 3CQZI 1TWHI 4QTTA 2PK7A 1JJ2Z 3G4S1 3PO3S 4DQYB 1N8R2 1K732 2KI7B 5IT9f 1VQ6Z 4A3II 3J81b 4MD7A 1QF8A 1VQK1 2V8KA 1VQM1 1Q812 4E2YA 2VF1A 2AKLA 3EERA 1QVFZ 3CXCY 3J81f 1KD12 1I50I 4NBFA 1X0TA 3M3YI 1YHQZ 1NUIA 1QYPA 2R7ZI 2LEXA 4NBEA 2VPYA 3D2LA 2JMOA 4BY7I 2VPXA 1VQKZ 3IF8A 4A3BI 2E2II 3EEDA 2JA7I 2JA8I 1VQO1 4E31A 2OOXB 4E33A 1N8R1 1TFIA 1WCMI 1VQ4Z 1ZB9A 2V8IA 1YUKA 3CCJ1 3G71Z 1YHQ1 1USPB 1TWGI 2IZ3A 3Q87A 2O53A 2JIRA 2OTL1 3MZKB 4A3MI 1RLYA 3J80f 3S1RI 1KD11 3S1QI 3CCU1 4HGZA 3S1NI 3CD61 4RVFA 1VQ61 3G4SZ 2O4HA 5D1OB 2R92I 2JR6A 1VQ7Z 3MONA 2KPIA 3MZLB 2I3CA 4A3JI 2JUBA 1WJ2A 1YIT1 1NJI2 4BBRI 3M4OI 3I561 1W2BY 1K9M2 4XX2A 1YJ9Z 1TWFI 3CCMZ 1Q7Y1 3CCLZ 3CD6Z 1P9NA 1Y8CA 1S721 2RIQA 1JJ2Y 1RO2A 1W2BZ 2GU2A 2R93I 1VQNZ 1QVFY 3T4NB 1VQMZ 3CCE1 3I4NI 3GTPI 3PO3I 5T6BA 1RO0A 3VB9A 3I55Z 2JIOA 3CCJZ 4E2WA 2QA41 1VQ41 2OZKA 4AYBA 2V3VA 1Q16A 2Y0SA 3KIFA 1PFTA 4NBAA 3I4MI 2QEX1 1Z02A 2NAPA 5C4XI 2JIPA 3CC4Z 1VQ51 4NBGA 4X6AI 3CXCZ 1YJN1 3D9XA 1VQP1 5AN9F 1VQN1 3S16I 2WAQA 1KC81 1VQ81 3GTGI 2QREB 2QRDB 3GKQA 5T64A 2VPWA 1DL6A 4MRIA 2AYDA 5D1OA 2WB1A 1KQSY 3HOVI 1FDOA 1K8A1 4NFRA 1VQ5Z 3CCS1 1KC82 3HOYI 4MD9A 2IV2X 4MONA 1ZB8A 5IT9b 3CCEZ 1Y1VI 3CPWY 3CMEZ 3CC21 3HOWI 2V45A 4E32A 4NBDA 3D6WA 1VQ8Z 1KRLA 4BY1I 2JIQA 4MXUA 3CCM1 3CMA1 5C3EI 3S2HI 2K3RA 1M901 1ML8A 2JS4A 1K83I 1I3QI 3CCRZ 4BXXI 1K8A2 2OTJ1 3CCSZ 4NH1C 4CL1A 4A3DI 4TNUA 2M6NA 3JAMf 3GTMI 1WIIA 3VMIA 3F3PC 1SFOI 3VMHA 2QRCB 3GTLI 2P28A 5CM2M 1KQSZ 4A3CI 2OOYB 5IP9I 1Q862 3TE5B 1WW9A 1Z03A 3U50C 1S7MA 1YJW1 1S72Z 4E2XA 2E7ZA 3BG1B 2M48A 1X3ZA 3CC41 2HF1A 2ZAEB 1YJ91 1YIJ1 3G6EZ 4A93I 1YI2Z 3VMGA 2Q4ZA 4RVDA 2PMZA 4A3EI 2E2JI 2NVQI 1M902 4RVHA 1Q861 2RT9A 5C4JI 3RZDI 2QLVB 3CPWZ 2HU9A 2DE6A 3P5JB 3ESWA 3CCV1 3NH5A 2J6AA 2IZ4A 2JIMA 2F4OA 1M1K1 2K5RA 2RBLA 1QVGZ 1VQ9Z 3IX0A 3GTKI 1YJNZ 1VQ91 4MD8A 3G6E1 3FQMA 3QWUA 4NBBA 3CMAZ 4NBCA 1Q822 2H85A 2NVXI 2PM9A 2GTIA 1RNIA 1LQLA 4E30A 1AA6A 3IR7A 3I07A 2QEXZ 3CCQ1 1WZNA 2DE7A 4NB8A 1R9TI 5A2Qb 1N2FA 5C44I 1Q811 4Y52I 3OW2Y 3CCR1 1SIWA 1VQ71 5A2Qf 1M1K2 3CCQZ 3CCUZ 1VLAA 2VUMI 3HOZI 3HKZA 2YADA 1YIJZ 2V8JA 1NP6A 3S17I
chains in the Genus database with same CATH topology
2OTLZ 5FLXf 4DK1A 1JWHC 2E2HI 1QVGY 4A3GI 3CCL1 3G711 3CME1 3CC2Z 2LFUA 3NH4A 1Q821 1TWCI 5IP7I 2B63I 3OW2Z 3GTMS 2QKDA 1VQOZ 3NFZA 1X3WA 3CC71 3H0GI 4DGLA 4A3LI 5LL6f 2NVTI 3F3FC 2JA6I 1RO4A 1YI21 3NDIA 3S2DI 2QA4Z 3PO2I 3IFUA 3HOXI 3J7A4 4S1TA 5T67A 2NVYI 3GTQI 1VQL1 2DE5A 1I6HI 3I56Z 4HGYA 4MH4A 2JA5I 3HOUI 2JNYA 1YUAA 4Y7NI 4HH4A 1Y1WI 1YJWZ 4A3FI 1K731 4RVGA 2BJOA 2GTHA 5FLXb 3S14I 2Q51A 3FQQA 4E2ZA 2RPRA 2E9HA 1YITZ 1ZH1A 1VQLZ 1NJI1 2LIYA 3TDHB 3I551 1Y1VS 1Q7Y2 1USPA 3LUSA 3RZOI 3BG0B 3FKII 4EWCA 3VTNA 4RV9A 2P3YA 3JAMb 1TWAI 2OTJZ 2W03A 2R6MA 3NDJA 1K9M1 3CC7Z 1L1OC 3CCVZ 3GTJI 3S1MI 3NH8A 2QR1B 2VUGA 3KIHA 1VQPZ 3GCFA 4NOZA 3J80b 4NB9A 4QTUA 4A3KI 3S15I 1RQFA 3GTOI 2YU9I 2G2KA 1Z01A 4BBSI 4NBHA 5FLMI 2F4MA 2RHBA 2EGTA 2W04A 4RS4A 3H3VJ 3K7AI 5D1PA 3CQZI 1TWHI 4QTTA 2PK7A 1JJ2Z 3G4S1 3PO3S 4DQYB 1N8R2 1K732 2KI7B 5IT9f 1VQ6Z 4A3II 3J81b 4MD7A 1QF8A 1VQK1 2V8KA 1VQM1 1Q812 4E2YA 2VF1A 2AKLA 3EERA 1QVFZ 3CXCY 3J81f 1KD12 1I50I 4NBFA 1X0TA 3M3YI 1YHQZ 1NUIA 1QYPA 2R7ZI 4NBEA 2JMOA 4BY7I 1VQKZ 3IF8A 4A3BI 2E2II 3EEDA 2JA7I 2JA8I 1VQO1 4E31A 2OOXB 4E33A 1N8R1 1TFIA 1WCMI 1VQ4Z 1ZB9A 2V8IA 1YUKA 3CCJ1 3G71Z 1YHQ1 1USPB 1TWGI 2IZ3A 3Q87A 2O53A 2OTL1 3MZKB 4A3MI 1RLYA 3J80f 3S1RI 1KD11 3S1QI 3CCU1 4HGZA 3S1NI 3CD61 4RVFA 1VQ61 3G4SZ 2O4HA 5D1OB 2R92I 2JR6A 1VQ7Z 3MONA 2KPIA 3MZLB 2I3CA 4A3JI 2JUBA 1YIT1 1NJI2 4BBRI 3M4OI 3I561 1W2BY 1K9M2 4XX2A 1YJ9Z 1TWFI 3CCMZ 1Q7Y1 3CCLZ 3CD6Z 1P9NA 1S721 2RIQA 1JJ2Y 1RO2A 1W2BZ 2GU2A 2R93I 1VQNZ 1QVFY 3T4NB 1VQMZ 3CCE1 3I4NI 3GTPI 3PO3I 5T6BA 1RO0A 3VB9A 3I55Z 3CCJZ 4E2WA 2QA41 1VQ41 2OZKA 4AYBA 3I4MI 2Y0SA 3KIFA 1PFTA 4NBAA 2QEX1 1Z02A 5C4XI 3CC4Z 1VQ51 4NBGA 4X6AI 3CXCZ 1YJN1 3D9XA 1VQP1 5AN9F 1VQN1 3S16I 2WAQA 1KC81 1VQ81 3GTGI 2QREB 2QRDB 3GKQA 5T64A 1DL6A 4MRIA 5D1OA 2WB1A 1KQSY 3HOVI 1K8A1 4NFRA 1VQ5Z 3CCS1 1KC82 3HOYI 4MD9A 4MONA 1ZB8A 5IT9b 3CCEZ 1Y1VI 3CPWY 3CMEZ 3CC21 3HOWI 4E32A 4NBDA 3D6WA 1KRLA 1VQ8Z 4BY1I 4MXUA 3CCM1 3CMA1 5C3EI 3S2HI 2K3RA 1M901 1ML8A 2JS4A 1K83I 1I3QI 3CCRZ 4BXXI 1K8A2 2OTJ1 3CCSZ 4NH1C 4CL1A 4A3DI 4TNUA 2M6NA 3JAMf 3GTMI 1WIIA 3VMIA 3F3PC 1SFOI 3VMHA 2QRCB 3GTLI 2P28A 5CM2M 1KQSZ 4A3CI 2OOYB 5IP9I 1Q862 3TE5B 1WW9A 1Z03A 3U50C 1S7MA 1YJW1 1S72Z 4E2XA 3BG1B 2M48A 1X3ZA 3CC41 2HF1A 2ZAEB 1YJ91 1YIJ1 3G6EZ 4A93I 1YI2Z 3VMGA 2Q4ZA 4RVDA 2PMZA 4A3EI 2E2JI 2NVQI 1M902 4RVHA 1Q861 2RT9A 5C4JI 3RZDI 2QLVB 3CPWZ 2HU9A 2DE6A 3P5JB 3ESWA 3CCV1 3NH5A 2J6AA 2IZ4A 2F4OA 1M1K1 2K5RA 2RBLA 1QVGZ 1VQ9Z 3IX0A 3GTKI 1YJNZ 1VQ91 4MD8A 3G6E1 3FQMA 3QWUA 4NBBA 3CMAZ 4NBCA 1Q822 2H85A 2NVXI 2PM9A 2GTIA 1RNIA 1LQLA 4E30A 3I07A 2QEXZ 3CCQ1 2DE7A 4NB8A 1R9TI 5A2Qb 1N2FA 5C44I 1Q811 4Y52I 3OW2Y 3CCR1 1VQ71 5A2Qf 1M1K2 3CCQZ 3CCUZ 1VLAA 2VUMI 3HOZI 3HKZA 2YADA 1YIJZ 2V8JA 1NP6A 3S17I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  3CQZ I;  1TWH I;  4QTT A;  2PK7 A;  4A3D I;  3GTM I;  3PO3 S;  4A3G I;  3VMI A;  1SFO I;  3VMH A;  3GTL I;  2R93 I;  5CM2 M;  4A3I I;  4A3C I;  3I4N I;  3GTP I;  1TWC I;  5IP9 I;  5IP7 I;  2B63 I;  3GTM S;  3PO3 I;  3VB9 A;  1X3W A;  3H0G I;  1WW9 A;  3U50 C;  2AKL A;  3EER A;  4A3L I;  2NVT I;  1I50 I;  3I4M I;  1PFT A;  4NBA A;  2JA6 I;  4NBF A;  1X3Z A;  3M3Y I;  1NUI A;  1RO4 A;  2HF1 A;  1QYP A;  2R7Z I;  3S2D I;  3PO2 I;  4A93 I;  3HOX I;  4NBE A;  5C4X I;  3VMG A;  2NVY I;  3GTQ I;  2DE5 A;  4BY7 I;  1I6H I;  4A3B I;  4NBG A;  4X6A I;  2E2I I;  2JA7 I;  2JA8 I;  4MH4 A;  4A3E I;  2E2J I;  2JA5 I;  3HOU I;  2JNY A;  1YUA A;  4Y7N I;  2NVQ I;  3S16 I;  1Y1W I;  5C4J I;  4A3F I;  3GTG I;  3RZD I;  1TFI A;  1WCM I;  2BJO A;  3GKQ A;  1ZB9 A;  3S14 I;  2DE6 A;  1USP B;  3ESW A;  1TWG I;  1DL6 A;  2J6A A;  3Q87 A;  2F4O A;  2K5R A;  2RBL A;  3HOV I;  3GTK I;  3HOY I;  1Y1V S;  4A3M I;  1RLY A;  1ZB8 A;  1USP A;  3LUS A;  3S1R I;  3S1Q I;  3RZO I;  4NBB A;  3FKI I;  4NBC A;  1Y1V I;  2P3Y A;  3S1N I;  2NVX I;  1TWA I;  3HOW I;  1LQL A;  4NBD A;  3D6W A;  2R92 I;  1L1O C;  2JR6 A;  3I07 A;  4BY1 I;  2DE7 A;  4NB8 A;  3GTJ I;  3S1M I;  2KPI A;  1R9T I;  1N2F A;  5C44 I;  5C3E I;  3GCF A;  4NOZ A;  4Y52 I;  4NB9 A;  4QTU A;  3S2H I;  1ML8 A;  4A3J I;  4A3K I;  3S15 I;  2JS4 A;  3GTO I;  1K83 I;  2YU9 I;  1VLA A;  2VUM I;  1I3Q I;  4NBH A;  3HOZ I;  4BBS I;  4BBR I;  5FLM I;  2F4M A;  3M4O I;  4BXX I;  4XX2 A;  1TWF I;  3H3V J;  3S17 I;  3K7A I; 
#chains in the Genus database with same CATH topology
 2OTL Z;  5FLX f;  4DK1 A;  1JWH C;  2E2H I;  1QVG Y;  4A3G I;  3CCL 1;  3G71 1;  3CME 1;  3CC2 Z;  2LFU A;  3NH4 A;  1Q82 1;  1TWC I;  5IP7 I;  2B63 I;  3OW2 Z;  3GTM S;  2QKD A;  1VQO Z;  3NFZ A;  1X3W A;  3CC7 1;  3H0G I;  4DGL A;  4A3L I;  5LL6 f;  2NVT I;  3F3F C;  2JA6 I;  1RO4 A;  1YI2 1;  3NDI A;  1QXF A;  2QA4 Z;  3PO2 I;  3S2D I;  3IFU A;  3HOX I;  3J7A 4;  4S1T A;  5T67 A;  2NVY I;  3GTQ I;  1VQL 1;  2DE5 A;  1I6H I;  3I56 Z;  4HGY A;  4MH4 A;  2JA5 I;  3HOU I;  2JNY A;  1YUA A;  4Y7N I;  4HH4 A;  1Y1W I;  1YJW Z;  4A3F I;  1K73 1;  4RVG A;  2BJO A;  2GTH A;  5FLX b;  1FDI A;  2VPZ A;  3S14 I;  2Q51 A;  3FQQ A;  4E2Z A;  2RPR A;  2E9H A;  1YIT Z;  1ZH1 A;  1VQL Z;  1NJI 1;  2LIY A;  3TDH B;  3I55 1;  1Y1V S;  1Q7Y 2;  1USP A;  3LUS A;  3RZO I;  3BG0 B;  3FKI I;  4EWC A;  3VTN A;  4RV9 A;  2P3Y A;  3JAM b;  1TWA I;  2OTJ Z;  2W03 A;  2R6M A;  3NDJ A;  1K9M 1;  3CC7 Z;  1L1O C;  3CCV Z;  3GTJ I;  3S1M I;  3NH8 A;  2QR1 B;  2VUG A;  3KIH A;  1VQP Z;  3GCF A;  4NOZ A;  3J80 b;  4NB9 A;  4QTU A;  4A3K I;  3S15 I;  1RQF A;  3GTO I;  2YU9 I;  2G2K A;  1Z01 A;  4BBS I;  4NBH A;  5FLM I;  2F4M A;  2RHB A;  2EGT A;  2W04 A;  4RS4 A;  3H3V J;  3K7A I;  5D1P A;  3CQZ I;  1TWH I;  4QTT A;  2PK7 A;  1JJ2 Z;  3G4S 1;  3PO3 S;  4DQY B;  1N8R 2;  1K73 2;  2KI7 B;  5IT9 f;  1VQ6 Z;  4A3I I;  3J81 b;  4MD7 A;  1QF8 A;  1VQK 1;  2V8K A;  1VQM 1;  1Q81 2;  4E2Y A;  2VF1 A;  2AKL A;  3EER A;  1QVF Z;  3CXC Y;  3J81 f;  1KD1 2;  1I50 I;  4NBF A;  1X0T A;  3M3Y I;  1YHQ Z;  1NUI A;  1QYP A;  2R7Z I;  2LEX A;  4NBE A;  2VPY A;  3D2L A;  2JMO A;  4BY7 I;  2VPX A;  1VQK Z;  3IF8 A;  4A3B I;  2E2I I;  3EED A;  2JA7 I;  2JA8 I;  1VQO 1;  4E31 A;  2OOX B;  4E33 A;  1N8R 1;  1TFI A;  1WCM I;  1VQ4 Z;  1ZB9 A;  2V8I A;  1YUK A;  3CCJ 1;  3G71 Z;  1YHQ 1;  1USP B;  1TWG I;  2IZ3 A;  3Q87 A;  2O53 A;  2JIR A;  2OTL 1;  3MZK B;  4A3M I;  1RLY A;  3J80 f;  3S1R I;  1KD1 1;  3S1Q I;  3CCU 1;  4HGZ A;  3S1N I;  3CD6 1;  4RVF A;  1VQ6 1;  3G4S Z;  2O4H A;  5D1O B;  2R92 I;  2JR6 A;  1VQ7 Z;  3MON A;  2KPI A;  3MZL B;  2I3C A;  4A3J I;  2JUB A;  1WJ2 A;  1YIT 1;  1NJI 2;  4BBR I;  3M4O I;  3I56 1;  1W2B Y;  1K9M 2;  4XX2 A;  1YJ9 Z;  1TWF I;  3CCM Z;  1Q7Y 1;  3CCL Z;  3CD6 Z;  1P9N A;  1Y8C A;  1S72 1;  2RIQ A;  1JJ2 Y;  1RO2 A;  1W2B Z;  2GU2 A;  2R93 I;  1VQN Z;  1QVF Y;  3T4N B;  1VQM Z;  3CCE 1;  3I4N I;  3GTP I;  3PO3 I;  5T6B A;  1RO0 A;  3VB9 A;  3I55 Z;  2JIO A;  3CCJ Z;  4E2W A;  2QA4 1;  1VQ4 1;  2OZK A;  4AYB A;  2V3V A;  1Q16 A;  2Y0S A;  3KIF A;  1PFT A;  4NBA A;  3I4M I;  2QEX 1;  1Z02 A;  2NAP A;  5C4X I;  2JIP A;  3CC4 Z;  1VQ5 1;  4NBG A;  4X6A I;  3CXC Z;  1YJN 1;  3D9X A;  1VQP 1;  5AN9 F;  1VQN 1;  3S16 I;  2WAQ A;  1KC8 1;  1VQ8 1;  3GTG I;  2QRE B;  2QRD B;  3GKQ A;  5T64 A;  2VPW A;  1DL6 A;  4MRI A;  2AYD A;  5D1O A;  2WB1 A;  1KQS Y;  3HOV I;  1FDO A;  1K8A 1;  4NFR A;  1VQ5 Z;  3CCS 1;  1KC8 2;  3HOY I;  4MD9 A;  2IV2 X;  4MON A;  1ZB8 A;  5IT9 b;  3CCE Z;  1Y1V I;  3CPW Y;  3CME Z;  3CC2 1;  3HOW I;  2V45 A;  4E32 A;  4NBD A;  3D6W A;  1VQ8 Z;  1KRL A;  4BY1 I;  2JIQ A;  4MXU A;  3CCM 1;  3CMA 1;  5C3E I;  3S2H I;  2K3R A;  1M90 1;  1ML8 A;  2JS4 A;  1K83 I;  1I3Q I;  3CCR Z;  4BXX I;  1K8A 2;  2OTJ 1;  3CCS Z;  4NH1 C;  4CL1 A;  4A3D I;  4TNU A;  2M6N A;  3JAM f;  3GTM I;  1WII A;  3VMI A;  3F3P C;  1SFO I;  3VMH A;  2QRC B;  3GTL I;  2P28 A;  5CM2 M;  1KQS Z;  4A3C I;  2OOY B;  5IP9 I;  1Q86 2;  3TE5 B;  1WW9 A;  1Z03 A;  3U50 C;  1S7M A;  1YJW 1;  1S72 Z;  4E2X A;  2E7Z A;  3BG1 B;  2M48 A;  1X3Z A;  3CC4 1;  2HF1 A;  2ZAE B;  1YJ9 1;  1YIJ 1;  3G6E Z;  4A93 I;  1YI2 Z;  3VMG A;  2Q4Z A;  4RVD A;  2PMZ A;  4A3E I;  2E2J I;  2NVQ I;  1M90 2;  4RVH A;  1Q86 1;  2RT9 A;  5C4J I;  3RZD I;  2QLV B;  3CPW Z;  2HU9 A;  2DE6 A;  3P5J B;  3ESW A;  3CCV 1;  3NH5 A;  2J6A A;  2IZ4 A;  2JIM A;  2F4O A;  1M1K 1;  2K5R A;  2RBL A;  1QVG Z;  1VQ9 Z;  3IX0 A;  3GTK I;  1YJN Z;  1VQ9 1;  4MD8 A;  3G6E 1;  3FQM A;  3QWU A;  4NBB A;  3CMA Z;  4NBC A;  1Q82 2;  2H85 A;  2NVX I;  2PM9 A;  2GTI A;  1RNI A;  1LQL A;  4E30 A;  1AA6 A;  3IR7 A;  3I07 A;  2QEX Z;  3CCQ 1;  1WZN A;  2DE7 A;  4NB8 A;  1R9T I;  5A2Q b;  1N2F A;  5C44 I;  1Q81 1;  4Y52 I;  3OW2 Y;  3CCR 1;  1SIW A;  1VQ7 1;  5A2Q f;  1M1K 2;  3CCQ Z;  3CCU Z;  1VLA A;  2VUM I;  3HOZ I;  3HKZ A;  2YAD A;  1YIJ Z;  2V8J A;  1NP6 A;  3S17 I; 
#chains in the Genus database with same CATH homology
 2OTL Z;  5FLX f;  4DK1 A;  1JWH C;  2E2H I;  1QVG Y;  4A3G I;  3CCL 1;  3G71 1;  3CME 1;  3CC2 Z;  2LFU A;  3NH4 A;  1Q82 1;  1TWC I;  5IP7 I;  2B63 I;  3OW2 Z;  3GTM S;  2QKD A;  1VQO Z;  3NFZ A;  1X3W A;  3CC7 1;  3H0G I;  4DGL A;  4A3L I;  5LL6 f;  2NVT I;  3F3F C;  2JA6 I;  1RO4 A;  1YI2 1;  3NDI A;  3S2D I;  2QA4 Z;  3PO2 I;  3IFU A;  3HOX I;  3J7A 4;  4S1T A;  5T67 A;  2NVY I;  3GTQ I;  1VQL 1;  2DE5 A;  1I6H I;  3I56 Z;  4HGY A;  4MH4 A;  2JA5 I;  3HOU I;  2JNY A;  1YUA A;  4Y7N I;  4HH4 A;  1Y1W I;  1YJW Z;  4A3F I;  1K73 1;  4RVG A;  2BJO A;  2GTH A;  5FLX b;  3S14 I;  2Q51 A;  3FQQ A;  4E2Z A;  2RPR A;  2E9H A;  1YIT Z;  1ZH1 A;  1VQL Z;  1NJI 1;  2LIY A;  3TDH B;  3I55 1;  1Y1V S;  1Q7Y 2;  1USP A;  3LUS A;  3RZO I;  3BG0 B;  3FKI I;  4EWC A;  3VTN A;  4RV9 A;  2P3Y A;  3JAM b;  1TWA I;  2OTJ Z;  2W03 A;  2R6M A;  3NDJ A;  1K9M 1;  3CC7 Z;  1L1O C;  3CCV Z;  3GTJ I;  3S1M I;  3NH8 A;  2QR1 B;  2VUG A;  3KIH A;  1VQP Z;  3GCF A;  4NOZ A;  3J80 b;  4NB9 A;  4QTU A;  4A3K I;  3S15 I;  1RQF A;  3GTO I;  2YU9 I;  2G2K A;  1Z01 A;  4BBS I;  4NBH A;  5FLM I;  2F4M A;  2RHB A;  2EGT A;  2W04 A;  4RS4 A;  3H3V J;  3K7A I;  5D1P A;  3CQZ I;  1TWH I;  4QTT A;  2PK7 A;  1JJ2 Z;  3G4S 1;  3PO3 S;  4DQY B;  1N8R 2;  1K73 2;  2KI7 B;  5IT9 f;  1VQ6 Z;  4A3I I;  3J81 b;  4MD7 A;  1QF8 A;  1VQK 1;  2V8K A;  1VQM 1;  1Q81 2;  4E2Y A;  2VF1 A;  2AKL A;  3EER A;  1QVF Z;  3CXC Y;  3J81 f;  1KD1 2;  1I50 I;  4NBF A;  1X0T A;  3M3Y I;  1YHQ Z;  1NUI A;  1QYP A;  2R7Z I;  4NBE A;  2JMO A;  4BY7 I;  1VQK Z;  3IF8 A;  4A3B I;  2E2I I;  3EED A;  2JA7 I;  2JA8 I;  1VQO 1;  4E31 A;  2OOX B;  4E33 A;  1N8R 1;  1TFI A;  1WCM I;  1VQ4 Z;  1ZB9 A;  2V8I A;  1YUK A;  3CCJ 1;  3G71 Z;  1YHQ 1;  1USP B;  1TWG I;  2IZ3 A;  3Q87 A;  2O53 A;  2OTL 1;  3MZK B;  4A3M I;  1RLY A;  3J80 f;  3S1R I;  1KD1 1;  3S1Q I;  3CCU 1;  4HGZ A;  3S1N I;  3CD6 1;  4RVF A;  1VQ6 1;  3G4S Z;  2O4H A;  5D1O B;  2R92 I;  2JR6 A;  1VQ7 Z;  3MON A;  2KPI A;  3MZL B;  2I3C A;  4A3J I;  2JUB A;  1YIT 1;  1NJI 2;  4BBR I;  3M4O I;  3I56 1;  1W2B Y;  1K9M 2;  4XX2 A;  1YJ9 Z;  1TWF I;  3CCM Z;  1Q7Y 1;  3CCL Z;  3CD6 Z;  1P9N A;  1S72 1;  2RIQ A;  1JJ2 Y;  1RO2 A;  1W2B Z;  2GU2 A;  2R93 I;  1VQN Z;  1QVF Y;  3T4N B;  1VQM Z;  3CCE 1;  3I4N I;  3GTP I;  3PO3 I;  5T6B A;  1RO0 A;  3VB9 A;  3I55 Z;  3CCJ Z;  4E2W A;  2QA4 1;  1VQ4 1;  2OZK A;  4AYB A;  3I4M I;  2Y0S A;  3KIF A;  1PFT A;  4NBA A;  2QEX 1;  1Z02 A;  5C4X I;  3CC4 Z;  1VQ5 1;  4NBG A;  4X6A I;  3CXC Z;  1YJN 1;  3D9X A;  1VQP 1;  5AN9 F;  1VQN 1;  3S16 I;  2WAQ A;  1KC8 1;  1VQ8 1;  3GTG I;  2QRE B;  2QRD B;  3GKQ A;  5T64 A;  1DL6 A;  4MRI A;  5D1O A;  2WB1 A;  1KQS Y;  3HOV I;  1K8A 1;  4NFR A;  1VQ5 Z;  3CCS 1;  1KC8 2;  3HOY I;  4MD9 A;  4MON A;  1ZB8 A;  5IT9 b;  3CCE Z;  1Y1V I;  3CPW Y;  3CME Z;  3CC2 1;  3HOW I;  4E32 A;  4NBD A;  3D6W A;  1KRL A;  1VQ8 Z;  4BY1 I;  4MXU A;  3CCM 1;  3CMA 1;  5C3E I;  3S2H I;  2K3R A;  1M90 1;  1ML8 A;  2JS4 A;  1K83 I;  1I3Q I;  3CCR Z;  4BXX I;  1K8A 2;  2OTJ 1;  3CCS Z;  4NH1 C;  4CL1 A;  4A3D I;  4TNU A;  2M6N A;  3JAM f;  3GTM I;  1WII A;  3VMI A;  3F3P C;  1SFO I;  3VMH A;  2QRC B;  3GTL I;  2P28 A;  5CM2 M;  1KQS Z;  4A3C I;  2OOY B;  5IP9 I;  1Q86 2;  3TE5 B;  1WW9 A;  1Z03 A;  3U50 C;  1S7M A;  1YJW 1;  1S72 Z;  4E2X A;  3BG1 B;  2M48 A;  1X3Z A;  3CC4 1;  2HF1 A;  2ZAE B;  1YJ9 1;  1YIJ 1;  3G6E Z;  4A93 I;  1YI2 Z;  3VMG A;  2Q4Z A;  4RVD A;  2PMZ A;  4A3E I;  2E2J I;  2NVQ I;  1M90 2;  4RVH A;  1Q86 1;  2RT9 A;  5C4J I;  3RZD I;  2QLV B;  3CPW Z;  2HU9 A;  2DE6 A;  3P5J B;  3ESW A;  3CCV 1;  3NH5 A;  2J6A A;  2IZ4 A;  2F4O A;  1M1K 1;  2K5R A;  2RBL A;  1QVG Z;  1VQ9 Z;  3IX0 A;  3GTK I;  1YJN Z;  1VQ9 1;  4MD8 A;  3G6E 1;  3FQM A;  3QWU A;  4NBB A;  3CMA Z;  4NBC A;  1Q82 2;  2H85 A;  2NVX I;  2PM9 A;  2GTI A;  1RNI A;  1LQL A;  4E30 A;  3I07 A;  2QEX Z;  3CCQ 1;  2DE7 A;  4NB8 A;  1R9T I;  5A2Q b;  1N2F A;  5C44 I;  1Q81 1;  4Y52 I;  3OW2 Y;  3CCR 1;  1VQ7 1;  5A2Q f;  1M1K 2;  3CCQ Z;  3CCU Z;  1VLA A;  2VUM I;  3HOZ I;  3HKZ A;  2YAD A;  1YIJ Z;  2V8J A;  1NP6 A;  3S17 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...