3S6BA

Crystal structure of methionine aminopeptidase 1b from plasmodium falciparum, pf10_0150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
345
structure length
345
Chain Sequence
HLKTIVKKHLSPENFDPTNRKYWVYDDHLKNFVNFKFTGDVRPWPLSKINHVPSHIERPDYAISSIPESELIYKRKSDIYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDVPKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNPTVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTKRTQDSPPLGFDTKDELYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase 1b from Plasmodium Falciparum, PF10_0150
rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 109
structure length 345
sequence length 345
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3s6bA01
1YJ3A 2GG0A 1JAWA 2GG7A 3BIPA 5D6FA 4RZYA 2GU7A 4S01A 2BHCA 1XGSA 5CE6A 5JI6A 1XGMA 1WL6A 1C27A 2ADUA 1Y1NA 1WL9A 4IECA 4RZZA 5CDEA 5FCFA 2EA4A 4FLLA 4IF7A 2NQ7A 2B3LA 1PV9A 1XGOA 1B6AA 4U6CA 3CB5A 4S2RP 4S2TP 4U71A 1KQ9A 4FKCA 4FLJA 1QXYA 1W7VA 1C23A 4U6EA 4PNCA 1CHMA 1O0XA 3CB6A 4IKUA 2Q94A 1KQ0A 2Q92A 2DFIA 2V3YA 4PV4A 4FLIA 2GU6A 3L24A 3MX6A 4A6VA 5CDLA 3D27A 2HOWA 4EGEA 3S6BA 3TB5A 4IU6A 3RORA 3PKEA 2GA2A 2BWSA 1YVMA 4S00A 5CDVA 4MATA 4U69A 4ZNGA 1N51A 2GG5A 2IW2A 1WBQA 2P99A 2V3ZA 4B28A 4U73A 1WN1A 4ZWOA 4ZWUA 2BWYA 1QZYA 1BOAA 5CNXA 1W2MA 3IG4A 4JUQA 4IPAA 3PKAA 2GGCA 4U6ZA 4IKSA 4RGZ1 3CTZA 4FUKA 2BWUA 2G6PA 2GG9A 2GU5A 2BWTA 1YW7A 3PKBA 3PKCA 3TAVA 4U1BA 1R5GA 4IKTA 5CLSA 1R58A 4FO8A 4IKRA 5JHUA 4R60A 2B3HA 3BITA 1C22A 5JFRA 2BN7A 2BWVA 3PKDA 4HXXA 4IDYA 1XGNA 2BWXA 2Q8KA 5D6EA 1A16A 2BHAA 2GU4A 2V3XA 3IU7A 1B59A 1XNZA 2GG2A 1QXZA 3Q6DA 5CIKA 1C24A 1YW9A 2GTXA 2BB7A 2Q95A 4U6WA 1WLRA 2GZ5A 3RVAA 2BWWA 2P9AA 3MATA 2OKNA 1YW8A 2B3KA 2Q96A 5E5BA 4ZWPA 5FCHA 2GGBA 4U6JA 1QXWA 4U70A 3MR1A 2EA2A 4FO7A 1BN5A 3FMQA 2EVCA 4QR8A 2GG3A 3FMRA 2P98A 2BHBA 3L7GA 1WKMA 2BH3A 3IU8A 2ZSGA 4OOKA 2MATA 2GG8A 1M35A 4A6WA 1KP0A 2NQ6A 4KM3A 1MATA 4Z7MA 2V6CA 1C21A 2EVOA 2OAZA 1WY2A 3FM3A 2BHDA 3BIQA 3IU9A 4FLKA 2Q93A 4U75A 1R5HA 4U76A 2EVMA
chains in the Genus database with same CATH superfamily
1YJ3A 2GG0A 1JAWA 2GG7A 3BIPA 5D6FA 4RZYA 2GU7A 4S01A 2BHCA 1XGSA 5CE6A 5JI6A 1XGMA 1WL6A 1C27A 2ADUA 1Y1NA 1WL9A 4IECA 4RZZA 5CDEA 5FCFA 2EA4A 4FLLA 4IF7A 2NQ7A 2B3LA 1PV9A 1XGOA 1B6AA 4U6CA 3CB5A 4S2RP 4S2TP 4U71A 1KQ9A 4FKCA 4FLJA 1QXYA 1W7VA 1C23A 4U6EA 4PNCA 1CHMA 1O0XA 3CB6A 4IKUA 2Q94A 1KQ0A 2Q92A 2DFIA 2V3YA 4PV4A 4FLIA 2GU6A 3L24A 3MX6A 4A6VA 5CDLA 3D27A 2HOWA 4EGEA 3S6BA 3TB5A 4IU6A 3RORA 3PKEA 2GA2A 2BWSA 1YVMA 4S00A 5CDVA 4MATA 4U69A 4ZNGA 1N51A 2GG5A 2IW2A 1WBQA 2P99A 2V3ZA 4B28A 4U73A 1WN1A 4ZWOA 4ZWUA 2BWYA 1QZYA 1BOAA 5CNXA 1W2MA 3IG4A 4JUQA 4IPAA 3PKAA 2GGCA 4U6ZA 4IKSA 4RGZ1 3CTZA 4FUKA 2BWUA 2G6PA 2GG9A 2GU5A 2BWTA 1YW7A 3PKBA 3PKCA 3TAVA 4U1BA 1R5GA 4IKTA 5CLSA 1R58A 4FO8A 4IKRA 5JHUA 4R60A 2B3HA 3BITA 1C22A 5JFRA 2BN7A 2BWVA 3PKDA 4HXXA 4IDYA 1XGNA 2BWXA 2Q8KA 5D6EA 1A16A 2BHAA 2GU4A 2V3XA 3IU7A 1B59A 1XNZA 2GG2A 1QXZA 3Q6DA 5CIKA 1C24A 1YW9A 2GTXA 2BB7A 2Q95A 4U6WA 1WLRA 2GZ5A 3RVAA 2BWWA 2P9AA 3MATA 2OKNA 1YW8A 2B3KA 2Q96A 5E5BA 4ZWPA 5FCHA 2GGBA 4U6JA 1QXWA 4U70A 3MR1A 2EA2A 4FO7A 1BN5A 3FMQA 2EVCA 4QR8A 2GG3A 3FMRA 2P98A 2BHBA 3L7GA 1WKMA 2BH3A 3IU8A 2ZSGA 4OOKA 2MATA 2GG8A 1M35A 4A6WA 1KP0A 2NQ6A 4KM3A 1MATA 4Z7MA 2V6CA 1C21A 2EVOA 2OAZA 1WY2A 3FM3A 2BHDA 3BIQA 3IU9A 4FLKA 2Q93A 4U75A 1R5HA 4U76A 2EVMA
chains in the Genus database with same CATH topology
1YJ3A 2GG0A 1JAWA 2GG7A 3BIPA 5D6FA 4RZYA 2GU7A 4S01A 2BHCA 1XGSA 5CE6A 5JI6A 1XGMA 1WL6A 1C27A 2ADUA 1Y1NA 1WL9A 4IECA 4RZZA 5CDEA 5FCFA 2EA4A 4FLLA 4IF7A 2NQ7A 2B3LA 1PV9A 1XGOA 1B6AA 4U6CA 3CB5A 4S2RP 4S2TP 4U71A 1KQ9A 4FKCA 4FLJA 1QXYA 1W7VA 1C23A 4U6EA 4PNCA 1CHMA 1O0XA 3CB6A 4IKUA 2Q94A 1KQ0A 2Q92A 2DFIA 2V3YA 4PV4A 4FLIA 2GU6A 3L24A 3MX6A 4A6VA 5CDLA 3D27A 2HOWA 4EGEA 3S6BA 3TB5A 4IU6A 3RORA 3PKEA 2GA2A 2BWSA 1YVMA 4S00A 5CDVA 4MATA 4U69A 4ZNGA 1N51A 2GG5A 2IW2A 1WBQA 2P99A 2V3ZA 4B28A 4U73A 1WN1A 4ZWOA 4ZWUA 2BWYA 1QZYA 1BOAA 5CNXA 1W2MA 3IG4A 4JUQA 4IPAA 3PKAA 2GGCA 4U6ZA 4IKSA 4RGZ1 3CTZA 4FUKA 2BWUA 2G6PA 2GG9A 2GU5A 2BWTA 1YW7A 3PKBA 3PKCA 3TAVA 4U1BA 1R5GA 4IKTA 5CLSA 1R58A 4FO8A 4IKRA 5JHUA 4R60A 2B3HA 3BITA 1C22A 5JFRA 2BN7A 2BWVA 3PKDA 4HXXA 4IDYA 1XGNA 2BWXA 2Q8KA 5D6EA 1A16A 2BHAA 2GU4A 2V3XA 3IU7A 1B59A 1XNZA 2GG2A 1QXZA 3Q6DA 5CIKA 1C24A 1YW9A 2GTXA 2BB7A 2Q95A 4U6WA 1WLRA 2GZ5A 3RVAA 2BWWA 2P9AA 3MATA 2OKNA 1YW8A 2B3KA 2Q96A 5E5BA 4ZWPA 5FCHA 2GGBA 4U6JA 1QXWA 4U70A 3MR1A 2EA2A 4FO7A 1BN5A 3FMQA 2EVCA 4QR8A 2GG3A 3FMRA 2P98A 2BHBA 3L7GA 1WKMA 2BH3A 3IU8A 2ZSGA 4OOKA 2MATA 2GG8A 1M35A 4A6WA 1KP0A 2NQ6A 4KM3A 1MATA 4Z7MA 2V6CA 1C21A 2EVOA 2OAZA 1WY2A 3FM3A 2BHDA 3BIQA 3IU9A 4FLKA 2Q93A 4U75A 1R5HA 4U76A 2EVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  2GG0 A;  1JAW A;  2GG7 A;  3BIP A;  5D6F A;  4RZY A;  2GU7 A;  4S01 A;  2BHC A;  1XGS A;  5CE6 A;  5JI6 A;  1XGM A;  1WL6 A;  1C27 A;  2ADU A;  1Y1N A;  1WL9 A;  4IEC A;  4RZZ A;  5CDE A;  5FCF A;  2EA4 A;  4FLL A;  4IF7 A;  2NQ7 A;  2B3L A;  1PV9 A;  1XGO A;  1B6A A;  4U6C A;  3CB5 A;  4S2R P;  4S2T P;  4U71 A;  1KQ9 A;  4FKC A;  4FLJ A;  1QXY A;  1W7V A;  1C23 A;  4U6E A;  4PNC A;  1CHM A;  1O0X A;  3CB6 A;  4IKU A;  2Q94 A;  1KQ0 A;  2Q92 A;  2DFI A;  2V3Y A;  4PV4 A;  4FLI A;  2GU6 A;  3L24 A;  3MX6 A;  4A6V A;  5CDL A;  3D27 A;  2HOW A;  4EGE A;  3S6B A;  3TB5 A;  4IU6 A;  3ROR A;  3PKE A;  2GA2 A;  2BWS A;  1YVM A;  4S00 A;  5CDV A;  4MAT A;  4U69 A;  4ZNG A;  1N51 A;  2GG5 A;  2IW2 A;  1WBQ A;  2P99 A;  2V3Z A;  4B28 A;  4U73 A;  1WN1 A;  4ZWO A;  4ZWU A;  2BWY A;  1QZY A;  1BOA A;  5CNX A;  1W2M A;  3IG4 A;  4JUQ A;  4IPA A;  3PKA A;  2GGC A;  4U6Z A;  4IKS A;  4RGZ 1;  3CTZ A;  4FUK A;  2BWU A;  2G6P A;  2GG9 A;  2GU5 A;  2BWT A;  1YW7 A;  3PKB A;  3PKC A;  3TAV A;  4U1B A;  1R5G A;  4IKT A;  5CLS A;  1R58 A;  4FO8 A;  4IKR A;  5JHU A;  4R60 A;  2B3H A;  3BIT A;  1C22 A;  5JFR A;  2BN7 A;  2BWV A;  3PKD A;  4HXX A;  4IDY A;  1XGN A;  2BWX A;  2Q8K A;  5D6E A;  1A16 A;  2BHA A;  2GU4 A;  2V3X A;  3IU7 A;  1B59 A;  1XNZ A;  2GG2 A;  1QXZ A;  3Q6D A;  5CIK A;  1C24 A;  1YW9 A;  2GTX A;  2BB7 A;  2Q95 A;  4U6W A;  1WLR A;  2GZ5 A;  3RVA A;  2BWW A;  2P9A A;  3MAT A;  2OKN A;  1YW8 A;  2B3K A;  2Q96 A;  5E5B A;  4ZWP A;  5FCH A;  2GGB A;  4U6J A;  1QXW A;  4U70 A;  3MR1 A;  2EA2 A;  4FO7 A;  1BN5 A;  3FMQ A;  2EVC A;  4QR8 A;  2GG3 A;  3FMR A;  2P98 A;  2BHB A;  3L7G A;  1WKM A;  2BH3 A;  3IU8 A;  2ZSG A;  4OOK A;  2MAT A;  2GG8 A;  1M35 A;  4A6W A;  1KP0 A;  2NQ6 A;  4KM3 A;  1MAT A;  4Z7M A;  2V6C A;  1C21 A;  2EVO A;  2OAZ A;  1WY2 A;  3FM3 A;  2BHD A;  3BIQ A;  3IU9 A;  4FLK A;  2Q93 A;  4U75 A;  1R5H A;  4U76 A;  2EVM A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  2GG0 A;  1JAW A;  2GG7 A;  3BIP A;  5D6F A;  4RZY A;  2GU7 A;  4S01 A;  2BHC A;  1XGS A;  5CE6 A;  5JI6 A;  1XGM A;  1WL6 A;  1C27 A;  2ADU A;  1Y1N A;  1WL9 A;  4IEC A;  4RZZ A;  5CDE A;  5FCF A;  2EA4 A;  4FLL A;  4IF7 A;  2NQ7 A;  2B3L A;  1PV9 A;  1XGO A;  1B6A A;  4U6C A;  3CB5 A;  4S2R P;  4S2T P;  4U71 A;  1KQ9 A;  4FKC A;  4FLJ A;  1QXY A;  1W7V A;  1C23 A;  4U6E A;  4PNC A;  1CHM A;  1O0X A;  3CB6 A;  4IKU A;  2Q94 A;  1KQ0 A;  2Q92 A;  2DFI A;  2V3Y A;  4PV4 A;  4FLI A;  2GU6 A;  3L24 A;  3MX6 A;  4A6V A;  5CDL A;  3D27 A;  2HOW A;  4EGE A;  3S6B A;  3TB5 A;  4IU6 A;  3ROR A;  3PKE A;  2GA2 A;  2BWS A;  1YVM A;  4S00 A;  5CDV A;  4MAT A;  4U69 A;  4ZNG A;  1N51 A;  2GG5 A;  2IW2 A;  1WBQ A;  2P99 A;  2V3Z A;  4B28 A;  4U73 A;  1WN1 A;  4ZWO A;  4ZWU A;  2BWY A;  1QZY A;  1BOA A;  5CNX A;  1W2M A;  3IG4 A;  4JUQ A;  4IPA A;  3PKA A;  2GGC A;  4U6Z A;  4IKS A;  4RGZ 1;  3CTZ A;  4FUK A;  2BWU A;  2G6P A;  2GG9 A;  2GU5 A;  2BWT A;  1YW7 A;  3PKB A;  3PKC A;  3TAV A;  4U1B A;  1R5G A;  4IKT A;  5CLS A;  1R58 A;  4FO8 A;  4IKR A;  5JHU A;  4R60 A;  2B3H A;  3BIT A;  1C22 A;  5JFR A;  2BN7 A;  2BWV A;  3PKD A;  4HXX A;  4IDY A;  1XGN A;  2BWX A;  2Q8K A;  5D6E A;  1A16 A;  2BHA A;  2GU4 A;  2V3X A;  3IU7 A;  1B59 A;  1XNZ A;  2GG2 A;  1QXZ A;  3Q6D A;  5CIK A;  1C24 A;  1YW9 A;  2GTX A;  2BB7 A;  2Q95 A;  4U6W A;  1WLR A;  2GZ5 A;  3RVA A;  2BWW A;  2P9A A;  3MAT A;  2OKN A;  1YW8 A;  2B3K A;  2Q96 A;  5E5B A;  4ZWP A;  5FCH A;  2GGB A;  4U6J A;  1QXW A;  4U70 A;  3MR1 A;  2EA2 A;  4FO7 A;  1BN5 A;  3FMQ A;  2EVC A;  4QR8 A;  2GG3 A;  3FMR A;  2P98 A;  2BHB A;  3L7G A;  1WKM A;  2BH3 A;  3IU8 A;  2ZSG A;  4OOK A;  2MAT A;  2GG8 A;  1M35 A;  4A6W A;  1KP0 A;  2NQ6 A;  4KM3 A;  1MAT A;  4Z7M A;  2V6C A;  1C21 A;  2EVO A;  2OAZ A;  1WY2 A;  3FM3 A;  2BHD A;  3BIQ A;  3IU9 A;  4FLK A;  2Q93 A;  4U75 A;  1R5H A;  4U76 A;  2EVM A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  2GG0 A;  1JAW A;  2GG7 A;  3BIP A;  5D6F A;  4RZY A;  2GU7 A;  4S01 A;  2BHC A;  1XGS A;  5CE6 A;  5JI6 A;  1XGM A;  1WL6 A;  1C27 A;  2ADU A;  1Y1N A;  1WL9 A;  4IEC A;  4RZZ A;  5CDE A;  5FCF A;  2EA4 A;  4FLL A;  4IF7 A;  2NQ7 A;  2B3L A;  1PV9 A;  1XGO A;  1B6A A;  4U6C A;  3CB5 A;  4S2R P;  4S2T P;  4U71 A;  1KQ9 A;  4FKC A;  4FLJ A;  1QXY A;  1W7V A;  1C23 A;  4U6E A;  4PNC A;  1CHM A;  1O0X A;  3CB6 A;  4IKU A;  2Q94 A;  1KQ0 A;  2Q92 A;  2DFI A;  2V3Y A;  4PV4 A;  4FLI A;  2GU6 A;  3L24 A;  3MX6 A;  4A6V A;  5CDL A;  3D27 A;  2HOW A;  4EGE A;  3S6B A;  3TB5 A;  4IU6 A;  3ROR A;  3PKE A;  2GA2 A;  2BWS A;  1YVM A;  4S00 A;  5CDV A;  4MAT A;  4U69 A;  4ZNG A;  1N51 A;  2GG5 A;  2IW2 A;  1WBQ A;  2P99 A;  2V3Z A;  4B28 A;  4U73 A;  1WN1 A;  4ZWO A;  4ZWU A;  2BWY A;  1QZY A;  1BOA A;  5CNX A;  1W2M A;  3IG4 A;  4JUQ A;  4IPA A;  3PKA A;  2GGC A;  4U6Z A;  4IKS A;  4RGZ 1;  3CTZ A;  4FUK A;  2BWU A;  2G6P A;  2GG9 A;  2GU5 A;  2BWT A;  1YW7 A;  3PKB A;  3PKC A;  3TAV A;  4U1B A;  1R5G A;  4IKT A;  5CLS A;  1R58 A;  4FO8 A;  4IKR A;  5JHU A;  4R60 A;  2B3H A;  3BIT A;  1C22 A;  5JFR A;  2BN7 A;  2BWV A;  3PKD A;  4HXX A;  4IDY A;  1XGN A;  2BWX A;  2Q8K A;  5D6E A;  1A16 A;  2BHA A;  2GU4 A;  2V3X A;  3IU7 A;  1B59 A;  1XNZ A;  2GG2 A;  1QXZ A;  3Q6D A;  5CIK A;  1C24 A;  1YW9 A;  2GTX A;  2BB7 A;  2Q95 A;  4U6W A;  1WLR A;  2GZ5 A;  3RVA A;  2BWW A;  2P9A A;  3MAT A;  2OKN A;  1YW8 A;  2B3K A;  2Q96 A;  5E5B A;  4ZWP A;  5FCH A;  2GGB A;  4U6J A;  1QXW A;  4U70 A;  3MR1 A;  2EA2 A;  4FO7 A;  1BN5 A;  3FMQ A;  2EVC A;  4QR8 A;  2GG3 A;  3FMR A;  2P98 A;  2BHB A;  3L7G A;  1WKM A;  2BH3 A;  3IU8 A;  2ZSG A;  4OOK A;  2MAT A;  2GG8 A;  1M35 A;  4A6W A;  1KP0 A;  2NQ6 A;  4KM3 A;  1MAT A;  4Z7M A;  2V6C A;  1C21 A;  2EVO A;  2OAZ A;  1WY2 A;  3FM3 A;  2BHD A;  3BIQ A;  3IU9 A;  4FLK A;  2Q93 A;  4U75 A;  1R5H A;  4U76 A;  2EVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...