3SEKC

Crystal structure of the myostatin:follistatin-like 3 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
201
Chain Sequence
GVCWLQATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb
molecule keywords Growth/differentiation factor 8
molecule tags Signaling protein
source organism Mus musculus
total genus 37
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3sekC01
1UZQA 3SGQI 1CGJI 2BUSA 1UZPA 1YTPA 4SGBI 2SGQI 2N71A 2N17A 1Y1BA 1HPTA 2QQDA 1UZJA 1M8BA 2B0UC 2P6AC 3QTLD 1DS3I 2ARPF 4GI3C 1M8CA 2ERWA 1SGYI 1LR8A 2N52A 1OVOA 1CSOI 3SGBI 1CHOI 2NU0I 2NU3I 3TJQA 2W86A 3SEKC 1H0ZA 2KMOA 1R0RI 1DS2I 1HDLA 2XRCA 4HGUA 2LEOA 1SGRI 1CGII 1KSQA 1BUSA 2KCXA 1APJA 2OVOA 1UVGA 1SGQI 1IY6A 1TGSI 1UZKA 2WCYA 1LR9A 1FYBA 2GKVA 2JXDA 1AN1I 1SGNI 1NUBA 1MT1A 1OMTA 1Z7KB 3OVOA 5DAEA 1PPFI 1OMUA 1SGEI 2NU2I 2GKTI 1TIHA 1N13A 2SGDI 2GKRI 1SGPI 1TBRR 5JHWC 1UUCA 2JZMA 1TBQR 2F3CI 1Y1CA 2V53A 1PJUA 1TURA 2M5XA 4OVOA 1CT4I 2KMQA 2SGPI 2JYYA 1KMAA 1LR7A 1HJAI 1YU6C 2NU4I 2KMRA 1CE3A 1BMOA 3HH2C 3B4VC 1CT0I 2NU1I 2QQCA 1PCEA 1TUSA 2SGFI 1IY5A 1OYVI 1SGDI 1UVFA 1CT2I 2KMPA 1IW4A 2SGEI
chains in the Genus database with same CATH superfamily
2ORVA 1XBTA 1FY7A 2YUUA 3D00A 3SGQI 1UZQA 1WGCA 3UEJA 3OL0A 1CGJI 1MJBA 2BUSA 2A20A 2E5RA 1UZPA 3R5AA 1MJ9A 2QQ0A 1TBNA 1YTPA 3UGDA 4SGBI 2SGQI 9WGAA 2N71A 3VE5A 3UGIA 1UHAA 1V1HA 1W4RA 1HPTA 1Y1BA 2N17A 1XA6A 2QQDA 2UVOA 3QAHA 3R5CA 2JW6A 3UOEA 1UZJA 1M8BA 1NXUA 2B0UC 2K9HA 2P6AC 2PQ8A 1KBEA 2Y0MA 2N1AB 3RU0A 3QTLD 1MJAA 2UZ3A 3UEYA 2ENZA 1DS3I 5CCLA 2CJSC 2ARPF 4GI3C 2LB7A 1W3SA 1M8CA 1FARA 2ERWA 1SGYI 1TOTA 3PDNA 1LR8A 2N52A 5FUWA 1OVOA 1ULKA 1CSOI 3SGBI 1PTQA 2B8TA 5FUYA 1CHOI 2NU0I 2NU3I 3TJQA 2VRWB 1Z2IA 4WP4A 1ULNA 2W86A 4FKDA 3SEKC 2OZUA 2L8EA 1H0ZA 2L7XA 4JCVE 5E3RA 3TO6A 2CWGA 2KMOA 1P9GA 1R0RI 3GOXA 1TBOA 2ODDA 1DS2I 2OU2A 1HDLA 1HEVA 1ULMA 2XRCA 2OD1A 4HGUA 1X4SA 2CWFA 2LEOA 1SGRI 2DKVA 1CGII 2WGCA 1KSQA 2FNFX 1K7UA 1BUSA 3R5BA 4B6DA 2KCXA 2LUYA 1FAQA 1APJA 2OVOA 1U5KA 1UVGA 4E1RA 4UXJA 1SGQI 4L9MA 5EX3A 3TO7A 1IY6A 1TGSI 1WGTA 2X52A 1K7TA 2GVIA 3UFFA 1UZKA 1P9ZA 1K7VA 2WCYA 1WTJA 3E59A 1LR9A 3OXLA 2RIJA 2V1CA 5HQ8A 1FYBA 2QQEA 2GKVA 2JXDA 1R79A 1AN1I 1SGNI 1NUBA 5FUVA 1MT1A 2QPOA 3UGLA 1PTRA 1OMTA 3TOAA 1S20A 1Z7KB 3OVOA 5DAEA 2ROWA 1PPFI 2W0TA 1RFHA 1OMUA 1SGEI 2RC4A 5CCMA 2NU2I 3R5DA 2GKTI 1TIHA 5J8FA 1XX6A 3MEKA 1N13A 2J87A 2SGDI 2X3TA 3BJIA 4UXIA 7WGAA 2GKRI 1SGPI 1TBRR 5JHWC 3FC3A 1UUCA 2JZMA 2YQPA 3OXGA 2V1CC 1TBQR 1WKXA 2ENNA 5E3PA 2F3CI 3OXFA 1Y1CA 2V53A 4E1PA 3FSYA 3TO9A 1PJUA 1TURA 2M5XA 4DNCA 4OVOA 5J8CA 3CXLA 1CT4I 2KMQA 2GIVA 5EX0A 2SGPI 2ELIA 1Q9BA 2JYYA 1KMAA 1LR7A 1HJAI 1YU6C 2NU4I 2KMRA 3E2IA 5HI7A 1CE3A 1VDDA 2JA1A 3VDPA 1BMOA 3QWPA 4MPIA 3HH2C 2J9RA 1CT0I 3B4VC 2NU1I 4UXHA 2QQCA 5E3QA 1PCEA 1TUSA 4AMLA 2SGFI 3FSXA 2ORWA 2WVJA 1IY5A 1V1IA 1OYVI 3VDUA 1Y8FA 2DIPA 1SGDI 3TOBA 1UVFA 1CT2I 2DB6A 2KMPA 1X74A 2CWHA 3KY9A 5FUXA 4A24A 1IW4A 1KBFA 2E73A 2SGEI
chains in the Genus database with same CATH topology
2ORVA 1XBTA 2YUUA 3D00A 3SGQI 1UZQA 3UEJA 3OL0A 1CGJI 2BUSA 2A20A 2E5RA 1UZPA 2QQ0A 1TBNA 1YTPA 3UGDA 4SGBI 2SGQI 2N71A 3VE5A 3UGIA 1V1HA 1W4RA 1HPTA 1Y1BA 2N17A 1XA6A 2QQDA 2JW6A 1UZJA 1M8BA 2K9HA 2B0UC 2P6AC 1KBEA 2N1AB 3RU0A 3QTLD 2UZ3A 3UEYA 2ENZA 1DS3I 5CCLA 2CJSC 2ARPF 4GI3C 1W3SA 1M8CA 1FARA 2ERWA 1SGYI 1TOTA 3PDNA 1LR8A 2N52A 5FUWA 1OVOA 1CSOI 3SGBI 1PTQA 2B8TA 5FUYA 1CHOI 2NU0I 2NU3I 3TJQA 2VRWB 2W86A 4FKDA 3SEKC 2L8EA 1H0ZA 2L7XA 4JCVE 3GOXA 2KMOA 1R0RI 1TBOA 2ODDA 1DS2I 1HDLA 2XRCA 2OD1A 4HGUA 1X4SA 2LEOA 1SGRI 1CGII 1KSQA 2FNFX 1BUSA 4B6DA 2KCXA 2LUYA 1FAQA 1APJA 2OVOA 1U5KA 1UVGA 4E1RA 4UXJA 1SGQI 4L9MA 5EX3A 1IY6A 1TGSI 2GVIA 3UFFA 1UZKA 2WCYA 3E59A 1LR9A 3OXLA 5HQ8A 2V1CA 1FYBA 2QQEA 2GKVA 2JXDA 1R79A 1AN1I 1SGNI 1NUBA 5FUVA 1MT1A 2QPOA 3UGLA 1PTRA 1OMTA 1Z7KB 3OVOA 5DAEA 2ROWA 1PPFI 2W0TA 1RFHA 1OMUA 1SGEI 5CCMA 2NU2I 2GKTI 1TIHA 1XX6A 3MEKA 1N13A 2J87A 2SGDI 3BJIA 4UXIA 2GKRI 1SGPI 1TBRR 5JHWC 3FC3A 1UUCA 2JZMA 2YQPA 3OXGA 2V1CC 1TBQR 2ENNA 2F3CI 3OXFA 1Y1CA 2V53A 4E1PA 1PJUA 1TURA 2M5XA 4OVOA 3CXLA 1CT4I 2KMQA 5EX0A 2SGPI 2ELIA 2JYYA 1KMAA 1LR7A 1HJAI 1YU6C 2NU4I 2KMRA 3E2IA 5HI7A 1CE3A 1VDDA 2JA1A 3VDPA 1BMOA 3QWPA 3HH2C 2J9RA 1CT0I 3B4VC 2NU1I 4UXHA 2QQCA 1PCEA 1TUSA 2SGFI 2ORWA 2WVJA 1IY5A 1V1IA 1OYVI 3VDUA 1Y8FA 2DIPA 1SGDI 4A24A 1UVFA 1CT2I 2DB6A 2KMPA 1X74A 3KY9A 5FUXA 1IW4A 1KBFA 2E73A 2SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZQ A;  3SGQ I;  1CGJ I;  2BUS A;  1UZP A;  1YTP A;  4SGB I;  2SGQ I;  2N71 A;  2N17 A;  1Y1B A;  1HPT A;  2QQD A;  1UZJ A;  1M8B A;  2B0U C;  2P6A C;  3QTL D;  1DS3 I;  2ARP F;  4GI3 C;  1M8C A;  2ERW A;  1SGY I;  1LR8 A;  2N52 A;  1OVO A;  1CSO I;  3SGB I;  1CHO I;  2NU0 I;  2NU3 I;  3TJQ A;  2W86 A;  3SEK C;  1H0Z A;  2KMO A;  1R0R I;  1DS2 I;  1HDL A;  2XRC A;  4HGU A;  2LEO A;  1SGR I;  1CGI I;  1KSQ A;  1BUS A;  2KCX A;  1APJ A;  2OVO A;  1UVG A;  1SGQ I;  1IY6 A;  1TGS I;  1UZK A;  2WCY A;  1LR9 A;  1FYB A;  2GKV A;  2JXD A;  1AN1 I;  1SGN I;  1NUB A;  1MT1 A;  1OMT A;  1Z7K B;  3OVO A;  5DAE A;  1PPF I;  1OMU A;  1SGE I;  2NU2 I;  2GKT I;  1TIH A;  1N13 A;  2SGD I;  2GKR I;  1SGP I;  1TBR R;  5JHW C;  1UUC A;  2JZM A;  1TBQ R;  2F3C I;  1Y1C A;  2V53 A;  1PJU A;  1TUR A;  2M5X A;  4OVO A;  1CT4 I;  2KMQ A;  2SGP I;  2JYY A;  1KMA A;  1LR7 A;  1HJA I;  1YU6 C;  2NU4 I;  2KMR A;  1CE3 A;  1BMO A;  3HH2 C;  3B4V C;  1CT0 I;  2NU1 I;  2QQC A;  1PCE A;  1TUS A;  2SGF I;  1IY5 A;  1OYV I;  1SGD I;  1UVF A;  1CT2 I;  2KMP A;  1IW4 A;  2SGE I; 
#chains in the Genus database with same CATH topology
 2ORV A;  1XBT A;  1FY7 A;  2YUU A;  3D00 A;  3SGQ I;  1UZQ A;  1WGC A;  3UEJ A;  3OL0 A;  1CGJ I;  1MJB A;  2BUS A;  2A20 A;  2E5R A;  1UZP A;  3R5A A;  1MJ9 A;  2QQ0 A;  1TBN A;  1YTP A;  3UGD A;  4SGB I;  2SGQ I;  9WGA A;  2N71 A;  3VE5 A;  3UGI A;  1UHA A;  1V1H A;  1W4R A;  1HPT A;  1Y1B A;  2N17 A;  1XA6 A;  2QQD A;  2UVO A;  3QAH A;  3R5C A;  2JW6 A;  3UOE A;  1UZJ A;  1M8B A;  1NXU A;  2B0U C;  2K9H A;  2P6A C;  2PQ8 A;  1KBE A;  2Y0M A;  2N1A B;  3RU0 A;  3QTL D;  1MJA A;  2UZ3 A;  3UEY A;  2ENZ A;  1DS3 I;  5CCL A;  2CJS C;  2ARP F;  4GI3 C;  2LB7 A;  1W3S A;  1M8C A;  1FAR A;  2ERW A;  1SGY I;  1TOT A;  3PDN A;  1LR8 A;  2N52 A;  5FUW A;  1OVO A;  1ULK A;  1CSO I;  3SGB I;  1PTQ A;  2B8T A;  5FUY A;  1CHO I;  2NU0 I;  2NU3 I;  3TJQ A;  2VRW B;  1Z2I A;  4WP4 A;  1ULN A;  2W86 A;  4FKD A;  3SEK C;  2OZU A;  2L8E A;  1H0Z A;  2L7X A;  4JCV E;  5E3R A;  3TO6 A;  2CWG A;  2KMO A;  1P9G A;  1R0R I;  3GOX A;  1TBO A;  2ODD A;  1DS2 I;  2OU2 A;  1HDL A;  1HEV A;  1ULM A;  2XRC A;  2OD1 A;  4HGU A;  1X4S A;  2CWF A;  2LEO A;  1SGR I;  2DKV A;  1CGI I;  2WGC A;  1KSQ A;  2FNF X;  1K7U A;  1BUS A;  3R5B A;  4B6D A;  2KCX A;  2LUY A;  1FAQ A;  1APJ A;  2OVO A;  1U5K A;  1UVG A;  4E1R A;  4UXJ A;  1SGQ I;  4L9M A;  5EX3 A;  3TO7 A;  1IY6 A;  1TGS I;  1WGT A;  2X52 A;  1K7T A;  2GVI A;  3UFF A;  1UZK A;  1P9Z A;  1K7V A;  2WCY A;  1WTJ A;  3E59 A;  1LR9 A;  3OXL A;  2RIJ A;  2V1C A;  5HQ8 A;  1FYB A;  2QQE A;  2GKV A;  2JXD A;  1R79 A;  1AN1 I;  1SGN I;  1NUB A;  5FUV A;  1MT1 A;  2QPO A;  3UGL A;  1PTR A;  1OMT A;  3TOA A;  1S20 A;  1Z7K B;  3OVO A;  5DAE A;  2ROW A;  1PPF I;  2W0T A;  1RFH A;  1OMU A;  1SGE I;  2RC4 A;  5CCM A;  2NU2 I;  3R5D A;  2GKT I;  1TIH A;  5J8F A;  1XX6 A;  3MEK A;  1N13 A;  2J87 A;  2SGD I;  2X3T A;  3BJI A;  4UXI A;  7WGA A;  2GKR I;  1SGP I;  1TBR R;  5JHW C;  3FC3 A;  1UUC A;  2JZM A;  2YQP A;  3OXG A;  2V1C C;  1TBQ R;  1WKX A;  2ENN A;  5E3P A;  2F3C I;  3OXF A;  1Y1C A;  2V53 A;  4E1P A;  3FSY A;  3TO9 A;  1PJU A;  1TUR A;  2M5X A;  4DNC A;  4OVO A;  5J8C A;  3CXL A;  1CT4 I;  2KMQ A;  2GIV A;  5EX0 A;  2SGP I;  2ELI A;  1Q9B A;  2JYY A;  1KMA A;  1LR7 A;  1HJA I;  1YU6 C;  2NU4 I;  2KMR A;  3E2I A;  5HI7 A;  1CE3 A;  1VDD A;  2JA1 A;  3VDP A;  1BMO A;  3QWP A;  4MPI A;  3HH2 C;  2J9R A;  1CT0 I;  3B4V C;  2NU1 I;  4UXH A;  2QQC A;  5E3Q A;  1PCE A;  1TUS A;  4AML A;  2SGF I;  3FSX A;  2ORW A;  2WVJ A;  1IY5 A;  1V1I A;  1OYV I;  3VDU A;  1Y8F A;  2DIP A;  1SGD I;  3TOB A;  1UVF A;  1CT2 I;  2DB6 A;  2KMP A;  1X74 A;  2CWH A;  3KY9 A;  5FUX A;  4A24 A;  1IW4 A;  1KBF A;  2E73 A;  2SGE I; 
#chains in the Genus database with same CATH homology
 2ORV A;  1XBT A;  2YUU A;  3D00 A;  3SGQ I;  1UZQ A;  3UEJ A;  3OL0 A;  1CGJ I;  2BUS A;  2A20 A;  2E5R A;  1UZP A;  2QQ0 A;  1TBN A;  1YTP A;  3UGD A;  4SGB I;  2SGQ I;  2N71 A;  3VE5 A;  3UGI A;  1V1H A;  1W4R A;  1HPT A;  1Y1B A;  2N17 A;  1XA6 A;  2QQD A;  2JW6 A;  1UZJ A;  1M8B A;  2K9H A;  2B0U C;  2P6A C;  1KBE A;  2N1A B;  3RU0 A;  3QTL D;  2UZ3 A;  3UEY A;  2ENZ A;  1DS3 I;  5CCL A;  2CJS C;  2ARP F;  4GI3 C;  1W3S A;  1M8C A;  1FAR A;  2ERW A;  1SGY I;  1TOT A;  3PDN A;  1LR8 A;  2N52 A;  5FUW A;  1OVO A;  1CSO I;  3SGB I;  1PTQ A;  2B8T A;  5FUY A;  1CHO I;  2NU0 I;  2NU3 I;  3TJQ A;  2VRW B;  2W86 A;  4FKD A;  3SEK C;  2L8E A;  1H0Z A;  2L7X A;  4JCV E;  3GOX A;  2KMO A;  1R0R I;  1TBO A;  2ODD A;  1DS2 I;  1HDL A;  2XRC A;  2OD1 A;  4HGU A;  1X4S A;  2LEO A;  1SGR I;  1CGI I;  1KSQ A;  2FNF X;  1BUS A;  4B6D A;  2KCX A;  2LUY A;  1FAQ A;  1APJ A;  2OVO A;  1U5K A;  1UVG A;  4E1R A;  4UXJ A;  1SGQ I;  4L9M A;  5EX3 A;  1IY6 A;  1TGS I;  2GVI A;  3UFF A;  1UZK A;  2WCY A;  3E59 A;  1LR9 A;  3OXL A;  5HQ8 A;  2V1C A;  1FYB A;  2QQE A;  2GKV A;  2JXD A;  1R79 A;  1AN1 I;  1SGN I;  1NUB A;  5FUV A;  1MT1 A;  2QPO A;  3UGL A;  1PTR A;  1OMT A;  1Z7K B;  3OVO A;  5DAE A;  2ROW A;  1PPF I;  2W0T A;  1RFH A;  1OMU A;  1SGE I;  5CCM A;  2NU2 I;  2GKT I;  1TIH A;  1XX6 A;  3MEK A;  1N13 A;  2J87 A;  2SGD I;  3BJI A;  4UXI A;  2GKR I;  1SGP I;  1TBR R;  5JHW C;  3FC3 A;  1UUC A;  2JZM A;  2YQP A;  3OXG A;  2V1C C;  1TBQ R;  2ENN A;  2F3C I;  3OXF A;  1Y1C A;  2V53 A;  4E1P A;  1PJU A;  1TUR A;  2M5X A;  4OVO A;  3CXL A;  1CT4 I;  2KMQ A;  5EX0 A;  2SGP I;  2ELI A;  2JYY A;  1KMA A;  1LR7 A;  1HJA I;  1YU6 C;  2NU4 I;  2KMR A;  3E2I A;  5HI7 A;  1CE3 A;  1VDD A;  2JA1 A;  3VDP A;  1BMO A;  3QWP A;  3HH2 C;  2J9R A;  1CT0 I;  3B4V C;  2NU1 I;  4UXH A;  2QQC A;  1PCE A;  1TUS A;  2SGF I;  2ORW A;  2WVJ A;  1IY5 A;  1V1I A;  1OYV I;  3VDU A;  1Y8F A;  2DIP A;  1SGD I;  4A24 A;  1UVF A;  1CT2 I;  2DB6 A;  2KMP A;  1X74 A;  3KY9 A;  5FUX A;  1IW4 A;  1KBF A;  2E73 A;  2SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...