3SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
molecule keywords Streptogrisin B
molecule tags Hydrolase/hydrolase inhibitor
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sgqI00
1DS3I 1UUCA 2KMQA 1OMUA 1OMTA 2KMRA 1AN1I 4HGUA 2GKVA 1CT4I 1Y1BA 1CGJI 1OVOA 1OYVI 1SGRI 1SGPI 1TBRR 1Z7KB 1SGYI 1PJUA 1TIHA 2BUSA 1CT0I 1MT1A 2SGDI 2KMOA 1IW4A 1M8BA 1Y1CA 1UVGA 1H0ZA 2V53A 2NU1I 1HPTA 2XRCA 1M8CA 1CT2I 1CE3A 4OVOA 2SGFI 1TUSA 1N13A 1HJAI 1CGII 3SGBI 1BUSA 2NU4I 1PCEA 2M5XA 2QQDA 2ARPF 1BMOA 3QTLD 2WCYA 1KMAA 2KMPA 2N52A 3TJQA 1HDLA 3OVOA 2JZMA 1TBQR 1YU6C 2NU3I 1TURA 1TGSI 1LR7A 2JYYA 2SGPI 1DS2I 3SEKC 2GKRI 2GKTI 5JHWC 1FYBA 2LEOA 3HH2C 3SGQI 2B0UC 3B4VC 2QQCA 2SGQI 2NU2I 2OVOA 2N71A 2KCXA 1LR8A 2JXDA 1LR9A 1IY5A 2NU0I 1CSOI 2ERWA 1SGQI 1R0RI 4SGBI 2P6AC 1CHOI 1YTPA 1NUBA 2SGEI 1SGEI 2F3CI 4GI3C 2N17A 1SGDI 1PPFI 1SGNI 5DAEA 1IY6A 1UVFA
chains in the Genus database with same CATH superfamily
1UHAA 4E1RA 2K9HA 1DS3I 1UUCA 2KMQA 1XBTA 3D00A 3OXLA 5E3PA 1OMUA 1Z2IA 1OMTA 5FUXA 5FUYA 1Q9BA 1WGTA 1AN1I 1ULMA 2KMRA 2GKVA 3CXLA 1CT4I 4HGUA 1Y1BA 1CGJI 2W0TA 1OVOA 1OYVI 1SGRI 1SGPI 1TBRR 1Z7KB 1SGYI 2Y0MA 1PJUA 1TIHA 3TOBA 2BUSA 2QQEA 4AMLA 1CT0I 1KBEA 2ORWA 4MPIA 5EX0A 3VE5A 1P9ZA 4WP4A 4B6DA 1MT1A 2SGDI 2YUUA 2V1CA 5CCMA 2L8EA 2KMOA 1HEVA 1RFHA 2DB6A 1IW4A 1V1HA 2UVOA 1M8BA 1Y1CA 1UVGA 1H0ZA 3R5CA 2RC4A 4UXIA 2V53A 4E1PA 2E73A 2QPOA 1TBOA 2DKVA 3FSXA 5E3QA 1FY7A 2ENZA 2NU1I 1HPTA 1R79A 4UXHA 3TO9A 1P9GA 3TO7A 2XRCA 1M8CA 3OXFA 1CT2I 1NXUA 3TO6A 1CE3A 2V1CC 1PTRA 4OVOA 2SGFI 1TUSA 1N13A 5FUVA 3QWPA 5FUWA 1HJAI 2LB7A 3UFFA 1CGII 2J9RA 3SGBI 3UGDA 5HI7A 5HQ8A 1BUSA 1ULKA 5J8CA 3R5BA 1WKXA 3VDUA 2B8TA 2DIPA 2ROWA 2CWHA 2NU4I 1MJ9A 1PCEA 2M5XA 2QQDA 2X52A 2OU2A 7WGAA 3R5DA 2CJSC 2ARPF 1BMOA 3PDNA 3QTLD 1K7VA 1WGCA 2WCYA 1KMAA 2UZ3A 2KMPA 2N52A 3TJQA 1HDLA 3OVOA 2WVJA 2JZMA 3UGLA 3GOXA 1TBQR 2OZUA 3OL0A 1V1IA 1YU6C 2RIJA 4FKDA 1FARA 3VDPA 2NU3I 3FSYA 2ODDA 3R5AA 1VDDA 1TURA 4JCVE 3UGIA 1PTQA 1TGSI 3TOAA 1LR7A 2JYYA 2SGPI 3BJIA 1DS2I 3SEKC 1TBNA 1MJBA 9WGAA 4UXJA 2GKRI 2GKTI 1TOTA 1W3SA 2JA1A 2YQPA 5JHWC 3RU0A 1FYBA 2LEOA 2WGCA 3HH2C 2X3TA 2B0UC 3SGQI 3FC3A 2JW6A 3B4VC 1K7UA 1W4RA 2ORVA 2QQCA 2SGQI 1X4SA 2J87A 2NU2I 1KBFA 2FNFX 2CWGA 2OVOA 2N71A 2QQ0A 2GIVA 2KCXA 2PQ8A 1U5KA 3MEKA 1LR8A 2JXDA 2ELIA 1LR9A 1Y8FA 1IY5A 3E59A 1S20A 2GVIA 2NU0I 1CSOI 4L9MA 2ERWA 1X74A 5CCLA 1ULNA 1K7TA 2VRWB 5J8FA 1SGQI 1R0RI 1XA6A 3E2IA 3KY9A 2P6AC 1CHOI 1YTPA 2N1AB 4SGBI 5EX3A 3QAHA 1NUBA 2SGEI 3UEJA 4A24A 1SGEI 2LUYA 4DNCA 2E5RA 2F3CI 1MJAA 4GI3C 1FAQA 2N17A 1SGDI 1PPFI 2L7XA 3OXGA 2OD1A 3UEYA 1WTJA 1SGNI 2CWFA 3UOEA 5E3RA 2A20A 5DAEA 1IY6A 2ENNA 1XX6A 1UVFA
chains in the Genus database with same CATH topology
4E1RA 2K9HA 1DS3I 1UUCA 2KMQA 1XBTA 3D00A 3OXLA 1OMUA 1OMTA 5FUXA 5FUYA 1AN1I 2KMRA 4HGUA 2GKVA 3CXLA 1CT4I 1Y1BA 1CGJI 2W0TA 1OVOA 1OYVI 1SGRI 1SGPI 1TBRR 1Z7KB 1SGYI 1PJUA 1TIHA 2BUSA 2QQEA 1CT0I 1KBEA 2ORWA 5EX0A 3VE5A 4B6DA 1MT1A 2SGDI 2YUUA 2V1CA 5CCMA 2L8EA 2KMOA 1RFHA 2DB6A 1IW4A 1V1HA 1M8BA 1Y1CA 1UVGA 1H0ZA 4UXIA 2V53A 4E1PA 2E73A 2QPOA 1TBOA 2ENZA 2NU1I 1HPTA 1R79A 4UXHA 2XRCA 1M8CA 3OXFA 1CT2I 1CE3A 2V1CC 1PTRA 4OVOA 2SGFI 1TUSA 1N13A 5FUVA 3QWPA 5FUWA 1HJAI 5CCLA 3UFFA 1CGII 2J9RA 3SGBI 3UGDA 5HI7A 5HQ8A 1BUSA 3VDUA 2B8TA 2DIPA 2ROWA 2NU4I 1PCEA 2M5XA 2QQDA 2CJSC 2ARPF 1BMOA 3PDNA 3QTLD 2WCYA 1KMAA 2UZ3A 2KMPA 2N52A 3TJQA 1HDLA 3OVOA 2WVJA 2JZMA 3UGLA 3GOXA 1TBQR 3OL0A 1V1IA 1YU6C 4FKDA 1FARA 3VDPA 2NU3I 2ODDA 1VDDA 1TURA 4JCVE 3UGIA 1PTQA 1TGSI 1LR7A 2JYYA 2SGPI 3BJIA 1DS2I 3SEKC 1TBNA 4UXJA 2GKRI 2GKTI 1TOTA 1W3SA 2JA1A 2YQPA 5JHWC 3RU0A 1FYBA 2LEOA 3HH2C 3SGQI 2B0UC 3FC3A 2JW6A 3B4VC 1W4RA 2ORVA 2QQCA 2SGQI 1X4SA 2J87A 2NU2I 1KBFA 2FNFX 2OVOA 2N71A 2QQ0A 2KCXA 1U5KA 3MEKA 1LR8A 2JXDA 2ELIA 1LR9A 1Y8FA 1IY5A 3E59A 4L9MA 2GVIA 2NU0I 1CSOI 2ERWA 1X74A 2VRWB 1SGQI 1R0RI 1XA6A 3E2IA 3KY9A 2P6AC 1CHOI 1YTPA 2N1AB 4SGBI 5EX3A 3UEJA 1NUBA 2SGEI 4A24A 1SGEI 2LUYA 2E5RA 2F3CI 4GI3C 1FAQA 2N17A 1SGDI 1PPFI 2L7XA 3OXGA 2OD1A 3UEYA 1SGNI 2A20A 5DAEA 1IY6A 2ENNA 1XX6A 1UVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DS3 I;  1UUC A;  2KMQ A;  1OMU A;  1OMT A;  2KMR A;  1AN1 I;  4HGU A;  2GKV A;  1CT4 I;  1Y1B A;  1CGJ I;  1OVO A;  1OYV I;  1SGR I;  1SGP I;  1TBR R;  1Z7K B;  1SGY I;  1PJU A;  1TIH A;  2BUS A;  1CT0 I;  1MT1 A;  2SGD I;  2KMO A;  1IW4 A;  1M8B A;  1Y1C A;  1UVG A;  1H0Z A;  2V53 A;  2NU1 I;  1HPT A;  2XRC A;  1M8C A;  1CT2 I;  1CE3 A;  4OVO A;  2SGF I;  1TUS A;  1N13 A;  1HJA I;  1CGI I;  3SGB I;  1BUS A;  2NU4 I;  1PCE A;  2M5X A;  2QQD A;  2ARP F;  1BMO A;  3QTL D;  2WCY A;  1KMA A;  2KMP A;  2N52 A;  3TJQ A;  1HDL A;  3OVO A;  2JZM A;  1TBQ R;  1YU6 C;  2NU3 I;  1TUR A;  1TGS I;  1LR7 A;  2JYY A;  2SGP I;  1DS2 I;  3SEK C;  2GKR I;  2GKT I;  5JHW C;  1FYB A;  2LEO A;  3HH2 C;  3SGQ I;  2B0U C;  3B4V C;  2QQC A;  2SGQ I;  2NU2 I;  2OVO A;  2N71 A;  2KCX A;  1LR8 A;  2JXD A;  1LR9 A;  1IY5 A;  2NU0 I;  1CSO I;  2ERW A;  1SGQ I;  1R0R I;  4SGB I;  2P6A C;  1CHO I;  1YTP A;  1NUB A;  2SGE I;  1SGE I;  2F3C I;  4GI3 C;  2N17 A;  1SGD I;  1PPF I;  1SGN I;  5DAE A;  1IY6 A;  1UVF A; 
#chains in the Genus database with same CATH topology
 1UHA A;  4E1R A;  2K9H A;  1DS3 I;  1UUC A;  2KMQ A;  1XBT A;  3D00 A;  3OXL A;  5E3P A;  1OMU A;  1Z2I A;  1OMT A;  5FUX A;  5FUY A;  1Q9B A;  1WGT A;  1AN1 I;  1ULM A;  2KMR A;  2GKV A;  3CXL A;  1CT4 I;  4HGU A;  1Y1B A;  1CGJ I;  2W0T A;  1OVO A;  1OYV I;  1SGR I;  1SGP I;  1TBR R;  1Z7K B;  1SGY I;  2Y0M A;  1PJU A;  1TIH A;  3TOB A;  2BUS A;  2QQE A;  4AML A;  1CT0 I;  1KBE A;  2ORW A;  4MPI A;  5EX0 A;  3VE5 A;  1P9Z A;  4WP4 A;  4B6D A;  1MT1 A;  2SGD I;  2YUU A;  2V1C A;  5CCM A;  2L8E A;  2KMO A;  1HEV A;  1RFH A;  2DB6 A;  1IW4 A;  1V1H A;  2UVO A;  1M8B A;  1Y1C A;  1UVG A;  1H0Z A;  3R5C A;  2RC4 A;  4UXI A;  2V53 A;  4E1P A;  2E73 A;  2QPO A;  1TBO A;  2DKV A;  3FSX A;  5E3Q A;  1FY7 A;  2ENZ A;  2NU1 I;  1HPT A;  1R79 A;  4UXH A;  3TO9 A;  1P9G A;  3TO7 A;  2XRC A;  1M8C A;  3OXF A;  1CT2 I;  1NXU A;  3TO6 A;  1CE3 A;  2V1C C;  1PTR A;  4OVO A;  2SGF I;  1TUS A;  1N13 A;  5FUV A;  3QWP A;  5FUW A;  1HJA I;  2LB7 A;  3UFF A;  1CGI I;  2J9R A;  3SGB I;  3UGD A;  5HI7 A;  5HQ8 A;  1BUS A;  1ULK A;  5J8C A;  3R5B A;  1WKX A;  3VDU A;  2B8T A;  2DIP A;  2ROW A;  2CWH A;  2NU4 I;  1MJ9 A;  1PCE A;  2M5X A;  2QQD A;  2X52 A;  2OU2 A;  7WGA A;  3R5D A;  2CJS C;  2ARP F;  1BMO A;  3PDN A;  3QTL D;  1K7V A;  1WGC A;  2WCY A;  1KMA A;  2UZ3 A;  2KMP A;  2N52 A;  3TJQ A;  1HDL A;  3OVO A;  2WVJ A;  2JZM A;  3UGL A;  3GOX A;  1TBQ R;  2OZU A;  3OL0 A;  1V1I A;  1YU6 C;  2RIJ A;  4FKD A;  1FAR A;  3VDP A;  2NU3 I;  3FSY A;  2ODD A;  3R5A A;  1VDD A;  1TUR A;  4JCV E;  3UGI A;  1PTQ A;  1TGS I;  3TOA A;  1LR7 A;  2JYY A;  2SGP I;  3BJI A;  1DS2 I;  3SEK C;  1TBN A;  1MJB A;  9WGA A;  4UXJ A;  2GKR I;  2GKT I;  1TOT A;  1W3S A;  2JA1 A;  2YQP A;  5JHW C;  3RU0 A;  1FYB A;  2LEO A;  2WGC A;  3HH2 C;  2X3T A;  2B0U C;  3SGQ I;  3FC3 A;  2JW6 A;  3B4V C;  1K7U A;  1W4R A;  2ORV A;  2QQC A;  2SGQ I;  1X4S A;  2J87 A;  2NU2 I;  1KBF A;  2FNF X;  2CWG A;  2OVO A;  2N71 A;  2QQ0 A;  2GIV A;  2KCX A;  2PQ8 A;  1U5K A;  3MEK A;  1LR8 A;  2JXD A;  2ELI A;  1LR9 A;  1Y8F A;  1IY5 A;  3E59 A;  1S20 A;  2GVI A;  2NU0 I;  1CSO I;  4L9M A;  2ERW A;  1X74 A;  5CCL A;  1ULN A;  1K7T A;  2VRW B;  5J8F A;  1SGQ I;  1R0R I;  1XA6 A;  3E2I A;  3KY9 A;  2P6A C;  1CHO I;  1YTP A;  2N1A B;  4SGB I;  5EX3 A;  3QAH A;  1NUB A;  2SGE I;  3UEJ A;  4A24 A;  1SGE I;  2LUY A;  4DNC A;  2E5R A;  2F3C I;  1MJA A;  4GI3 C;  1FAQ A;  2N17 A;  1SGD I;  1PPF I;  2L7X A;  3OXG A;  2OD1 A;  3UEY A;  1WTJ A;  1SGN I;  2CWF A;  3UOE A;  5E3R A;  2A20 A;  5DAE A;  1IY6 A;  2ENN A;  1XX6 A;  1UVF A; 
#chains in the Genus database with same CATH homology
 4E1R A;  2K9H A;  1DS3 I;  1UUC A;  2KMQ A;  1XBT A;  3D00 A;  3OXL A;  1OMU A;  1OMT A;  5FUX A;  5FUY A;  1AN1 I;  2KMR A;  4HGU A;  2GKV A;  3CXL A;  1CT4 I;  1Y1B A;  1CGJ I;  2W0T A;  1OVO A;  1OYV I;  1SGR I;  1SGP I;  1TBR R;  1Z7K B;  1SGY I;  1PJU A;  1TIH A;  2BUS A;  2QQE A;  1CT0 I;  1KBE A;  2ORW A;  5EX0 A;  3VE5 A;  4B6D A;  1MT1 A;  2SGD I;  2YUU A;  2V1C A;  5CCM A;  2L8E A;  2KMO A;  1RFH A;  2DB6 A;  1IW4 A;  1V1H A;  1M8B A;  1Y1C A;  1UVG A;  1H0Z A;  4UXI A;  2V53 A;  4E1P A;  2E73 A;  2QPO A;  1TBO A;  2ENZ A;  2NU1 I;  1HPT A;  1R79 A;  4UXH A;  2XRC A;  1M8C A;  3OXF A;  1CT2 I;  1CE3 A;  2V1C C;  1PTR A;  4OVO A;  2SGF I;  1TUS A;  1N13 A;  5FUV A;  3QWP A;  5FUW A;  1HJA I;  5CCL A;  3UFF A;  1CGI I;  2J9R A;  3SGB I;  3UGD A;  5HI7 A;  5HQ8 A;  1BUS A;  3VDU A;  2B8T A;  2DIP A;  2ROW A;  2NU4 I;  1PCE A;  2M5X A;  2QQD A;  2CJS C;  2ARP F;  1BMO A;  3PDN A;  3QTL D;  2WCY A;  1KMA A;  2UZ3 A;  2KMP A;  2N52 A;  3TJQ A;  1HDL A;  3OVO A;  2WVJ A;  2JZM A;  3UGL A;  3GOX A;  1TBQ R;  3OL0 A;  1V1I A;  1YU6 C;  4FKD A;  1FAR A;  3VDP A;  2NU3 I;  2ODD A;  1VDD A;  1TUR A;  4JCV E;  3UGI A;  1PTQ A;  1TGS I;  1LR7 A;  2JYY A;  2SGP I;  3BJI A;  1DS2 I;  3SEK C;  1TBN A;  4UXJ A;  2GKR I;  2GKT I;  1TOT A;  1W3S A;  2JA1 A;  2YQP A;  5JHW C;  3RU0 A;  1FYB A;  2LEO A;  3HH2 C;  3SGQ I;  2B0U C;  3FC3 A;  2JW6 A;  3B4V C;  1W4R A;  2ORV A;  2QQC A;  2SGQ I;  1X4S A;  2J87 A;  2NU2 I;  1KBF A;  2FNF X;  2OVO A;  2N71 A;  2QQ0 A;  2KCX A;  1U5K A;  3MEK A;  1LR8 A;  2JXD A;  2ELI A;  1LR9 A;  1Y8F A;  1IY5 A;  3E59 A;  4L9M A;  2GVI A;  2NU0 I;  1CSO I;  2ERW A;  1X74 A;  2VRW B;  1SGQ I;  1R0R I;  1XA6 A;  3E2I A;  3KY9 A;  2P6A C;  1CHO I;  1YTP A;  2N1A B;  4SGB I;  5EX3 A;  3UEJ A;  1NUB A;  2SGE I;  4A24 A;  1SGE I;  2LUY A;  2E5R A;  2F3C I;  4GI3 C;  1FAQ A;  2N17 A;  1SGD I;  1PPF I;  2L7X A;  3OXG A;  2OD1 A;  3UEY A;  1SGN I;  2A20 A;  5DAE A;  1IY6 A;  2ENN A;  1XX6 A;  1UVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...