3SJTA

Crystal structure of human arginase i in complex with the inhibitor me-abh, resolution 1.60 a, twinned structure
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
313
structure length
313
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of alpha,alpha-Disubstituted Amino Acids to Arginase Suggests New Avenues for Inhibitor Design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 114
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3sjtA00
4IXUA 3E9BA 4HZEA 4RHIA 4IU5A 4IU0A 4GSVA 3GMZA 1P8NA 1P8OA 4Q40A 3SL1A 3PZLA 3MJLA 3SJTA 3MMRA 4G3HA 1T5GA 2ZAVA 2EF4A 4GWDA 2PHAA 3LHLA 4IE1A 4Q3QA 4MYKA 1TBHA 3THEA 5CEVA 4HXQA 1XFKA 2RLAA 3NIOA 2A0MA 1T4PA 3NIQA 1P8SA 4Q3VA 2EIVA 1WVAA 4ITYA 4RHMA 1T4RA 4IXVA 4Q3RC 4IU4A 3E6VA 4MYLA 3LP7A 1WVBA 3E8QA 3SKKA 5HJAA 3THHA 1HQGA 1ZPEA 3LP4A 3THJA 1ZPGA 1CEVA 3E6KA 4RLAA 3MFWA 5RLAA 4HWWA 4RHQA 4IE3A 1HQXA 4Q3TA 1D3VA 2AEBA 1P8QA 3MFVA 3SL0A 1WOGA 3F80A 2CEVA 1HQHA 3DJ8A 2PLLA 1T4SA 1T5FA 4GWCA 3GN0A 4MYNA 1GQ7A 4MXRA 3M1RA 4IE2A 1R1OA 4Q3PA 3TH7A 1P8RA 3CEVA 5HJ9A 3E8ZA 4RHJA 1TA1A 4Q42A 1HQ5A 4Q3UA 4FCKA 1HQFA 4Q3RA 4GSMA 4RHLA 4MYFA 1P8MA 4FCIA 3TF3A 1WOHA 4RHKA 4GSZA 3RLAA 2PHOA 3NIPA 4DZ4A 1RLAA 1WOIA 4I06A 3KV2A 1P8PA 2EF5A 4IU1A 4CEVA 1T4TA 1TBLA 4Q3SA 4Q41A 1PQ3A 1GQ6A 1TBJA
chains in the Genus database with same CATH superfamily
4IXUA 3E9BA 4HZEA 4RHIA 5EFGA 3EWFA 4IU5A 4IU0A 1T69A 4CQFA 4GSVA 3GMZA 1P8NA 5EFHA 1P8OA 4ZUPA 4Q40A 1VKGA 3SL1A 3PZLA 3EZPA 3MJLA 5G0IA 3MMRA 3Q9CA 5EFNA 5THTA 4G3HA 4ZURA 3SJTA 4BZ7A 5A2SA 1T5GA 2ZAVA 4QA0A 2EF4A 4GWDA 1ZZ1A 4QA4A 4BZ5A 2PHAA 3LHLA 5IX0A 5G1AA 4IE1A 3MZ7A 4Q3QA 4MYKA 5G10A 1TBHA 5EFBD 3C0ZA 3THEA 3C0YA 2VCGA 5CEVA 4HXQA 1XFKA 5EFKB 2RLAA 3NIOA 2A0MA 5G0HA 1C3PA 1T4PA 3NIQA 1P8SA 5EEFA 4Q3VA 5JI5A 2EIVA 4ZUOA 4BZ9A 1WVAA 4ITYA 5G0XA 4BZ6A 5G0YA 1W22A 4RHMA 1T4RA 5G12A 5DC8A 4IXVA 1T64A 4Q3RC 4IU4A 3E6VA 4MYLA 3LP7A 1ZZ3A 4QA1A 4RN1A 1WVBA 3E8QA 3SKKA 5HJAA 5G0JA 3THHA 1HQGA 3MAXA 3ZNSA 1ZPEA 3LP4A 5DC5A 5D1BA 2VQJA 4RN2A 3SFFA 3THJA 1ZPGA 1CEVA 3E6KA 5G17A 2VQVA 4RLAA 3MFWA 5RLAA 4HWWA 5EEIA 3MZ3A 5IWGA 4CBTA 3F07A 4RHQA 4ZUQA 5G1BA 4IE3A 1HQXA 5G13A 4QA5A 4Q3TA 1D3VA 5DC6A 2AEBA 1P8QA 1C3RA 3EZTA 3MENA 1WOGA 3MFVA 3F80A 5D1CA 5FCWA 2CEVA 5G0GA 5G11A 3SFHA 1HQHA 3DJ8A 5EF8A 2PLLA 1T4SA 4QA6A 5LI3A 5FUEA 1T5FA 4GWCA 3F0RA 3GN0A 4MYNA 4ZUMA 1GQ7A 3Q9EA 3Q9FA 4MXRA 3M1RA 4IE2A 1R1OA 4Q3PA 3TH7A 4A69A 5THUA 1P8RA 3CEVA 5HJ9A 2VQOA 3E8ZA 4RHJA 5EFJD 1TA1A 4Q42A 1HQ5A 2VQQA 4Q3UA 5ICNB 4FCKA 1ZZ0A 1HQFA 3MZ4A 4Q3RA 3ZNRA 4CBYA 4RN0A 4ZUNA 4GSMA 4RHLA 4MYFA 1P8MA 5D1DA 5G1CA 3Q9BA 4FCIA 2V5WA 4QA2A 3TF3A 1WOHA 4LY1A 5BWZA 4QA7A 2GH6A 2VQWG 4GSZA 4RHKA 1T67A 5EEKA 3RLAA 2PHOA 3NIPA 2V5XA 5THSA 2VQMA 1RLAA 4BKXB 4DZ4A 4QA3A 1WOIA 3C10A 5DC7A 4I06A 3KV2A 1C3SA 4BZ8A 3SL0A 1P8PA 5EENA 5EEMA 2EF5A 4IU1A 3RQDA 3MZ6A 1T4TA 4CEVA 5EF7A 1TBLA 5THVA 3F06A 4Q3SA 3EW8A 4Q41A 1PQ3A 1GQ6A 1TBJA 4LXZA 5G3WA
chains in the Genus database with same CATH topology
4IXUA 3E9BA 4HZEA 4RHIA 4IU5A 4IU0A 4GSVA 3GMZA 1P8NA 1P8OA 4Q40A 3SL1A 3PZLA 3MJLA 3SJTA 3MMRA 4G3HA 1T5GA 2ZAVA 2EF4A 4GWDA 2PHAA 3LHLA 4IE1A 4Q3QA 4MYKA 1TBHA 3THEA 5CEVA 4HXQA 1XFKA 2RLAA 3NIOA 2A0MA 1T4PA 3NIQA 1P8SA 4Q3VA 2EIVA 1WVAA 4ITYA 4RHMA 1T4RA 4IXVA 4Q3RC 4IU4A 3E6VA 4MYLA 3LP7A 1WVBA 3E8QA 3SKKA 5HJAA 3THHA 1HQGA 1ZPEA 3LP4A 3THJA 1ZPGA 1CEVA 3E6KA 4RLAA 3MFWA 5RLAA 4HWWA 4RHQA 4IE3A 1HQXA 4Q3TA 1D3VA 2AEBA 1P8QA 3MFVA 3SL0A 1WOGA 3F80A 2CEVA 1HQHA 3DJ8A 2PLLA 1T4SA 1T5FA 4GWCA 3GN0A 4MYNA 1GQ7A 4MXRA 3M1RA 4IE2A 1R1OA 4Q3PA 3TH7A 1P8RA 3CEVA 5HJ9A 3E8ZA 4RHJA 1TA1A 4Q42A 1HQ5A 4Q3UA 4FCKA 1HQFA 4Q3RA 4GSMA 4RHLA 4MYFA 1P8MA 4FCIA 3TF3A 1WOHA 4RHKA 4GSZA 3RLAA 2PHOA 3NIPA 4DZ4A 1RLAA 1WOIA 4I06A 3KV2A 1P8PA 2EF5A 4IU1A 4CEVA 1T4TA 1TBLA 4Q3SA 4Q41A 1PQ3A 1GQ6A 1TBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXU A;  3E9B A;  4HZE A;  4RHI A;  4IU5 A;  4IU0 A;  4GSV A;  3GMZ A;  1P8N A;  1P8O A;  4Q40 A;  3SL1 A;  3PZL A;  3MJL A;  3SJT A;  3MMR A;  4G3H A;  1T5G A;  2ZAV A;  2EF4 A;  4GWD A;  2PHA A;  3LHL A;  4IE1 A;  4Q3Q A;  4MYK A;  1TBH A;  3THE A;  5CEV A;  4HXQ A;  1XFK A;  2RLA A;  3NIO A;  2A0M A;  1T4P A;  3NIQ A;  1P8S A;  4Q3V A;  2EIV A;  1WVA A;  4ITY A;  4RHM A;  1T4R A;  4IXV A;  4Q3R C;  4IU4 A;  3E6V A;  4MYL A;  3LP7 A;  1WVB A;  3E8Q A;  3SKK A;  5HJA A;  3THH A;  1HQG A;  1ZPE A;  3LP4 A;  3THJ A;  1ZPG A;  1CEV A;  3E6K A;  4RLA A;  3MFW A;  5RLA A;  4HWW A;  4RHQ A;  4IE3 A;  1HQX A;  4Q3T A;  1D3V A;  2AEB A;  1P8Q A;  3MFV A;  3SL0 A;  1WOG A;  3F80 A;  2CEV A;  1HQH A;  3DJ8 A;  2PLL A;  1T4S A;  1T5F A;  4GWC A;  3GN0 A;  4MYN A;  1GQ7 A;  4MXR A;  3M1R A;  4IE2 A;  1R1O A;  4Q3P A;  3TH7 A;  1P8R A;  3CEV A;  5HJ9 A;  3E8Z A;  4RHJ A;  1TA1 A;  4Q42 A;  1HQ5 A;  4Q3U A;  4FCK A;  1HQF A;  4Q3R A;  4GSM A;  4RHL A;  4MYF A;  1P8M A;  4FCI A;  3TF3 A;  1WOH A;  4RHK A;  4GSZ A;  3RLA A;  2PHO A;  3NIP A;  4DZ4 A;  1RLA A;  1WOI A;  4I06 A;  3KV2 A;  1P8P A;  2EF5 A;  4IU1 A;  4CEV A;  1T4T A;  1TBL A;  4Q3S A;  4Q41 A;  1PQ3 A;  1GQ6 A;  1TBJ A; 
#chains in the Genus database with same CATH topology
 4IXU A;  3E9B A;  4HZE A;  4RHI A;  5EFG A;  3EWF A;  4IU5 A;  4IU0 A;  1T69 A;  4CQF A;  4GSV A;  3GMZ A;  1P8N A;  5EFH A;  1P8O A;  4ZUP A;  4Q40 A;  1VKG A;  3SL1 A;  3PZL A;  3EZP A;  3MJL A;  5G0I A;  3MMR A;  3Q9C A;  5EFN A;  5THT A;  4G3H A;  4ZUR A;  3SJT A;  4BZ7 A;  5A2S A;  1T5G A;  2ZAV A;  4QA0 A;  2EF4 A;  4GWD A;  1ZZ1 A;  4QA4 A;  4BZ5 A;  2PHA A;  3LHL A;  5IX0 A;  5G1A A;  4IE1 A;  3MZ7 A;  4Q3Q A;  4MYK A;  5G10 A;  1TBH A;  5EFB D;  3C0Z A;  3THE A;  3C0Y A;  2VCG A;  5CEV A;  4HXQ A;  1XFK A;  5EFK B;  2RLA A;  3NIO A;  2A0M A;  5G0H A;  1C3P A;  1T4P A;  3NIQ A;  1P8S A;  5EEF A;  4Q3V A;  5JI5 A;  2EIV A;  4ZUO A;  4BZ9 A;  1WVA A;  4ITY A;  5G0X A;  4BZ6 A;  5G0Y A;  1W22 A;  4RHM A;  1T4R A;  5G12 A;  5DC8 A;  4IXV A;  1T64 A;  4Q3R C;  4IU4 A;  3E6V A;  4MYL A;  3LP7 A;  1ZZ3 A;  4QA1 A;  4RN1 A;  1WVB A;  3E8Q A;  3SKK A;  5HJA A;  5G0J A;  3THH A;  1HQG A;  3MAX A;  3ZNS A;  1ZPE A;  3LP4 A;  5DC5 A;  5D1B A;  2VQJ A;  4RN2 A;  3SFF A;  3THJ A;  1ZPG A;  1CEV A;  3E6K A;  5G17 A;  2VQV A;  4RLA A;  3MFW A;  5RLA A;  4HWW A;  5EEI A;  3MZ3 A;  5IWG A;  4CBT A;  3F07 A;  4RHQ A;  4ZUQ A;  5G1B A;  4IE3 A;  1HQX A;  5G13 A;  4QA5 A;  4Q3T A;  1D3V A;  5DC6 A;  2AEB A;  1P8Q A;  1C3R A;  3EZT A;  3MEN A;  1WOG A;  3MFV A;  3F80 A;  5D1C A;  5FCW A;  2CEV A;  5G0G A;  5G11 A;  3SFH A;  1HQH A;  3DJ8 A;  5EF8 A;  2PLL A;  1T4S A;  4QA6 A;  5LI3 A;  5FUE A;  1T5F A;  4GWC A;  3F0R A;  3GN0 A;  4MYN A;  4ZUM A;  1GQ7 A;  3Q9E A;  3Q9F A;  4MXR A;  3M1R A;  4IE2 A;  1R1O A;  4Q3P A;  3TH7 A;  4A69 A;  5THU A;  1P8R A;  3CEV A;  5HJ9 A;  2VQO A;  3E8Z A;  4RHJ A;  5EFJ D;  1TA1 A;  4Q42 A;  1HQ5 A;  2VQQ A;  4Q3U A;  5ICN B;  4FCK A;  1ZZ0 A;  1HQF A;  3MZ4 A;  4Q3R A;  3ZNR A;  4CBY A;  4RN0 A;  4ZUN A;  4GSM A;  4RHL A;  4MYF A;  1P8M A;  5D1D A;  5G1C A;  3Q9B A;  4FCI A;  2V5W A;  4QA2 A;  3TF3 A;  1WOH A;  4LY1 A;  5BWZ A;  4QA7 A;  2GH6 A;  2VQW G;  4GSZ A;  4RHK A;  1T67 A;  5EEK A;  3RLA A;  2PHO A;  3NIP A;  2V5X A;  5THS A;  2VQM A;  1RLA A;  4BKX B;  4DZ4 A;  4QA3 A;  1WOI A;  3C10 A;  5DC7 A;  4I06 A;  3KV2 A;  1C3S A;  4BZ8 A;  3SL0 A;  1P8P A;  5EEN A;  5EEM A;  2EF5 A;  4IU1 A;  3RQD A;  3MZ6 A;  1T4T A;  4CEV A;  5EF7 A;  1TBL A;  5THV A;  3F06 A;  4Q3S A;  3EW8 A;  4Q41 A;  1PQ3 A;  1GQ6 A;  1TBJ A;  4LXZ A;  5G3W A; 
#chains in the Genus database with same CATH homology
 4IXU A;  3E9B A;  4HZE A;  4RHI A;  4IU5 A;  4IU0 A;  4GSV A;  3GMZ A;  1P8N A;  1P8O A;  4Q40 A;  3SL1 A;  3PZL A;  3MJL A;  3SJT A;  3MMR A;  4G3H A;  1T5G A;  2ZAV A;  2EF4 A;  4GWD A;  2PHA A;  3LHL A;  4IE1 A;  4Q3Q A;  4MYK A;  1TBH A;  3THE A;  5CEV A;  4HXQ A;  1XFK A;  2RLA A;  3NIO A;  2A0M A;  1T4P A;  3NIQ A;  1P8S A;  4Q3V A;  2EIV A;  1WVA A;  4ITY A;  4RHM A;  1T4R A;  4IXV A;  4Q3R C;  4IU4 A;  3E6V A;  4MYL A;  3LP7 A;  1WVB A;  3E8Q A;  3SKK A;  5HJA A;  3THH A;  1HQG A;  1ZPE A;  3LP4 A;  3THJ A;  1ZPG A;  1CEV A;  3E6K A;  4RLA A;  3MFW A;  5RLA A;  4HWW A;  4RHQ A;  4IE3 A;  1HQX A;  4Q3T A;  1D3V A;  2AEB A;  1P8Q A;  3MFV A;  3SL0 A;  1WOG A;  3F80 A;  2CEV A;  1HQH A;  3DJ8 A;  2PLL A;  1T4S A;  1T5F A;  4GWC A;  3GN0 A;  4MYN A;  1GQ7 A;  4MXR A;  3M1R A;  4IE2 A;  1R1O A;  4Q3P A;  3TH7 A;  1P8R A;  3CEV A;  5HJ9 A;  3E8Z A;  4RHJ A;  1TA1 A;  4Q42 A;  1HQ5 A;  4Q3U A;  4FCK A;  1HQF A;  4Q3R A;  4GSM A;  4RHL A;  4MYF A;  1P8M A;  4FCI A;  3TF3 A;  1WOH A;  4RHK A;  4GSZ A;  3RLA A;  2PHO A;  3NIP A;  4DZ4 A;  1RLA A;  1WOI A;  4I06 A;  3KV2 A;  1P8P A;  2EF5 A;  4IU1 A;  4CEV A;  1T4T A;  1TBL A;  4Q3S A;  4Q41 A;  1PQ3 A;  1GQ6 A;  1TBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...