3S8NA

Crystal structure of the grb2 sh2 domain in complex with a pyxn-derived tripeptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area.
pubmed doi rcsb
molecule keywords Growth factor receptor-bound protein 2
molecule tags Signaling protein/antagonist
source organism Homo sapiens
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3s8nA00
1O4RA 3VS7A 1SPSA 2C9WA 5EEQA 2EOBA 1BHHA 5I6VA 5J3XA 2BBUA 2FCIA 1LUMA 2K79B 2PTKA 4K11A 1LUKA 3T04A 1BF5A 3N8MA 2H8HA 1MILA 3KFJA 2ETZA 2PLDA 4NWGA 1SHDA 3GXXA 2LNWA 2EO6A 3BUXB 2LQWA 4TZIA 1A1BA 2GSBA 1QG1E 2Y1MA 5EG3B 2CI9A 1O43A 1LUNA 1LKLA 1O4GA 1O4HA 1FBVA 1X27A 3BKBA 1AOTF 1O44A 4A4BA 3UYOA 2K7AB 4NWFA 2MQIA 1BMBA 2DCRA 3IN8A 4EY0A 3OP0A 1JYQA 2FO0A 3VROA 4XZ1A 5BO4A 1O4NA 3MAZA 2C0TA 1ZFPE 1O46A 2GE9A 2CBLA 2LCTA 2YSXA 3S8NA 1O47A 3S9KA 5DC0B 3VS4A 1MW4A 1UUSA 1Y57A 1F1WA 4OHEA 3ZNIA 4A4CA 1NZLA 2LNXA 3CBLA 1BFJA 1FHSA 2B3OA 1CWEA 1G83A 2L6KA 1O4JA 1AYDA 4WWQA 5EHPA 3IMDA 1BHFA 2EYVA 5IBSA 2DLZA 2CI8A 1OO4A 2HMHA 1XA6A 1O41A 1RJAA 2MK2A 1KA6A 1F2FA 1O4PA 1AYBA 1YVHA 4H34A 1A07A 1AYAA 1O4FA 3PFVA 1KA7A 2IZVA 1LCKA 2SHPA 3IMJA 2LQNA 4GL9E 2C0OA 1H9OA 3VRYA 1AOUF 4F5BA 5D0JA 3VRNA 1QADA 1A1AA 2HDXA 1SHAA 3PSJA 2ECDA 1O4DA 2EKXA 1OPKA 1NZVA 3K2MA 3BUMB 2KNOA 4XZ0A 3VRRA 1CSYA 4F5AA 2HUWA 2CS0A 2JYQA 1O4IA 2DM0A 3IN7A 3MXYA 3GQIB 2XP1A 2HDVA 4DGXA 2YU7A 1CWDL 3US4A 3N84A 4JEGA 4D8KA 4OHDA 1A1EA 4L1BB 4E68A 1TZEE 3PS5A 2SRCA 3QWXX 4E93A 1O4MA 4GWFA 4ROJA 3GXWA 2PLEA 2Y1NA 3N7YA 2IUGA 1A08A 1FU6A 1R1PA 3OVEA 4QSYA 4X6SA 1R1QA 1BLJA 1O49A 5DC9A 2EYZA 1O4CA 2EO3A 3EAZA 1D1ZA 4M4ZA 1JYUA 1JWOA 4LUDA 4OHLA 1NRVA 1YVLA 3WA4A 1SKJA 4P9VA 3VS2A 1AYCA 5AULA 1O4EA 4P9ZA 1JU5A 1O4LA 1JYRA 1B47A 1LUIA 1M61A 3QWYA 1Z3KA 1FYRA 4U17A 3VS5A 1BHHB 1I3ZA 1BLKA 1M27A 3OV1A 2DLYA 1LCJA 3VRQA 3TKZA 3TL0A 1SPRA 4EIHA 4H1OA 1BKMA 5CDWA 2KK6A 1O4BA 2L4KA 4K45A 1O4QA 2RORA 1O4OA 3S8OA 4F59A 3VS6A 3OB2B 2CRHA 2RSYA 3BUWB 3NHNA 1OO3A 2H46E 5HKYA 1P13A 1LKKA 1TCEA 4OHIA 2AOAA 2QMSA 3BUNB 3MXCA 1A1CA 1WQUA 3OB1B 1A81A 2CR4A 1BM2A 1FMKA 1RQQC 1GRIA 3M7FA 3PSKA 3EACA 2IUIA 1D4TA 3HCKA 3HHMB 2RMXA 3VS1A 1AB2A 2RVFA 1OPLA 2MRJA 2MRKA 3PQZA 3BUOB 2PNBA 2IUHA 2C0IA 1X6CA 3PJPA 2VIFA 4JGHA 1SHBA 2AUGA 2MC1A 1O4AA 1FU5A 1O4KA 1O48A 5EHRA 5IBMA 4U1PA 4GPLB 2OZOA 3S8LA 4K44A 3VGOA 2PNAA 3VRZA 5DC4A 5AXIA 1UURA 1R1SA 4OHHA 1O42A 1IS0A 1D4WA 1AD5A 5HKWA 2EL8A 2HCKA 3VRPA 1CJ1A 5KAZA 1BG1A 4DGPA 3UF4A 5HKZA 4FL3A 1BFIA 1PICA 2Y3AB 1X0NA 1RPYA 2EYYA 1FBZA 2DX0A 1QCFA 5EELA 1K9AA 2H5KA 2ABLA 1O45A 2L3TA 5GJIA 4K2RA 5DF6A 4FBNA 1BKLA 1CSZA 1GHUA 3PLFB 2DVJA 3HIZB 1A09A 4LUEA 1HCTB 2CIAA 1KC2A 3CXLA 2AOBA 1HCSB 3CD3A 1IJRA 1KSWA 2EU0A 1Y1UA 3VS3A 2OQ1A 4JE4A 4FL2A 5GJHA 3CWGA 3VS0A 3C7IA
chains in the Genus database with same CATH superfamily
1O4RA 3VS7A 1SPSA 2C9WA 5EEQA 2EOBA 1BHHA 5I6VA 5J3XA 2BBUA 2FCIA 1LUMA 2K79B 2PTKA 4K11A 1LUKA 3T04A 1BF5A 3N8MA 2H8HA 1MILA 3KFJA 2ETZA 2PLDA 4NWGA 1SHDA 3GXXA 2LNWA 2EO6A 3BUXB 2LQWA 4TZIA 1A1BA 2GSBA 1QG1E 2Y1MA 5EG3B 2CI9A 1O43A 1LUNA 1LKLA 1O4GA 1O4HA 1FBVA 1X27A 3BKBA 1AOTF 1O44A 4A4BA 3UYOA 2K7AB 4NWFA 2MQIA 1BMBA 2DCRA 3IN8A 3LYVA 4EY0A 3OP0A 1JYQA 2FO0A 3VROA 4XZ1A 5BO4A 1O4NA 3MAZA 2C0TA 1ZFPE 1O46A 2GE9A 2CBLA 2LCTA 2YSXA 3S8NA 1O47A 3S9KA 5DC0B 3VS4A 1MW4A 1UUSA 1Y57A 1F1WA 4OHEA 3ZNIA 4A4CA 1NZLA 2LNXA 3CBLA 1BFJA 1FHSA 2B3OA 1CWEA 1G83A 2L6KA 1O4JA 1AYDA 4WWQA 5EHPA 3IMDA 1BHFA 2EYVA 5IBSA 2DLZA 2CI8A 1OO4A 2HMHA 1XA6A 1O41A 1RJAA 2MK2A 1KA6A 1F2FA 1O4PA 1AYBA 1YVHA 4H34A 1A07A 1AYAA 1O4FA 3PFVA 1KA7A 2IZVA 1LCKA 2SHPA 3IMJA 3K2TA 2LQNA 4GL9E 2C0OA 1H9OA 3VRYA 1AOUF 4F5BA 5D0JA 3VRNA 1QADA 1A1AA 2HDXA 1SHAA 3PSJA 2ECDA 1O4DA 2EKXA 1OPKA 1NZVA 3K2MA 3BUMB 2KNOA 4XZ0A 3VRRA 1CSYA 4F5AA 2HUWA 2CS0A 2JYQA 1O4IA 2DM0A 3IN7A 3MXYA 3GQIB 2XP1A 2HDVA 4DGXA 2YU7A 1CWDL 3US4A 2LRAA 3N84A 4JEGA 4D8KA 4OHDA 1A1EA 4L1BB 4E68A 1TZEE 3PS5A 2SRCA 3QWXX 4E93A 1O4MA 4GWFA 4ROJA 3GXWA 2PLEA 2Y1NA 3N7YA 2IUGA 1A08A 1FU6A 1R1PA 3OVEA 4QSYA 4X6SA 1R1QA 1BLJA 1O49A 5DC9A 2EYZA 1O4CA 2EO3A 3EAZA 1D1ZA 4M4ZA 1JYUA 1JWOA 4LUDA 4OHLA 1NRVA 1YVLA 3WA4A 1SKJA 4P9VA 3VS2A 1AYCA 5AULA 1O4EA 4P9ZA 1JU5A 1O4LA 1JYRA 1B47A 1LUIA 1M61A 3QWYA 1Z3KA 1FYRA 4U17A 3VS5A 1BHHB 1I3ZA 1BLKA 1M27A 3OV1A 2DLYA 1LCJA 3VRQA 3TKZA 3TL0A 1SPRA 4EIHA 4H1OA 1BKMA 5CDWA 2KK6A 1O4BA 2L4KA 4K45A 1O4QA 2RORA 1O4OA 3S8OA 4F59A 3VS6A 3OB2B 2CRHA 2RSYA 3BUWB 3NHNA 1OO3A 2H46E 5HKYA 1P13A 1LKKA 1TCEA 4OHIA 2AOAA 2QMSA 3BUNB 3MXCA 1A1CA 1WQUA 3OB1B 1A81A 2CR4A 1BM2A 1FMKA 1RQQC 1GRIA 3M7FA 3PSKA 3EACA 2IUIA 1D4TA 3HCKA 3HHMB 2RMXA 3VS1A 1AB2A 2RVFA 1OPLA 2MRJA 2MRKA 3PQZA 3BUOB 2PNBA 2IUHA 2C0IA 1X6CA 3PJPA 2VIFA 4JGHA 1SHBA 2AUGA 2MC1A 1O4AA 1FU5A 1O4KA 1O48A 5EHRA 5IBMA 4U1PA 4GPLB 2OZOA 3S8LA 4K44A 3VGOA 2PNAA 3VRZA 5DC4A 5AXIA 1UURA 1R1SA 4OHHA 1O42A 1IS0A 1D4WA 1AD5A 5HKWA 2EL8A 2HCKA 3VRPA 1CJ1A 5KAZA 1BG1A 4DGPA 2KGYA 3UF4A 5HKZA 4FL3A 1BFIA 1PICA 2Y3AB 1X0NA 1RPYA 2EYYA 1FBZA 2DX0A 1QCFA 5EELA 1K9AA 2H5KA 2ABLA 1O45A 2L3TA 5GJIA 4K2RA 5DF6A 4FBNA 1BKLA 1CSZA 1GHUA 3PLFB 2DVJA 3HIZB 1A09A 4LUEA 1HCTB 2CIAA 1KC2A 3CXLA 2AOBA 1HCSB 3CD3A 1IJRA 1KSWA 2EU0A 1Y1UA 3VS3A 2OQ1A 4JE4A 4FL2A 5GJHA 3CWGA 3VS0A 3C7IA
chains in the Genus database with same CATH topology
1O4RA 3VS7A 1SPSA 2C9WA 5EEQA 2EOBA 1BHHA 5I6VA 5J3XA 2BBUA 2FCIA 1LUMA 2K79B 2PTKA 4K11A 1LUKA 3T04A 1BF5A 3N8MA 2H8HA 1MILA 3KFJA 2ETZA 2PLDA 4NWGA 1SHDA 3GXXA 2LNWA 2EO6A 3BUXB 2LQWA 4TZIA 1A1BA 2GSBA 1QG1E 2Y1MA 5EG3B 2CI9A 1O43A 1LUNA 1LKLA 1O4GA 1O4HA 1FBVA 1X27A 3BKBA 1AOTF 1O44A 4A4BA 3UYOA 2K7AB 4NWFA 2MQIA 1BMBA 2DCRA 3IN8A 4EY0A 3OP0A 1JYQA 2FO0A 3VROA 4XZ1A 5BO4A 1O4NA 3MAZA 2C0TA 1ZFPE 1O46A 2GE9A 2CBLA 2LCTA 2YSXA 3S8NA 1O47A 3S9KA 5DC0B 3VS4A 1MW4A 1UUSA 1Y57A 1F1WA 4OHEA 3ZNIA 4A4CA 1NZLA 2LNXA 3CBLA 1BFJA 1FHSA 2B3OA 1CWEA 1G83A 2L6KA 1O4JA 1AYDA 4WWQA 5EHPA 3IMDA 1BHFA 2EYVA 5IBSA 2DLZA 2CI8A 1OO4A 2HMHA 1XA6A 1O41A 1RJAA 2MK2A 1KA6A 1F2FA 1O4PA 1AYBA 1YVHA 4H34A 1A07A 1AYAA 1O4FA 3PFVA 1KA7A 2IZVA 1LCKA 2SHPA 3IMJA 2LQNA 4GL9E 2C0OA 1H9OA 3VRYA 1AOUF 4F5BA 5D0JA 3VRNA 1QADA 1A1AA 2HDXA 1SHAA 3PSJA 2ECDA 1O4DA 2EKXA 1OPKA 1NZVA 3K2MA 3BUMB 2KNOA 4XZ0A 3VRRA 1CSYA 4F5AA 2HUWA 2CS0A 2JYQA 1O4IA 2DM0A 3IN7A 3MXYA 3GQIB 2XP1A 2HDVA 4DGXA 2YU7A 1CWDL 3US4A 3N84A 4JEGA 4D8KA 4OHDA 1A1EA 4L1BB 4E68A 1TZEE 3PS5A 2SRCA 3QWXX 4E93A 1O4MA 4GWFA 4ROJA 3GXWA 2PLEA 2Y1NA 3N7YA 2IUGA 1A08A 1FU6A 1R1PA 3OVEA 4QSYA 4X6SA 1R1QA 1BLJA 1O49A 5DC9A 2EYZA 1O4CA 2EO3A 3EAZA 1D1ZA 4M4ZA 1JYUA 1JWOA 4LUDA 4OHLA 1NRVA 1YVLA 3WA4A 1SKJA 4P9VA 3VS2A 1AYCA 5AULA 1O4EA 4P9ZA 1JU5A 1O4LA 1JYRA 1B47A 1LUIA 1M61A 3QWYA 1Z3KA 1FYRA 4U17A 3VS5A 1BHHB 1I3ZA 1BLKA 1M27A 3OV1A 2DLYA 1LCJA 3VRQA 3TKZA 3TL0A 1SPRA 4EIHA 4H1OA 1BKMA 5CDWA 2KK6A 1O4BA 2L4KA 4K45A 1O4QA 2RORA 1O4OA 3S8OA 4F59A 3VS6A 3OB2B 2CRHA 2RSYA 3BUWB 3NHNA 1OO3A 2H46E 5HKYA 1P13A 1LKKA 1TCEA 4OHIA 2AOAA 2QMSA 3BUNB 3MXCA 1A1CA 1WQUA 3OB1B 1A81A 2CR4A 1BM2A 1FMKA 1RQQC 1GRIA 3M7FA 3PSKA 3EACA 2IUIA 1D4TA 3HCKA 3HHMB 2RMXA 3VS1A 1AB2A 2RVFA 1OPLA 2MRJA 2MRKA 3PQZA 3BUOB 2PNBA 2IUHA 2C0IA 1X6CA 3PJPA 2VIFA 4JGHA 1SHBA 2AUGA 2MC1A 1O4AA 1FU5A 1O4KA 1O48A 5EHRA 5IBMA 4U1PA 4GPLB 2OZOA 3S8LA 4K44A 3VGOA 2PNAA 3VRZA 5DC4A 5AXIA 1UURA 1R1SA 4OHHA 1O42A 1IS0A 1D4WA 1AD5A 5HKWA 2EL8A 2HCKA 3VRPA 1CJ1A 5KAZA 1BG1A 4DGPA 3UF4A 5HKZA 4FL3A 1BFIA 1PICA 2Y3AB 1X0NA 1RPYA 2EYYA 1FBZA 2DX0A 1QCFA 5EELA 1K9AA 2H5KA 2ABLA 1O45A 2L3TA 5GJIA 4K2RA 5DF6A 4FBNA 1BKLA 1CSZA 1GHUA 3PLFB 2DVJA 3HIZB 1A09A 4LUEA 1HCTB 2CIAA 1KC2A 3CXLA 2AOBA 1HCSB 3CD3A 1IJRA 1KSWA 2EU0A 1Y1UA 3VS3A 2OQ1A 4JE4A 4FL2A 5GJHA 3CWGA 3VS0A 3C7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O4R A;  3VS7 A;  1SPS A;  2C9W A;  5EEQ A;  2EOB A;  1BHH A;  5I6V A;  5J3X A;  2BBU A;  2FCI A;  1LUM A;  2K79 B;  2PTK A;  4K11 A;  1LUK A;  3T04 A;  1BF5 A;  3N8M A;  2H8H A;  1MIL A;  3KFJ A;  2ETZ A;  2PLD A;  4NWG A;  1SHD A;  3GXX A;  2LNW A;  2EO6 A;  3BUX B;  2LQW A;  4TZI A;  1A1B A;  2GSB A;  1QG1 E;  2Y1M A;  5EG3 B;  2CI9 A;  1O43 A;  1LUN A;  1LKL A;  1O4G A;  1O4H A;  1FBV A;  1X27 A;  3BKB A;  1AOT F;  1O44 A;  4A4B A;  3UYO A;  2K7A B;  4NWF A;  2MQI A;  1BMB A;  2DCR A;  3IN8 A;  4EY0 A;  3OP0 A;  1JYQ A;  2FO0 A;  3VRO A;  4XZ1 A;  5BO4 A;  1O4N A;  3MAZ A;  2C0T A;  1ZFP E;  1O46 A;  2GE9 A;  2CBL A;  2LCT A;  2YSX A;  3S8N A;  1O47 A;  3S9K A;  5DC0 B;  3VS4 A;  1MW4 A;  1UUS A;  1Y57 A;  1F1W A;  4OHE A;  3ZNI A;  4A4C A;  1NZL A;  2LNX A;  3CBL A;  1BFJ A;  1FHS A;  2B3O A;  1CWE A;  1G83 A;  2L6K A;  1O4J A;  1AYD A;  4WWQ A;  5EHP A;  3IMD A;  1BHF A;  2EYV A;  5IBS A;  2DLZ A;  2CI8 A;  1OO4 A;  2HMH A;  1XA6 A;  1O41 A;  1RJA A;  2MK2 A;  1KA6 A;  1F2F A;  1O4P A;  1AYB A;  1YVH A;  4H34 A;  1A07 A;  1AYA A;  1O4F A;  3PFV A;  1KA7 A;  2IZV A;  1LCK A;  2SHP A;  3IMJ A;  2LQN A;  4GL9 E;  2C0O A;  1H9O A;  3VRY A;  1AOU F;  4F5B A;  5D0J A;  3VRN A;  1QAD A;  1A1A A;  2HDX A;  1SHA A;  3PSJ A;  2ECD A;  1O4D A;  2EKX A;  1OPK A;  1NZV A;  3K2M A;  3BUM B;  2KNO A;  4XZ0 A;  3VRR A;  1CSY A;  4F5A A;  2HUW A;  2CS0 A;  2JYQ A;  1O4I A;  2DM0 A;  3IN7 A;  3MXY A;  3GQI B;  2XP1 A;  2HDV A;  4DGX A;  2YU7 A;  1CWD L;  3US4 A;  3N84 A;  4JEG A;  4D8K A;  4OHD A;  1A1E A;  4L1B B;  4E68 A;  1TZE E;  3PS5 A;  2SRC A;  3QWX X;  4E93 A;  1O4M A;  4GWF A;  4ROJ A;  3GXW A;  2PLE A;  2Y1N A;  3N7Y A;  2IUG A;  1A08 A;  1FU6 A;  1R1P A;  3OVE A;  4QSY A;  4X6S A;  1R1Q A;  1BLJ A;  1O49 A;  5DC9 A;  2EYZ A;  1O4C A;  2EO3 A;  3EAZ A;  1D1Z A;  4M4Z A;  1JYU A;  1JWO A;  4LUD A;  4OHL A;  1NRV A;  1YVL A;  3WA4 A;  1SKJ A;  4P9V A;  3VS2 A;  1AYC A;  5AUL A;  1O4E A;  4P9Z A;  1JU5 A;  1O4L A;  1JYR A;  1B47 A;  1LUI A;  1M61 A;  3QWY A;  1Z3K A;  1FYR A;  4U17 A;  3VS5 A;  1BHH B;  1I3Z A;  1BLK A;  1M27 A;  3OV1 A;  2DLY A;  1LCJ A;  3VRQ A;  3TKZ A;  3TL0 A;  1SPR A;  4EIH A;  4H1O A;  1BKM A;  5CDW A;  2KK6 A;  1O4B A;  2L4K A;  4K45 A;  1O4Q A;  2ROR A;  1O4O A;  3S8O A;  4F59 A;  3VS6 A;  3OB2 B;  2CRH A;  2RSY A;  3BUW B;  3NHN A;  1OO3 A;  2H46 E;  5HKY A;  1P13 A;  1LKK A;  1TCE A;  4OHI A;  2AOA A;  2QMS A;  3BUN B;  3MXC A;  1A1C A;  1WQU A;  3OB1 B;  1A81 A;  2CR4 A;  1BM2 A;  1FMK A;  1RQQ C;  1GRI A;  3M7F A;  3PSK A;  3EAC A;  2IUI A;  1D4T A;  3HCK A;  3HHM B;  2RMX A;  3VS1 A;  1AB2 A;  2RVF A;  1OPL A;  2MRJ A;  2MRK A;  3PQZ A;  3BUO B;  2PNB A;  2IUH A;  2C0I A;  1X6C A;  3PJP A;  2VIF A;  4JGH A;  1SHB A;  2AUG A;  2MC1 A;  1O4A A;  1FU5 A;  1O4K A;  1O48 A;  5EHR A;  5IBM A;  4U1P A;  4GPL B;  2OZO A;  3S8L A;  4K44 A;  3VGO A;  2PNA A;  3VRZ A;  5DC4 A;  5AXI A;  1UUR A;  1R1S A;  4OHH A;  1O42 A;  1IS0 A;  1D4W A;  1AD5 A;  5HKW A;  2EL8 A;  2HCK A;  3VRP A;  1CJ1 A;  5KAZ A;  1BG1 A;  4DGP A;  3UF4 A;  5HKZ A;  4FL3 A;  1BFI A;  1PIC A;  2Y3A B;  1X0N A;  1RPY A;  2EYY A;  1FBZ A;  2DX0 A;  1QCF A;  5EEL A;  1K9A A;  2H5K A;  2ABL A;  1O45 A;  2L3T A;  5GJI A;  4K2R A;  5DF6 A;  4FBN A;  1BKL A;  1CSZ A;  1GHU A;  3PLF B;  2DVJ A;  3HIZ B;  1A09 A;  4LUE A;  1HCT B;  2CIA A;  1KC2 A;  3CXL A;  2AOB A;  1HCS B;  3CD3 A;  1IJR A;  1KSW A;  2EU0 A;  1Y1U A;  3VS3 A;  2OQ1 A;  4JE4 A;  4FL2 A;  5GJH A;  3CWG A;  3VS0 A;  3C7I A; 
#chains in the Genus database with same CATH topology
 1O4R A;  3VS7 A;  1SPS A;  2C9W A;  5EEQ A;  2EOB A;  1BHH A;  5I6V A;  5J3X A;  2BBU A;  2FCI A;  1LUM A;  2K79 B;  2PTK A;  4K11 A;  1LUK A;  3T04 A;  1BF5 A;  3N8M A;  2H8H A;  1MIL A;  3KFJ A;  2ETZ A;  2PLD A;  4NWG A;  1SHD A;  3GXX A;  2LNW A;  2EO6 A;  3BUX B;  2LQW A;  4TZI A;  1A1B A;  2GSB A;  1QG1 E;  2Y1M A;  5EG3 B;  2CI9 A;  1O43 A;  1LUN A;  1LKL A;  1O4G A;  1O4H A;  1FBV A;  1X27 A;  3BKB A;  1AOT F;  1O44 A;  4A4B A;  3UYO A;  2K7A B;  4NWF A;  2MQI A;  1BMB A;  2DCR A;  3IN8 A;  3LYV A;  4EY0 A;  3OP0 A;  1JYQ A;  2FO0 A;  3VRO A;  4XZ1 A;  5BO4 A;  1O4N A;  3MAZ A;  2C0T A;  1ZFP E;  1O46 A;  2GE9 A;  2CBL A;  2LCT A;  2YSX A;  3S8N A;  1O47 A;  3S9K A;  5DC0 B;  3VS4 A;  1MW4 A;  1UUS A;  1Y57 A;  1F1W A;  4OHE A;  3ZNI A;  4A4C A;  1NZL A;  2LNX A;  3CBL A;  1BFJ A;  1FHS A;  2B3O A;  1CWE A;  1G83 A;  2L6K A;  1O4J A;  1AYD A;  4WWQ A;  5EHP A;  3IMD A;  1BHF A;  2EYV A;  5IBS A;  2DLZ A;  2CI8 A;  1OO4 A;  2HMH A;  1XA6 A;  1O41 A;  1RJA A;  2MK2 A;  1KA6 A;  1F2F A;  1O4P A;  1AYB A;  1YVH A;  4H34 A;  1A07 A;  1AYA A;  1O4F A;  3PFV A;  1KA7 A;  2IZV A;  1LCK A;  2SHP A;  3IMJ A;  3K2T A;  2LQN A;  4GL9 E;  2C0O A;  1H9O A;  3VRY A;  1AOU F;  4F5B A;  5D0J A;  3VRN A;  1QAD A;  1A1A A;  2HDX A;  1SHA A;  3PSJ A;  2ECD A;  1O4D A;  2EKX A;  1OPK A;  1NZV A;  3K2M A;  3BUM B;  2KNO A;  4XZ0 A;  3VRR A;  1CSY A;  4F5A A;  2HUW A;  2CS0 A;  2JYQ A;  1O4I A;  2DM0 A;  3IN7 A;  3MXY A;  3GQI B;  2XP1 A;  2HDV A;  4DGX A;  2YU7 A;  1CWD L;  3US4 A;  2LRA A;  3N84 A;  4JEG A;  4D8K A;  4OHD A;  1A1E A;  4L1B B;  4E68 A;  1TZE E;  3PS5 A;  2SRC A;  3QWX X;  4E93 A;  1O4M A;  4GWF A;  4ROJ A;  3GXW A;  2PLE A;  2Y1N A;  3N7Y A;  2IUG A;  1A08 A;  1FU6 A;  1R1P A;  3OVE A;  4QSY A;  4X6S A;  1R1Q A;  1BLJ A;  1O49 A;  5DC9 A;  2EYZ A;  1O4C A;  2EO3 A;  3EAZ A;  1D1Z A;  4M4Z A;  1JYU A;  1JWO A;  4LUD A;  4OHL A;  1NRV A;  1YVL A;  3WA4 A;  1SKJ A;  4P9V A;  3VS2 A;  1AYC A;  5AUL A;  1O4E A;  4P9Z A;  1JU5 A;  1O4L A;  1JYR A;  1B47 A;  1LUI A;  1M61 A;  3QWY A;  1Z3K A;  1FYR A;  4U17 A;  3VS5 A;  1BHH B;  1I3Z A;  1BLK A;  1M27 A;  3OV1 A;  2DLY A;  1LCJ A;  3VRQ A;  3TKZ A;  3TL0 A;  1SPR A;  4EIH A;  4H1O A;  1BKM A;  5CDW A;  2KK6 A;  1O4B A;  2L4K A;  4K45 A;  1O4Q A;  2ROR A;  1O4O A;  3S8O A;  4F59 A;  3VS6 A;  3OB2 B;  2CRH A;  2RSY A;  3BUW B;  3NHN A;  1OO3 A;  2H46 E;  5HKY A;  1P13 A;  1LKK A;  1TCE A;  4OHI A;  2AOA A;  2QMS A;  3BUN B;  3MXC A;  1A1C A;  1WQU A;  3OB1 B;  1A81 A;  2CR4 A;  1BM2 A;  1FMK A;  1RQQ C;  1GRI A;  3M7F A;  3PSK A;  3EAC A;  2IUI A;  1D4T A;  3HCK A;  3HHM B;  2RMX A;  3VS1 A;  1AB2 A;  2RVF A;  1OPL A;  2MRJ A;  2MRK A;  3PQZ A;  3BUO B;  2PNB A;  2IUH A;  2C0I A;  1X6C A;  3PJP A;  2VIF A;  4JGH A;  1SHB A;  2AUG A;  2MC1 A;  1O4A A;  1FU5 A;  1O4K A;  1O48 A;  5EHR A;  5IBM A;  4U1P A;  4GPL B;  2OZO A;  3S8L A;  4K44 A;  3VGO A;  2PNA A;  3VRZ A;  5DC4 A;  5AXI A;  1UUR A;  1R1S A;  4OHH A;  1O42 A;  1IS0 A;  1D4W A;  1AD5 A;  5HKW A;  2EL8 A;  2HCK A;  3VRP A;  1CJ1 A;  5KAZ A;  1BG1 A;  4DGP A;  2KGY A;  3UF4 A;  5HKZ A;  4FL3 A;  1BFI A;  1PIC A;  2Y3A B;  1X0N A;  1RPY A;  2EYY A;  1FBZ A;  2DX0 A;  1QCF A;  5EEL A;  1K9A A;  2H5K A;  2ABL A;  1O45 A;  2L3T A;  5GJI A;  4K2R A;  5DF6 A;  4FBN A;  1BKL A;  1CSZ A;  1GHU A;  3PLF B;  2DVJ A;  3HIZ B;  1A09 A;  4LUE A;  1HCT B;  2CIA A;  1KC2 A;  3CXL A;  2AOB A;  1HCS B;  3CD3 A;  1IJR A;  1KSW A;  2EU0 A;  1Y1U A;  3VS3 A;  2OQ1 A;  4JE4 A;  4FL2 A;  5GJH A;  3CWG A;  3VS0 A;  3C7I A; 
#chains in the Genus database with same CATH homology
 1O4R A;  3VS7 A;  1SPS A;  2C9W A;  5EEQ A;  2EOB A;  1BHH A;  5I6V A;  5J3X A;  2BBU A;  2FCI A;  1LUM A;  2K79 B;  2PTK A;  4K11 A;  1LUK A;  3T04 A;  1BF5 A;  3N8M A;  2H8H A;  1MIL A;  3KFJ A;  2ETZ A;  2PLD A;  4NWG A;  1SHD A;  3GXX A;  2LNW A;  2EO6 A;  3BUX B;  2LQW A;  4TZI A;  1A1B A;  2GSB A;  1QG1 E;  2Y1M A;  5EG3 B;  2CI9 A;  1O43 A;  1LUN A;  1LKL A;  1O4G A;  1O4H A;  1FBV A;  1X27 A;  3BKB A;  1AOT F;  1O44 A;  4A4B A;  3UYO A;  2K7A B;  4NWF A;  2MQI A;  1BMB A;  2DCR A;  3IN8 A;  4EY0 A;  3OP0 A;  1JYQ A;  2FO0 A;  3VRO A;  4XZ1 A;  5BO4 A;  1O4N A;  3MAZ A;  2C0T A;  1ZFP E;  1O46 A;  2GE9 A;  2CBL A;  2LCT A;  2YSX A;  3S8N A;  1O47 A;  3S9K A;  5DC0 B;  3VS4 A;  1MW4 A;  1UUS A;  1Y57 A;  1F1W A;  4OHE A;  3ZNI A;  4A4C A;  1NZL A;  2LNX A;  3CBL A;  1BFJ A;  1FHS A;  2B3O A;  1CWE A;  1G83 A;  2L6K A;  1O4J A;  1AYD A;  4WWQ A;  5EHP A;  3IMD A;  1BHF A;  2EYV A;  5IBS A;  2DLZ A;  2CI8 A;  1OO4 A;  2HMH A;  1XA6 A;  1O41 A;  1RJA A;  2MK2 A;  1KA6 A;  1F2F A;  1O4P A;  1AYB A;  1YVH A;  4H34 A;  1A07 A;  1AYA A;  1O4F A;  3PFV A;  1KA7 A;  2IZV A;  1LCK A;  2SHP A;  3IMJ A;  2LQN A;  4GL9 E;  2C0O A;  1H9O A;  3VRY A;  1AOU F;  4F5B A;  5D0J A;  3VRN A;  1QAD A;  1A1A A;  2HDX A;  1SHA A;  3PSJ A;  2ECD A;  1O4D A;  2EKX A;  1OPK A;  1NZV A;  3K2M A;  3BUM B;  2KNO A;  4XZ0 A;  3VRR A;  1CSY A;  4F5A A;  2HUW A;  2CS0 A;  2JYQ A;  1O4I A;  2DM0 A;  3IN7 A;  3MXY A;  3GQI B;  2XP1 A;  2HDV A;  4DGX A;  2YU7 A;  1CWD L;  3US4 A;  3N84 A;  4JEG A;  4D8K A;  4OHD A;  1A1E A;  4L1B B;  4E68 A;  1TZE E;  3PS5 A;  2SRC A;  3QWX X;  4E93 A;  1O4M A;  4GWF A;  4ROJ A;  3GXW A;  2PLE A;  2Y1N A;  3N7Y A;  2IUG A;  1A08 A;  1FU6 A;  1R1P A;  3OVE A;  4QSY A;  4X6S A;  1R1Q A;  1BLJ A;  1O49 A;  5DC9 A;  2EYZ A;  1O4C A;  2EO3 A;  3EAZ A;  1D1Z A;  4M4Z A;  1JYU A;  1JWO A;  4LUD A;  4OHL A;  1NRV A;  1YVL A;  3WA4 A;  1SKJ A;  4P9V A;  3VS2 A;  1AYC A;  5AUL A;  1O4E A;  4P9Z A;  1JU5 A;  1O4L A;  1JYR A;  1B47 A;  1LUI A;  1M61 A;  3QWY A;  1Z3K A;  1FYR A;  4U17 A;  3VS5 A;  1BHH B;  1I3Z A;  1BLK A;  1M27 A;  3OV1 A;  2DLY A;  1LCJ A;  3VRQ A;  3TKZ A;  3TL0 A;  1SPR A;  4EIH A;  4H1O A;  1BKM A;  5CDW A;  2KK6 A;  1O4B A;  2L4K A;  4K45 A;  1O4Q A;  2ROR A;  1O4O A;  3S8O A;  4F59 A;  3VS6 A;  3OB2 B;  2CRH A;  2RSY A;  3BUW B;  3NHN A;  1OO3 A;  2H46 E;  5HKY A;  1P13 A;  1LKK A;  1TCE A;  4OHI A;  2AOA A;  2QMS A;  3BUN B;  3MXC A;  1A1C A;  1WQU A;  3OB1 B;  1A81 A;  2CR4 A;  1BM2 A;  1FMK A;  1RQQ C;  1GRI A;  3M7F A;  3PSK A;  3EAC A;  2IUI A;  1D4T A;  3HCK A;  3HHM B;  2RMX A;  3VS1 A;  1AB2 A;  2RVF A;  1OPL A;  2MRJ A;  2MRK A;  3PQZ A;  3BUO B;  2PNB A;  2IUH A;  2C0I A;  1X6C A;  3PJP A;  2VIF A;  4JGH A;  1SHB A;  2AUG A;  2MC1 A;  1O4A A;  1FU5 A;  1O4K A;  1O48 A;  5EHR A;  5IBM A;  4U1P A;  4GPL B;  2OZO A;  3S8L A;  4K44 A;  3VGO A;  2PNA A;  3VRZ A;  5DC4 A;  5AXI A;  1UUR A;  1R1S A;  4OHH A;  1O42 A;  1IS0 A;  1D4W A;  1AD5 A;  5HKW A;  2EL8 A;  2HCK A;  3VRP A;  1CJ1 A;  5KAZ A;  1BG1 A;  4DGP A;  3UF4 A;  5HKZ A;  4FL3 A;  1BFI A;  1PIC A;  2Y3A B;  1X0N A;  1RPY A;  2EYY A;  1FBZ A;  2DX0 A;  1QCF A;  5EEL A;  1K9A A;  2H5K A;  2ABL A;  1O45 A;  2L3T A;  5GJI A;  4K2R A;  5DF6 A;  4FBN A;  1BKL A;  1CSZ A;  1GHU A;  3PLF B;  2DVJ A;  3HIZ B;  1A09 A;  4LUE A;  1HCT B;  2CIA A;  1KC2 A;  3CXL A;  2AOB A;  1HCS B;  3CD3 A;  1IJR A;  1KSW A;  2EU0 A;  1Y1U A;  3VS3 A;  2OQ1 A;  4JE4 A;  4FL2 A;  5GJH A;  3CWG A;  3VS0 A;  3C7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...