3SA2A

Bacuills anthracis dihydrofolate reductase bound propargyl-linked tmp analog, ucp1014
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
HHHMRVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAR studies of heterocyclic propargyl-linked TMP analogs to Bacillus dihydrofolate reductase
rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Bacillus anthracis
total genus 45
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3sa2A00
4EIZA 4KD7A 1DYHA 3NZDA 2W3VA 1QZFA 4ELGA 1RA1A 2BLBA 3UM8A 4FHBA 2BLAA 2OBCA 3JWCA 3F8YA 3NZ9X 1RX1A 2AZNA 1AOEA 4PTJA 3EIGA 3FS6A 1DYJA 3NZAX 1DRHA 3QLYA 3JWMA 4TU5X 2QK8A 3F8ZA 3GHVA 4DP3A 4M2XA 1E26A 4Q67A 1VDRA 5CC9A 3DATA 4P68A 4P66A 1DIUA 1JUVA 1J3KA 7DFRA 5HVEA 1LY3A 1J3IA 1RE7A 3NZCX 4LAHX 3NTZA 2LF1A 2W9GA 3NXTA 4DFRA 3SRQX 3M09A 3F0XX 4XT8A 3ZPGA 4M7VA 5DFRA 4RGCA 1LY4A 4HOEA 2DHFA 4ELFA 3DFRA 4G8ZX 5ECXA 1BOZA 4KY4A 1J3JA 3KGYA 2GD9A 5JG0X 1HFRA 3INVA 4XT7A 4DPHA 2HQPA 1RH3A 1DR5A 3TQBA 1DYIA 3CD2A 1M79A 5CCCA 5HPBA 4LEKX 5FDAA 3FQCA 4Q0DA 4QLGA 3SA2A 3ROAA 4NX7A 3S3VA 3UM6A 3GHCA 3NXOA 3F0VX 4M6KA 1RX5A 2W9HA 2C2SA 3EEJA 1IA4A 3F0UX 4CD2A 5U27A 3TD8A 1PD9A 3SRRX 2P4GA 3NU0A 1IA3A 3RO9A 3QL0A 3SGYA 2W3MA 4OSGA 1RA8A 3NXRA 1DR7A 4LAEX 3QYLA 3JVXA 3I8AX 4H95A 1S3VA 3QLWA 3IRNA 3FY8X 1DAJA 1KMSA 3FRBX 1CZ3A 1RG7A 3S9UA 3SA1A 1M7AA 3KY8A 4QHVA 1S3WA 1DRFA 4M7UA 1DR2A 8DFRA 4HA7A 3EEKA 3F0QX 3NXYA 3FYVX 4PSSA 4DPDA 2FZHA 1RB3A 1U72A 1M78A 1DLRA 3S7AA 3DGAA 4LAGX 1PD8A 5HUIA 3JW3A 3FQFA 1DRAA 2CIGA 4KFJA 4I13A 3SR5X 2FZJA 3QG2A 3UM5A 3DAUA 3D80A 4PSYA 3IRMA 1DRBA 1CD2A 4QJZD 4KM2A 3OAFA 2O7PA 4QLFA 3K45A 5ECCA 2HXVA 1RA3A 4XT4A 3IX9A 2CD2A 3CSEA 4QLEA 1DR3A 3IA5A 3OCHA 3IROA 4X5JA 4OR7A 3CLBA 1RC4A 3Q1HA 4PTHA 4X5IA 3FREX 1RF7A 4KL9A 2JYBA 4XT6A 4XE6X 4KEBA 1DHIA 5HF2X 1DYRA 3GYFA 3SAIA 4KJKA 4M6LA 1BZFA 3NXVA 1RX6A 3FQ0A 4EJ1A 3D84X 2W3WA 1DR4A 1JOLA 4HA9A 2ITHA 3CL9A 2L28A 3FQZA 1DDSA 3QL3A 1IA2A 2G6VA 2W9TA 3EEMA 1DREA 4ELEA 2ANOA 4XRBA 3KJRA 1S3UA 4PDJA 4X5FA 4IXED 2FZIA 4XECX 2XW7A 4ELHA 3FQOA 4KJLA 1YHOA 3SH2A 4DDRA 3K47A 3QGTA 5EAJA 3GI2A 4I1NA 1MVSA 1KMVA 3DL5A 3EELA 3EX8A 2H2QA 5E8QA 1OHJA 4KAKA 3FRAX 4G3MA 5HSRA 1DISA 3TQ8A 5HI6A 2W3AA 4P3RA 3NZ6X 1S3YA 2ANQA 2BL9A 4KM0A 4M6JA 4KNEA 1RD7A 3DG8A 3FQVA 2D0KA 3DRCA 3FY9X 1OHKA 2BLCA 2D5NA 2W3BA 3TQ9A 4Q0EA 1DR1A 3TQAA 3FYWX 4G95A 3M08A 4QI9A 4ELBA 1RA9A 5HVBA 4H97A 1RX8A 1RX7A 3JWKA 1U70A 1DDRA 4GH8A 5HF0X 1PDBA 5HQZA 4IXFX 3QLZA 4KLXA 1DG7A 1DHFA 5HT5A 3NZBX 3QFXA 3SRWX 1D1GA 4Q6AA 4XT5A 3ZPCA 1RX2A 3QLSA 3R33A 5JA3A 3NXXA 6DFRA 1DF7A 1HFPA 1DG8A 1KLKA 1MVTA 2OIPA 1IA1A 1RX3A 3I3RA 4FGGA 4ECKA 1RA2A 4KYAA 4KJJA 3HJ3A 4HOGA 2ZZAA 3SRSX 2W9SA 1SEJA 3F91A 1ZDRA 3QYOA 1JOMA 1DHJA 3JWFA 4H96A 3DL6A 2KGKA 3IA4A 4HOFA 3VCOA 3K2HA 4IXGX 3FRFX 1LUDA 4PSTA 5HSUA 4X5HA 4NX6A 3KFYA 2B3ZA 1AI9A 1DG5A 3FL8A 1HFQA 3N0HA 4KBNA 4H98A 3K74A 3L3RA 4EILA 3HBBA 2INQA 5U26A 1AO8A 3JSUA 3QLRA 3LG4A 4QJCA 5DXVA 3GHWA 4P3QA 3F0BX 1RX9A 2DRCA 3FRDX 3FL9A 2C2TA 3E0BA 4X5GA 1RX4A 3NRRA 3JTWA 5HQYA 4KY8A 1U71A 5HT4A 3SQYX 3SRUX 4FGHA 3KJSA 2HM9A 1RB2A 1VJ3A 3QLXA 3RG9A 3F0SX 3JW5A 4EIGA 1DLSA 1TDRA 1DR6A
chains in the Genus database with same CATH superfamily
4EIZA 4KD7A 1DYHA 3NZDA 2W3VA 1QZFA 4ELGA 1RA1A 2BLBA 3UM8A 4FHBA 2BLAA 2OBCA 3JWCA 3F8YA 3NZ9X 1RX1A 2AZNA 1AOEA 4PTJA 3EIGA 3FS6A 1DYJA 3NZAX 1DRHA 3QLYA 3JWMA 4TU5X 2QK8A 3F8ZA 3GHVA 4DP3A 4M2XA 1E26A 4Q67A 1VDRA 5CC9A 3DATA 4P68A 4P66A 1DIUA 1JUVA 1J3KA 7DFRA 5HVEA 1LY3A 1J3IA 1RE7A 3NZCX 4LAHX 3NTZA 2LF1A 2W9GA 3NXTA 4DFRA 3SRQX 3M09A 3F0XX 4XT8A 3ZPGA 4M7VA 5DFRA 4RGCA 1LY4A 4HOEA 2DHFA 4ELFA 3DFRA 4G8ZX 5ECXA 1BOZA 4KY4A 1J3JA 3KGYA 2GD9A 5JG0X 1HFRA 3INVA 4XT7A 4DPHA 2HQPA 1RH3A 1DR5A 3TQBA 1DYIA 3CD2A 1M79A 5CCCA 5HPBA 4LEKX 5FDAA 3FQCA 4Q0DA 4QLGA 3SA2A 3ROAA 4NX7A 3S3VA 3UM6A 3GHCA 3NXOA 3F0VX 4M6KA 1RX5A 2W9HA 2C2SA 3EEJA 1IA4A 3F0UX 4CD2A 5U27A 3TD8A 1PD9A 3SRRX 2P4GA 3NU0A 1IA3A 3RO9A 3QL0A 3SGYA 2W3MA 4OSGA 1RA8A 3NXRA 1DR7A 4LAEX 3QYLA 3JVXA 3I8AX 4H95A 1S3VA 3QLWA 3IRNA 3FY8X 1DAJA 1KMSA 3FRBX 1CZ3A 1RG7A 3S9UA 3SA1A 1M7AA 3KY8A 4QHVA 1S3WA 1DRFA 4M7UA 1DR2A 8DFRA 4HA7A 3EEKA 3F0QX 3NXYA 3FYVX 4PSSA 4DPDA 2FZHA 1RB3A 1U72A 1M78A 1DLRA 3S7AA 3DGAA 4LAGX 1PD8A 5HUIA 3JW3A 3FQFA 1DRAA 2CIGA 4KFJA 4I13A 3SR5X 2FZJA 3QG2A 3UM5A 3DAUA 3D80A 4PSYA 3IRMA 1DRBA 1CD2A 4QJZD 4KM2A 3OAFA 2O7PA 4QLFA 3K45A 5ECCA 2HXVA 1RA3A 4XT4A 3IX9A 2CD2A 3CSEA 4QLEA 1DR3A 3IA5A 3OCHA 3IROA 4X5JA 4OR7A 3CLBA 1RC4A 3Q1HA 4PTHA 4X5IA 3FREX 1RF7A 4KL9A 2JYBA 4XT6A 4XE6X 4KEBA 1DHIA 5HF2X 1DYRA 3GYFA 3SAIA 4KJKA 4M6LA 1BZFA 3NXVA 1RX6A 3FQ0A 4EJ1A 3D84X 2W3WA 1DR4A 1JOLA 4HA9A 2ITHA 3CL9A 2L28A 3FQZA 1DDSA 3QL3A 1IA2A 2G6VA 2W9TA 3EEMA 1DREA 4ELEA 2ANOA 4XRBA 3KJRA 1S3UA 4PDJA 4X5FA 4IXED 2FZIA 4XECX 2XW7A 4ELHA 3FQOA 4KJLA 1YHOA 3SH2A 4DDRA 3K47A 3QGTA 5EAJA 3GI2A 4I1NA 1MVSA 1KMVA 3DL5A 3EELA 3EX8A 2H2QA 5E8QA 1OHJA 4KAKA 3FRAX 4G3MA 5HSRA 1DISA 3TQ8A 5HI6A 2W3AA 4P3RA 3NZ6X 1S3YA 2ANQA 2BL9A 4KM0A 4M6JA 4KNEA 1RD7A 3DG8A 3FQVA 2D0KA 3DRCA 3FY9X 1OHKA 2BLCA 2D5NA 2W3BA 3TQ9A 4Q0EA 1DR1A 3TQAA 3FYWX 4G95A 3M08A 4QI9A 4ELBA 1RA9A 5HVBA 4H97A 1RX8A 1RX7A 3JWKA 1U70A 1DDRA 4GH8A 5HF0X 1PDBA 5HQZA 4IXFX 3QLZA 4KLXA 1DG7A 1DHFA 5HT5A 3NZBX 3QFXA 3SRWX 1D1GA 4Q6AA 4XT5A 3ZPCA 1RX2A 3QLSA 3R33A 5JA3A 3NXXA 6DFRA 1DF7A 1HFPA 1DG8A 1KLKA 1MVTA 2OIPA 1IA1A 1RX3A 3I3RA 4FGGA 4ECKA 1RA2A 4KYAA 4KJJA 3HJ3A 4HOGA 2ZZAA 3SRSX 2W9SA 1SEJA 3F91A 1ZDRA 3QYOA 1JOMA 1DHJA 3JWFA 4H96A 3DL6A 2KGKA 3IA4A 4HOFA 3VCOA 3K2HA 4IXGX 3FRFX 1LUDA 4PSTA 5HSUA 4X5HA 4NX6A 3KFYA 2B3ZA 1AI9A 1DG5A 3FL8A 1HFQA 3N0HA 4KBNA 4H98A 3K74A 3L3RA 4EILA 3HBBA 2INQA 5U26A 1AO8A 3JSUA 3QLRA 3LG4A 4QJCA 5DXVA 3GHWA 4P3QA 3F0BX 1RX9A 2DRCA 3FRDX 3FL9A 2C2TA 3E0BA 4X5GA 1RX4A 3NRRA 3JTWA 5HQYA 4KY8A 1U71A 5HT4A 3SQYX 3SRUX 4FGHA 3KJSA 2HM9A 1RB2A 1VJ3A 3QLXA 3RG9A 3F0SX 3JW5A 4EIGA 1DLSA 1TDRA 1DR6A
chains in the Genus database with same CATH topology
4EIZA 4KD7A 1DYHA 3NZDA 2W3VA 1QZFA 4ELGA 1RA1A 2BLBA 3UM8A 4FHBA 2BLAA 2OBCA 3JWCA 3F8YA 3NZ9X 1RX1A 2AZNA 1AOEA 4PTJA 3EIGA 3FS6A 1DYJA 3NZAX 1DRHA 3QLYA 3JWMA 4TU5X 2QK8A 3F8ZA 3GHVA 4DP3A 4M2XA 1E26A 4Q67A 1VDRA 5CC9A 3DATA 4P68A 4P66A 1DIUA 1JUVA 1J3KA 7DFRA 5HVEA 1LY3A 1J3IA 1RE7A 3NZCX 4LAHX 3NTZA 2LF1A 2W9GA 3NXTA 4DFRA 3SRQX 3M09A 3F0XX 4XT8A 3ZPGA 4M7VA 5DFRA 4RGCA 1LY4A 4HOEA 2DHFA 4ELFA 3DFRA 4G8ZX 5ECXA 1BOZA 4KY4A 1J3JA 3KGYA 2GD9A 5JG0X 1HFRA 3INVA 4XT7A 4DPHA 2HQPA 1RH3A 1DR5A 3TQBA 1DYIA 3CD2A 1M79A 5CCCA 5HPBA 4LEKX 5FDAA 3FQCA 4Q0DA 4QLGA 3SA2A 3ROAA 4NX7A 3S3VA 3UM6A 3GHCA 3NXOA 3F0VX 4M6KA 1RX5A 2W9HA 2C2SA 3EEJA 1IA4A 3F0UX 4CD2A 5U27A 3TD8A 1PD9A 3SRRX 2P4GA 3NU0A 1IA3A 3RO9A 3QL0A 3SGYA 2W3MA 4OSGA 1RA8A 3NXRA 1DR7A 4LAEX 3QYLA 3JVXA 3I8AX 4H95A 1S3VA 3QLWA 3IRNA 3FY8X 1DAJA 1KMSA 3FRBX 1CZ3A 1RG7A 3S9UA 3SA1A 1M7AA 3KY8A 4QHVA 1S3WA 1DRFA 4M7UA 1DR2A 8DFRA 4HA7A 3EEKA 3F0QX 3NXYA 3FYVX 4PSSA 4DPDA 2FZHA 1RB3A 1U72A 1M78A 1DLRA 3S7AA 3DGAA 4LAGX 1PD8A 5HUIA 3JW3A 3FQFA 1DRAA 2CIGA 4KFJA 4I13A 3SR5X 2FZJA 3QG2A 3UM5A 3DAUA 3D80A 4PSYA 3IRMA 1DRBA 1CD2A 4QJZD 4KM2A 3OAFA 2O7PA 4QLFA 3K45A 5ECCA 2HXVA 1RA3A 4XT4A 3IX9A 2CD2A 3CSEA 4QLEA 1DR3A 3IA5A 3OCHA 3IROA 4X5JA 4OR7A 3CLBA 1RC4A 3Q1HA 4PTHA 4X5IA 3FREX 1RF7A 4KL9A 2JYBA 4XT6A 4XE6X 4KEBA 1DHIA 5HF2X 1DYRA 3GYFA 3SAIA 4KJKA 4M6LA 1BZFA 3NXVA 1RX6A 3FQ0A 4EJ1A 3D84X 2W3WA 1DR4A 1JOLA 4HA9A 2ITHA 3CL9A 2L28A 3FQZA 1DDSA 3QL3A 1IA2A 2G6VA 2W9TA 3EEMA 1DREA 4ELEA 2ANOA 4XRBA 3KJRA 1S3UA 4PDJA 4X5FA 4IXED 2FZIA 4XECX 2XW7A 4ELHA 3FQOA 4KJLA 1YHOA 3SH2A 4DDRA 3K47A 3QGTA 5EAJA 3GI2A 4I1NA 1MVSA 1KMVA 3DL5A 3EELA 3EX8A 2H2QA 5E8QA 1OHJA 4KAKA 3FRAX 4G3MA 5HSRA 1DISA 3TQ8A 5HI6A 2W3AA 4P3RA 3NZ6X 1S3YA 2ANQA 2BL9A 4KM0A 4M6JA 4KNEA 1RD7A 3DG8A 3FQVA 2D0KA 3DRCA 3FY9X 1OHKA 2BLCA 2D5NA 2W3BA 3TQ9A 4Q0EA 1DR1A 3TQAA 3FYWX 4G95A 3M08A 4QI9A 4ELBA 1RA9A 5HVBA 4H97A 1RX8A 1RX7A 3JWKA 1U70A 1DDRA 4GH8A 5HF0X 1PDBA 5HQZA 4IXFX 3QLZA 4KLXA 1DG7A 1DHFA 5HT5A 3NZBX 3QFXA 3SRWX 1D1GA 4Q6AA 4XT5A 3ZPCA 1RX2A 3QLSA 3R33A 5JA3A 3NXXA 6DFRA 1DF7A 1HFPA 1DG8A 1KLKA 1MVTA 2OIPA 1IA1A 1RX3A 3I3RA 4FGGA 4ECKA 1RA2A 4KYAA 4KJJA 3HJ3A 4HOGA 2ZZAA 3SRSX 2W9SA 1SEJA 3F91A 1ZDRA 3QYOA 1JOMA 1DHJA 3JWFA 4H96A 3DL6A 2KGKA 3IA4A 4HOFA 3VCOA 3K2HA 4IXGX 3FRFX 1LUDA 4PSTA 5HSUA 4X5HA 4NX6A 3KFYA 2B3ZA 1AI9A 1DG5A 3FL8A 1HFQA 3N0HA 4KBNA 4H98A 3K74A 3L3RA 4EILA 3HBBA 2INQA 5U26A 1AO8A 3JSUA 3QLRA 3LG4A 4QJCA 5DXVA 3GHWA 4P3QA 3F0BX 1RX9A 2DRCA 3FRDX 3FL9A 2C2TA 3E0BA 4X5GA 1RX4A 3NRRA 3JTWA 5HQYA 4KY8A 1U71A 5HT4A 3SQYX 3SRUX 4FGHA 3KJSA 2HM9A 1RB2A 1VJ3A 3QLXA 3RG9A 3F0SX 3JW5A 4EIGA 1DLSA 1TDRA 1DR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIZ A;  4KD7 A;  1DYH A;  3NZD A;  2W3V A;  1QZF A;  4ELG A;  1RA1 A;  2BLB A;  3UM8 A;  4FHB A;  2BLA A;  2OBC A;  3JWC A;  3F8Y A;  3NZ9 X;  1RX1 A;  2AZN A;  1AOE A;  4PTJ A;  3EIG A;  3FS6 A;  1DYJ A;  3NZA X;  1DRH A;  3QLY A;  3JWM A;  4TU5 X;  2QK8 A;  3F8Z A;  3GHV A;  4DP3 A;  4M2X A;  1E26 A;  4Q67 A;  1VDR A;  5CC9 A;  3DAT A;  4P68 A;  4P66 A;  1DIU A;  1JUV A;  1J3K A;  7DFR A;  5HVE A;  1LY3 A;  1J3I A;  1RE7 A;  3NZC X;  4LAH X;  3NTZ A;  2LF1 A;  2W9G A;  3NXT A;  4DFR A;  3SRQ X;  3M09 A;  3F0X X;  4XT8 A;  3ZPG A;  4M7V A;  5DFR A;  4RGC A;  1LY4 A;  4HOE A;  2DHF A;  4ELF A;  3DFR A;  4G8Z X;  5ECX A;  1BOZ A;  4KY4 A;  1J3J A;  3KGY A;  2GD9 A;  5JG0 X;  1HFR A;  3INV A;  4XT7 A;  4DPH A;  2HQP A;  1RH3 A;  1DR5 A;  3TQB A;  1DYI A;  3CD2 A;  1M79 A;  5CCC A;  5HPB A;  4LEK X;  5FDA A;  3FQC A;  4Q0D A;  4QLG A;  3SA2 A;  3ROA A;  4NX7 A;  3S3V A;  3UM6 A;  3GHC A;  3NXO A;  3F0V X;  4M6K A;  1RX5 A;  2W9H A;  2C2S A;  3EEJ A;  1IA4 A;  3F0U X;  4CD2 A;  5U27 A;  3TD8 A;  1PD9 A;  3SRR X;  2P4G A;  3NU0 A;  1IA3 A;  3RO9 A;  3QL0 A;  3SGY A;  2W3M A;  4OSG A;  1RA8 A;  3NXR A;  1DR7 A;  4LAE X;  3QYL A;  3JVX A;  3I8A X;  4H95 A;  1S3V A;  3QLW A;  3IRN A;  3FY8 X;  1DAJ A;  1KMS A;  3FRB X;  1CZ3 A;  1RG7 A;  3S9U A;  3SA1 A;  1M7A A;  3KY8 A;  4QHV A;  1S3W A;  1DRF A;  4M7U A;  1DR2 A;  8DFR A;  4HA7 A;  3EEK A;  3F0Q X;  3NXY A;  3FYV X;  4PSS A;  4DPD A;  2FZH A;  1RB3 A;  1U72 A;  1M78 A;  1DLR A;  3S7A A;  3DGA A;  4LAG X;  1PD8 A;  5HUI A;  3JW3 A;  3FQF A;  1DRA A;  2CIG A;  4KFJ A;  4I13 A;  3SR5 X;  2FZJ A;  3QG2 A;  3UM5 A;  3DAU A;  3D80 A;  4PSY A;  3IRM A;  1DRB A;  1CD2 A;  4QJZ D;  4KM2 A;  3OAF A;  2O7P A;  4QLF A;  3K45 A;  5ECC A;  2HXV A;  1RA3 A;  4XT4 A;  3IX9 A;  2CD2 A;  3CSE A;  4QLE A;  1DR3 A;  3IA5 A;  3OCH A;  3IRO A;  4X5J A;  4OR7 A;  3CLB A;  1RC4 A;  3Q1H A;  4PTH A;  4X5I A;  3FRE X;  1RF7 A;  4KL9 A;  2JYB A;  4XT6 A;  4XE6 X;  4KEB A;  1DHI A;  5HF2 X;  1DYR A;  3GYF A;  3SAI A;  4KJK A;  4M6L A;  1BZF A;  3NXV A;  1RX6 A;  3FQ0 A;  4EJ1 A;  3D84 X;  2W3W A;  1DR4 A;  1JOL A;  4HA9 A;  2ITH A;  3CL9 A;  2L28 A;  3FQZ A;  1DDS A;  3QL3 A;  1IA2 A;  2G6V A;  2W9T A;  3EEM A;  1DRE A;  4ELE A;  2ANO A;  4XRB A;  3KJR A;  1S3U A;  4PDJ A;  4X5F A;  4IXE D;  2FZI A;  4XEC X;  2XW7 A;  4ELH A;  3FQO A;  4KJL A;  1YHO A;  3SH2 A;  4DDR A;  3K47 A;  3QGT A;  5EAJ A;  3GI2 A;  4I1N A;  1MVS A;  1KMV A;  3DL5 A;  3EEL A;  3EX8 A;  2H2Q A;  5E8Q A;  1OHJ A;  4KAK A;  3FRA X;  4G3M A;  5HSR A;  1DIS A;  3TQ8 A;  5HI6 A;  2W3A A;  4P3R A;  3NZ6 X;  1S3Y A;  2ANQ A;  2BL9 A;  4KM0 A;  4M6J A;  4KNE A;  1RD7 A;  3DG8 A;  3FQV A;  2D0K A;  3DRC A;  3FY9 X;  1OHK A;  2BLC A;  2D5N A;  2W3B A;  3TQ9 A;  4Q0E A;  1DR1 A;  3TQA A;  3FYW X;  4G95 A;  3M08 A;  4QI9 A;  4ELB A;  1RA9 A;  5HVB A;  4H97 A;  1RX8 A;  1RX7 A;  3JWK A;  1U70 A;  1DDR A;  4GH8 A;  5HF0 X;  1PDB A;  5HQZ A;  4IXF X;  3QLZ A;  4KLX A;  1DG7 A;  1DHF A;  5HT5 A;  3NZB X;  3QFX A;  3SRW X;  1D1G A;  4Q6A A;  4XT5 A;  3ZPC A;  1RX2 A;  3QLS A;  3R33 A;  5JA3 A;  3NXX A;  6DFR A;  1DF7 A;  1HFP A;  1DG8 A;  1KLK A;  1MVT A;  2OIP A;  1IA1 A;  1RX3 A;  3I3R A;  4FGG A;  4ECK A;  1RA2 A;  4KYA A;  4KJJ A;  3HJ3 A;  4HOG A;  2ZZA A;  3SRS X;  2W9S A;  1SEJ A;  3F91 A;  1ZDR A;  3QYO A;  1JOM A;  1DHJ A;  3JWF A;  4H96 A;  3DL6 A;  2KGK A;  3IA4 A;  4HOF A;  3VCO A;  3K2H A;  4IXG X;  3FRF X;  1LUD A;  4PST A;  5HSU A;  4X5H A;  4NX6 A;  3KFY A;  2B3Z A;  1AI9 A;  1DG5 A;  3FL8 A;  1HFQ A;  3N0H A;  4KBN A;  4H98 A;  3K74 A;  3L3R A;  4EIL A;  3HBB A;  2INQ A;  5U26 A;  1AO8 A;  3JSU A;  3QLR A;  3LG4 A;  4QJC A;  5DXV A;  3GHW A;  4P3Q A;  3F0B X;  1RX9 A;  2DRC A;  3FRD X;  3FL9 A;  2C2T A;  3E0B A;  4X5G A;  1RX4 A;  3NRR A;  3JTW A;  5HQY A;  4KY8 A;  1U71 A;  5HT4 A;  3SQY X;  3SRU X;  4FGH A;  3KJS A;  2HM9 A;  1RB2 A;  1VJ3 A;  3QLX A;  3RG9 A;  3F0S X;  3JW5 A;  4EIG A;  1DLS A;  1TDR A;  1DR6 A; 
#chains in the Genus database with same CATH topology
 4EIZ A;  4KD7 A;  1DYH A;  3NZD A;  2W3V A;  1QZF A;  4ELG A;  1RA1 A;  2BLB A;  3UM8 A;  4FHB A;  2BLA A;  2OBC A;  3JWC A;  3F8Y A;  3NZ9 X;  1RX1 A;  2AZN A;  1AOE A;  4PTJ A;  3EIG A;  3FS6 A;  1DYJ A;  3NZA X;  1DRH A;  3QLY A;  3JWM A;  4TU5 X;  2QK8 A;  3F8Z A;  3GHV A;  4DP3 A;  4M2X A;  1E26 A;  4Q67 A;  1VDR A;  5CC9 A;  3DAT A;  4P68 A;  4P66 A;  1DIU A;  1JUV A;  1J3K A;  7DFR A;  5HVE A;  1LY3 A;  1J3I A;  1RE7 A;  3NZC X;  4LAH X;  3NTZ A;  2LF1 A;  2W9G A;  3NXT A;  4DFR A;  3SRQ X;  3M09 A;  3F0X X;  4XT8 A;  3ZPG A;  4M7V A;  5DFR A;  4RGC A;  1LY4 A;  4HOE A;  2DHF A;  4ELF A;  3DFR A;  4G8Z X;  5ECX A;  1BOZ A;  4KY4 A;  1J3J A;  3KGY A;  2GD9 A;  5JG0 X;  1HFR A;  3INV A;  4XT7 A;  4DPH A;  2HQP A;  1RH3 A;  1DR5 A;  3TQB A;  1DYI A;  3CD2 A;  1M79 A;  5CCC A;  5HPB A;  4LEK X;  5FDA A;  3FQC A;  4Q0D A;  4QLG A;  3SA2 A;  3ROA A;  4NX7 A;  3S3V A;  3UM6 A;  3GHC A;  3NXO A;  3F0V X;  4M6K A;  1RX5 A;  2W9H A;  2C2S A;  3EEJ A;  1IA4 A;  3F0U X;  4CD2 A;  5U27 A;  3TD8 A;  1PD9 A;  3SRR X;  2P4G A;  3NU0 A;  1IA3 A;  3RO9 A;  3QL0 A;  3SGY A;  2W3M A;  4OSG A;  1RA8 A;  3NXR A;  1DR7 A;  4LAE X;  3QYL A;  3JVX A;  3I8A X;  4H95 A;  1S3V A;  3QLW A;  3IRN A;  3FY8 X;  1DAJ A;  1KMS A;  3FRB X;  1CZ3 A;  1RG7 A;  3S9U A;  3SA1 A;  1M7A A;  3KY8 A;  4QHV A;  1S3W A;  1DRF A;  4M7U A;  1DR2 A;  8DFR A;  4HA7 A;  3EEK A;  3F0Q X;  3NXY A;  3FYV X;  4PSS A;  4DPD A;  2FZH A;  1RB3 A;  1U72 A;  1M78 A;  1DLR A;  3S7A A;  3DGA A;  4LAG X;  1PD8 A;  5HUI A;  3JW3 A;  3FQF A;  1DRA A;  2CIG A;  4KFJ A;  4I13 A;  3SR5 X;  2FZJ A;  3QG2 A;  3UM5 A;  3DAU A;  3D80 A;  4PSY A;  3IRM A;  1DRB A;  1CD2 A;  4QJZ D;  4KM2 A;  3OAF A;  2O7P A;  4QLF A;  3K45 A;  5ECC A;  2HXV A;  1RA3 A;  4XT4 A;  3IX9 A;  2CD2 A;  3CSE A;  4QLE A;  1DR3 A;  3IA5 A;  3OCH A;  3IRO A;  4X5J A;  4OR7 A;  3CLB A;  1RC4 A;  3Q1H A;  4PTH A;  4X5I A;  3FRE X;  1RF7 A;  4KL9 A;  2JYB A;  4XT6 A;  4XE6 X;  4KEB A;  1DHI A;  5HF2 X;  1DYR A;  3GYF A;  3SAI A;  4KJK A;  4M6L A;  1BZF A;  3NXV A;  1RX6 A;  3FQ0 A;  4EJ1 A;  3D84 X;  2W3W A;  1DR4 A;  1JOL A;  4HA9 A;  2ITH A;  3CL9 A;  2L28 A;  3FQZ A;  1DDS A;  3QL3 A;  1IA2 A;  2G6V A;  2W9T A;  3EEM A;  1DRE A;  4ELE A;  2ANO A;  4XRB A;  3KJR A;  1S3U A;  4PDJ A;  4X5F A;  4IXE D;  2FZI A;  4XEC X;  2XW7 A;  4ELH A;  3FQO A;  4KJL A;  1YHO A;  3SH2 A;  4DDR A;  3K47 A;  3QGT A;  5EAJ A;  3GI2 A;  4I1N A;  1MVS A;  1KMV A;  3DL5 A;  3EEL A;  3EX8 A;  2H2Q A;  5E8Q A;  1OHJ A;  4KAK A;  3FRA X;  4G3M A;  5HSR A;  1DIS A;  3TQ8 A;  5HI6 A;  2W3A A;  4P3R A;  3NZ6 X;  1S3Y A;  2ANQ A;  2BL9 A;  4KM0 A;  4M6J A;  4KNE A;  1RD7 A;  3DG8 A;  3FQV A;  2D0K A;  3DRC A;  3FY9 X;  1OHK A;  2BLC A;  2D5N A;  2W3B A;  3TQ9 A;  4Q0E A;  1DR1 A;  3TQA A;  3FYW X;  4G95 A;  3M08 A;  4QI9 A;  4ELB A;  1RA9 A;  5HVB A;  4H97 A;  1RX8 A;  1RX7 A;  3JWK A;  1U70 A;  1DDR A;  4GH8 A;  5HF0 X;  1PDB A;  5HQZ A;  4IXF X;  3QLZ A;  4KLX A;  1DG7 A;  1DHF A;  5HT5 A;  3NZB X;  3QFX A;  3SRW X;  1D1G A;  4Q6A A;  4XT5 A;  3ZPC A;  1RX2 A;  3QLS A;  3R33 A;  5JA3 A;  3NXX A;  6DFR A;  1DF7 A;  1HFP A;  1DG8 A;  1KLK A;  1MVT A;  2OIP A;  1IA1 A;  1RX3 A;  3I3R A;  4FGG A;  4ECK A;  1RA2 A;  4KYA A;  4KJJ A;  3HJ3 A;  4HOG A;  2ZZA A;  3SRS X;  2W9S A;  1SEJ A;  3F91 A;  1ZDR A;  3QYO A;  1JOM A;  1DHJ A;  3JWF A;  4H96 A;  3DL6 A;  2KGK A;  3IA4 A;  4HOF A;  3VCO A;  3K2H A;  4IXG X;  3FRF X;  1LUD A;  4PST A;  5HSU A;  4X5H A;  4NX6 A;  3KFY A;  2B3Z A;  1AI9 A;  1DG5 A;  3FL8 A;  1HFQ A;  3N0H A;  4KBN A;  4H98 A;  3K74 A;  3L3R A;  4EIL A;  3HBB A;  2INQ A;  5U26 A;  1AO8 A;  3JSU A;  3QLR A;  3LG4 A;  4QJC A;  5DXV A;  3GHW A;  4P3Q A;  3F0B X;  1RX9 A;  2DRC A;  3FRD X;  3FL9 A;  2C2T A;  3E0B A;  4X5G A;  1RX4 A;  3NRR A;  3JTW A;  5HQY A;  4KY8 A;  1U71 A;  5HT4 A;  3SQY X;  3SRU X;  4FGH A;  3KJS A;  2HM9 A;  1RB2 A;  1VJ3 A;  3QLX A;  3RG9 A;  3F0S X;  3JW5 A;  4EIG A;  1DLS A;  1TDR A;  1DR6 A; 
#chains in the Genus database with same CATH homology
 4EIZ A;  4KD7 A;  1DYH A;  3NZD A;  2W3V A;  1QZF A;  4ELG A;  1RA1 A;  2BLB A;  3UM8 A;  4FHB A;  2BLA A;  2OBC A;  3JWC A;  3F8Y A;  3NZ9 X;  1RX1 A;  2AZN A;  1AOE A;  4PTJ A;  3EIG A;  3FS6 A;  1DYJ A;  3NZA X;  1DRH A;  3QLY A;  3JWM A;  4TU5 X;  2QK8 A;  3F8Z A;  3GHV A;  4DP3 A;  4M2X A;  1E26 A;  4Q67 A;  1VDR A;  5CC9 A;  3DAT A;  4P68 A;  4P66 A;  1DIU A;  1JUV A;  1J3K A;  7DFR A;  5HVE A;  1LY3 A;  1J3I A;  1RE7 A;  3NZC X;  4LAH X;  3NTZ A;  2LF1 A;  2W9G A;  3NXT A;  4DFR A;  3SRQ X;  3M09 A;  3F0X X;  4XT8 A;  3ZPG A;  4M7V A;  5DFR A;  4RGC A;  1LY4 A;  4HOE A;  2DHF A;  4ELF A;  3DFR A;  4G8Z X;  5ECX A;  1BOZ A;  4KY4 A;  1J3J A;  3KGY A;  2GD9 A;  5JG0 X;  1HFR A;  3INV A;  4XT7 A;  4DPH A;  2HQP A;  1RH3 A;  1DR5 A;  3TQB A;  1DYI A;  3CD2 A;  1M79 A;  5CCC A;  5HPB A;  4LEK X;  5FDA A;  3FQC A;  4Q0D A;  4QLG A;  3SA2 A;  3ROA A;  4NX7 A;  3S3V A;  3UM6 A;  3GHC A;  3NXO A;  3F0V X;  4M6K A;  1RX5 A;  2W9H A;  2C2S A;  3EEJ A;  1IA4 A;  3F0U X;  4CD2 A;  5U27 A;  3TD8 A;  1PD9 A;  3SRR X;  2P4G A;  3NU0 A;  1IA3 A;  3RO9 A;  3QL0 A;  3SGY A;  2W3M A;  4OSG A;  1RA8 A;  3NXR A;  1DR7 A;  4LAE X;  3QYL A;  3JVX A;  3I8A X;  4H95 A;  1S3V A;  3QLW A;  3IRN A;  3FY8 X;  1DAJ A;  1KMS A;  3FRB X;  1CZ3 A;  1RG7 A;  3S9U A;  3SA1 A;  1M7A A;  3KY8 A;  4QHV A;  1S3W A;  1DRF A;  4M7U A;  1DR2 A;  8DFR A;  4HA7 A;  3EEK A;  3F0Q X;  3NXY A;  3FYV X;  4PSS A;  4DPD A;  2FZH A;  1RB3 A;  1U72 A;  1M78 A;  1DLR A;  3S7A A;  3DGA A;  4LAG X;  1PD8 A;  5HUI A;  3JW3 A;  3FQF A;  1DRA A;  2CIG A;  4KFJ A;  4I13 A;  3SR5 X;  2FZJ A;  3QG2 A;  3UM5 A;  3DAU A;  3D80 A;  4PSY A;  3IRM A;  1DRB A;  1CD2 A;  4QJZ D;  4KM2 A;  3OAF A;  2O7P A;  4QLF A;  3K45 A;  5ECC A;  2HXV A;  1RA3 A;  4XT4 A;  3IX9 A;  2CD2 A;  3CSE A;  4QLE A;  1DR3 A;  3IA5 A;  3OCH A;  3IRO A;  4X5J A;  4OR7 A;  3CLB A;  1RC4 A;  3Q1H A;  4PTH A;  4X5I A;  3FRE X;  1RF7 A;  4KL9 A;  2JYB A;  4XT6 A;  4XE6 X;  4KEB A;  1DHI A;  5HF2 X;  1DYR A;  3GYF A;  3SAI A;  4KJK A;  4M6L A;  1BZF A;  3NXV A;  1RX6 A;  3FQ0 A;  4EJ1 A;  3D84 X;  2W3W A;  1DR4 A;  1JOL A;  4HA9 A;  2ITH A;  3CL9 A;  2L28 A;  3FQZ A;  1DDS A;  3QL3 A;  1IA2 A;  2G6V A;  2W9T A;  3EEM A;  1DRE A;  4ELE A;  2ANO A;  4XRB A;  3KJR A;  1S3U A;  4PDJ A;  4X5F A;  4IXE D;  2FZI A;  4XEC X;  2XW7 A;  4ELH A;  3FQO A;  4KJL A;  1YHO A;  3SH2 A;  4DDR A;  3K47 A;  3QGT A;  5EAJ A;  3GI2 A;  4I1N A;  1MVS A;  1KMV A;  3DL5 A;  3EEL A;  3EX8 A;  2H2Q A;  5E8Q A;  1OHJ A;  4KAK A;  3FRA X;  4G3M A;  5HSR A;  1DIS A;  3TQ8 A;  5HI6 A;  2W3A A;  4P3R A;  3NZ6 X;  1S3Y A;  2ANQ A;  2BL9 A;  4KM0 A;  4M6J A;  4KNE A;  1RD7 A;  3DG8 A;  3FQV A;  2D0K A;  3DRC A;  3FY9 X;  1OHK A;  2BLC A;  2D5N A;  2W3B A;  3TQ9 A;  4Q0E A;  1DR1 A;  3TQA A;  3FYW X;  4G95 A;  3M08 A;  4QI9 A;  4ELB A;  1RA9 A;  5HVB A;  4H97 A;  1RX8 A;  1RX7 A;  3JWK A;  1U70 A;  1DDR A;  4GH8 A;  5HF0 X;  1PDB A;  5HQZ A;  4IXF X;  3QLZ A;  4KLX A;  1DG7 A;  1DHF A;  5HT5 A;  3NZB X;  3QFX A;  3SRW X;  1D1G A;  4Q6A A;  4XT5 A;  3ZPC A;  1RX2 A;  3QLS A;  3R33 A;  5JA3 A;  3NXX A;  6DFR A;  1DF7 A;  1HFP A;  1DG8 A;  1KLK A;  1MVT A;  2OIP A;  1IA1 A;  1RX3 A;  3I3R A;  4FGG A;  4ECK A;  1RA2 A;  4KYA A;  4KJJ A;  3HJ3 A;  4HOG A;  2ZZA A;  3SRS X;  2W9S A;  1SEJ A;  3F91 A;  1ZDR A;  3QYO A;  1JOM A;  1DHJ A;  3JWF A;  4H96 A;  3DL6 A;  2KGK A;  3IA4 A;  4HOF A;  3VCO A;  3K2H A;  4IXG X;  3FRF X;  1LUD A;  4PST A;  5HSU A;  4X5H A;  4NX6 A;  3KFY A;  2B3Z A;  1AI9 A;  1DG5 A;  3FL8 A;  1HFQ A;  3N0H A;  4KBN A;  4H98 A;  3K74 A;  3L3R A;  4EIL A;  3HBB A;  2INQ A;  5U26 A;  1AO8 A;  3JSU A;  3QLR A;  3LG4 A;  4QJC A;  5DXV A;  3GHW A;  4P3Q A;  3F0B X;  1RX9 A;  2DRC A;  3FRD X;  3FL9 A;  2C2T A;  3E0B A;  4X5G A;  1RX4 A;  3NRR A;  3JTW A;  5HQY A;  4KY8 A;  1U71 A;  5HT4 A;  3SQY X;  3SRU X;  4FGH A;  3KJS A;  2HM9 A;  1RB2 A;  1VJ3 A;  3QLX A;  3RG9 A;  3F0S X;  3JW5 A;  4EIG A;  1DLS A;  1TDR A;  1DR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...