3SPTA

Crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
474
structure length
474
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Mycobacterium tuberculosis GlmU in complex with Acetyl CoA
rcsb
molecule keywords Bifunctional protein glmU
molecule tags Transferase
source organism Mycobacterium tuberculosis
total genus 179
structure length 474
sequence length 474
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2011-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3sptA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sptA01
3V0QA 3CKNA 4KC2A 4P00A 2VFZA 1KRVA 5FU0A 4EEOA 2MZBA 1WT3A 5IDSA 4FQWA 3V0MA 2A8WA 2W0VA 2WVKA 5C8RA 4EEAA 3TV0A 2ZU8A 3I3XA 2RJ0A 3BRKX 3Q1XA 4CJ8A 3ZGFA 2FKOA 2Z87A 3T7MA 4HO0A 3IOIA 1G9RA 2NXVA 3IOHA 5C3BA 3OH2A 4FROA 4MZUA 3IGJA 4M4KA 4Y7UA 2YQSA 1FO8A 4Y64A 3U2VA 2FY7A 5CMHA 3F1YA 1H4DA 1VGWA 1KGTA 1MR7A 1QQ0A 4B5BA 3ECTA 1H5TB 1R82A 4MYOA 4G3QA 4N6BA 5CQMX 1G1LA 1H5TA 5U2KA 5C3DA 4FRDA 2YCMA 4LW6A 5FUHA 4Y62A 3R5CA 3VBLA 5C4BA 1WSZA 3R5BA 1LZIA 3SXAA 1ZIZA 2BO7A 3ZGGA 2WE9A 3V4EA 1H5RA 1ZJPA 2ZU7A 4AA7A 3USRA 1ZI5A 4M98A 3Q7UA 1KRUA 1H4CA 2Y4JA 2I7BA 1LZ7A 4IHHA 4R36A 4DDZA 3K8EA 1NWGB 4N69A 1ZCYA 5F42A 3POLA 2IU8A 1GQCA 2AQ9A 1H7QA 3I0JA 5DDVA 1VZTA 4HO6A 3EEVA 3SXEA 1XHDA 3IXCA 2RJ1A 1G3LA 2I5KA 5AFUV 3E26A 4HO5A 3OTMA 5C49A 1R7YA 1QREA 5AJPA 2WLFA 2RJ5A 4EEMA 3V0LA 1ZJ1A 1HJLA 3FSCA 2X5SA 5FYEA 3ST8A 1S4NA 4JISA 1TZFA 3FSBA 4HOCA 4Y7TA 4XWIA 2AM4A 4N27A 5CQLX 5DDTA 5IDTA 2V0LA 2YESA 1G93A 3KWDA 4M2AA 1YROB 4BMAA 3R1WA 3VBIA 3V0OA 3EG4A 1QGQA 2JF2A 1QGSA 1K4VA 4ARWA 1VH1A 3V91A 5AJOA 3MQHA 3CKOA 1ZI3A 1J2ZA 1T3DA 4KXOA 1FR8A 4CJCA 1NQIB 3OGZA 3V8YA 1VZXA 2WEEA 3PKQA 2RJ9A 3CU0A 3OH1A 4B4MA 4KPXA 2E3DA 1IIMA 3D98A 3SRTA 3O3PA 4B42A 1E5KA 3I3AA 4HCQA 3SX3A 2JCJA 1GWWA 3N9WA 5CQNX 4EGGA 2WLCA 1TW1A 3BSYA 2P73A 2XMEA 2YQHA 3T7OA 5C47A 1TVYA 1H7HA 1KRRA 1FRWA 2BO4A 3OAMA 4KPZA 2GGQA 1FXOA 2JCLA 4HURA 1SSMA 4YS8A 3U2TA 4HZCA 1NMMB 2WLGA 1MP5A 1TDTA 1WVCA 2Y6PA 4FCEA 3TDTA 5EJ1A 2PA4A 5CMFX 2Y7AA 3TIOA 4M2BA 2Q4JA 3U2UA 3GVDA 3JUKA 4ECMA 2OEFA 2ICXA 3I0KA 3FOQA 1VH3A 4EQYA 2DPWA 2VS3A 3LW6A 3D5NA 5DEMA 3F1XA 3R5DA 3FWWA 1NHEB 1G2VA 1VZUA 3BCVA 4AAWA 3I0HA 1LL3A 2XATA 4HO3A 4C2SA 1SSTA 3V90A 4B4BA 2WLDA 3R3RA 1TW5A 4M28A 2Y4LA 1G8OA 4HO9A 4J09A 1PZTA 4MNDA 4LW3A 3E25A 3OC9A 1V67A 3MQGA 1JVGA 3KWEA 4G3SA 3VBMA 1W77A 5CMIA 1ZJ0A 4Y63A 4D48A 4HO2A 5BXCA 1ZJ3A 4CVHA 2FYCB 2QGIA 1MP4A 1FZWA 4KRVA 4KT7A 5C3AA 2D0JA 1VGUA 2X60A 2V0IA 3V0NA 2OI6A 2YQJA 2IU9A 4Y7GA 1FXJA 3V0PA 3OH3A 3TWDA 4J18A 4Y6UA 1WT2A 1G0RA 3OKRA 5C4FA 3SPTA 4KQLA 3MC4A 1ZI1A 2XWNA 5CMJA 3TQDA 5E3RA 2A8UA 5E3PA 1O0RA 2XWMA 2QIAA 4KNXA 3VNPA 3SXDA 4FRBA 2QKXA 1FWYA 2ZU9A 4Y7FA 3Q4SA 1H5SD 4FRMA 1V82A 3OUPA 5DEPA 4NANA 4D0TA 1H7FA 4EE5A 2AE7A 2JCKA 2VHEA 1H7EA 4E79A 2PGYA 3SX7A 3I0EA 4B2WA 1R7TA 1XZ6A 1R7XA 3SX8A 4P02A 1ON8A 4E6UA 3I0DA 3ZLLA 2Z86A 3I0LA 4ZDQA 3OU9A 1HJJA 2P6WA 3VBKA 1PZYB 3IOJA 3SX5A 1V84A 4NAKA 2IUAA 3FS8A 5JQQA 2OEGA 1FG5N 4ISXA 4HO8A 1EYRA 4GBPA 3T7NA 4EEGA 3VBJA 1H3MA 4FREA 4Y6NA 3U0XA 1KK4A 5ADXV 1JYKA 2AECA 1R81A 1Z90A 4EE3A 1XATA 4FRQA 4R37A 5C1GA 4HUSA 3TISA 1FGGA 5E3QA 3JTJA 1KK6A 1ZCTA 1ZJOA 2AM3A 4FRPA 2JF3A 1SS9A 3U2XA 4DECA 4JD0A 2VD4A 3CKVA 1THJA 2BO8A 1ZCUA 1HM8A 3P1BA 4G87A 1VM8A 4IRQA 1O7QA 5CQPA 3OTZA 2Y4KA 2OI7A 2YQCA 1KQAA 3R3IA 3HL3A 1FGXA 3KWCA 1OMXA 2V0JA 1S4PA 1KHRA 2WGZA 5C4DA 4EVWA 1LVWA 4FRLA 4G3PA 4NAIA 1O7OA 5CMGX 3F1CA 3USQA 4FCUA 2RIYA 5J49A 1QRMA 5CQOA 2VSHA 2GGOA 3ZLKA 1INJA 5C36A 3FSXA 3GUEA 4H7OA 4EAAA 1INIA 2RITA 1XHBA 2APCA 3RSBA 4AYLA 2RJ6A 4BQHA 2AESA 4DE7A 1JV1A 5ADXU 1GA8A 3T57A 2VS4A 4FRHA 4MYBA 3C8VA 3RMVA 2X65A 2Y4MA 3PKPA 3K8DA 1YP2A 2OI5A 1MR9A 1GX0A 5L6VA 4NALA 2E8BA 1FR9A 1W57A 1ON6A 3DUVA 3DK5A 3HJJA 2PGVA 3EE5A 3I0FA 2AGDA 2D7IA 2QH5A 4UEGA 2IC7A 5C1LA 4IHFA 1FOAA 3NZ2A 2V0KA 3VBPA 2O1GA 1HV9A 4HO4A 3I0CA 5FV9A 1G97A 3DJ4A 1ZHJA 1ZJ2A 4Y9XA 3BFPA 3VBNA 1QWJA 1LZ0A 2VSIA 3HSQA 1GWVA 1H7GA 4D11C 2D7RA 2O1HA 5L6SA 5FTSA 3RMWA 2XMHA 3I0GA 2WLEA 1GX4A 1VICA 4ASJA 2FFVA 3Q80A 4HG6A 3FTTA 3JUJA 2VXMA 4CJBA 3R8YA 5C4EA 3P47A 3TZTA 1S80A 1QRLA 2FYBA 1G95A 4D0ZA 4EA9A 1W55A 2O1FA 3BSSA 4EE4A 4Y7VA 4EA7A 2RJ7A 4KNRA 1FO9A 3SXGA 3CGXA 1JYLA 1KGQA 4B4GA 1YP4A 5C1HA 1HM9A 3JQYA 1H5RB 1QRGA 4EABA 2CU2A 4R7PA 2FYDB 1GQ9A 4IHGA 2I5EA 1H7TA 3FSYA 1QG8A 1R7UA 1VPAA 1JV3A 3OH4A 3PMOA 1MP3A 3PNNA 4IRPA 2PX7A 1R7VA 1ZDGA 4E1KA 5FTVA 5C38A 2WAWA 1OCXA 2TDTA 3DHOA 4HZDA 4D11A 5DG3A 4FRAA 1MC3A 1LL2A 3D8VA 2VS5A 1KK5A 1MRLA 1I52A 4KC4A 1R80A 3EH0A 3U0YA 1KWSA 1O23B 1OQMB 5C48A 1ZI4A 2BO6A 3GOSA 2P72A 4M9CA 1ZDFA 2JCOA 3QVBA 1ZCVA 3CJ8A 1G23A 5FU8A 1H5SC 1V3WA 4K6RA 2WVLA 1HM0A 1SSQA 2FFUA 3BXYA 1S4OA 3CKJA 3R5AA 2UX8A 4AC3A 1WT1A 3U2WA 2RIJA 1OMZA 4B2XA 4E75A 2P2OA 5EJZA 1QRFA 1YP3A 1NKHB 5I1FA 1LL0A 2RIZA 4DCLA 2YC3A 4AYJA 2AM5A 3BSWA 2FYAA 3CKQA 2RJ4A 5EIYA 1H7LA 2RJ8A 1EZIA 4N6AA 2RIXA 2V0HA 1IINA 5C4CA 3R0SA 2VXLA 2AH9A 4ASYA 5AFUU 1H4EA 2X5ZA 1JVDA 1VGZA 1LZJA 5AJNA 4EA8A 4KC1A 3SXCA 4MFGA 1H5SB 3V8ZA 3TK8A 3SXBA 2WVMA 4M99A 2XWLA 3KIAA 4L41C 1H5SA 1WT0A 1LXAA 3ZF8A 5IFYA 2QIVX 2NPOA 3R2WA 3I0IX 2W0WA 4E6TA 3OH0A 1VGTA 4B3UA 5HS2A 2YC5A 3OW5A 1NF5B 1V83A 2ICYA 3NGWA
chains in the Genus database with same CATH superfamily
3V0QA 3CKNA 4KC2A 4P00A 3SUCA 1KRVA 2VFZA 5FU0A 2MZBA 4EEOA 1WT3A 5IDSA 4FQWA 3V0MA 2A8WA 2W0VA 2WVKA 5C8RA 4EEAA 3TV0A 2ZU8A 3I3XA 2RJ0A 3BRKX 3Q1XA 4CJ8A 3ZGFA 2FKOA 2Z87A 3T7MA 4HO0A 3IOIA 1G9RA 2NXVA 3IOHA 5C3BA 3OH2A 4O6NA 4FROA 4MZUA 3IGJA 4M4KA 4Y7UA 2YQSA 1FO8A 4Y64A 3U2VA 2FY7A 5CMHA 3F1YA 1H4DA 1VGWA 1KGTA 1MR7A 1QQ0A 4B5BA 3ECTA 1H5TB 1R82A 4MYOA 4G3QA 4N6BA 5CQMX 1G1LA 1H5TA 5U2KA 5C3DA 4FRDA 2YCMA 4LW6A 5FUHA 4Y62A 3R5CA 3VBLA 5C4BA 1WSZA 3R5BA 4FIYA 1LZIA 3SXAA 1ZIZA 2BO7A 3ZGGA 2WE9A 3V4EA 1H5RA 1ZJPA 2ZU7A 4AA7A 3USRA 1ZI5A 4M98A 3Q7UA 1KRUA 1H4CA 2Y4JA 2I7BA 1LZ7A 4IHHA 4R36A 4DDZA 3K8EA 4O6MA 1NWGB 4N69A 1ZCYA 5F42A 3POLA 2IU8A 1GQCA 2AQ9A 1H7QA 3I0JA 5DDVA 2J0AA 1VZTA 4HO6A 3EEVA 3SXEA 1XHDA 3IXCA 2RJ1A 1G3LA 2I5KA 5AFUV 3E26A 4HO5A 3OTMA 5C49A 1R7YA 1QREA 5AJPA 2WLFA 2RJ5A 4EEMA 3V0LA 1ZJ1A 1HJLA 3FSCA 2X5SA 5FYEA 3ST8A 1S4NA 4JISA 1TZFA 3FSBA 4HOCA 4Y7TA 4XWIA 2AM4A 4N27A 5CQLX 5DDTA 5IDTA 1Z2FA 2V0LA 2YESA 1G93A 3KWDA 4M2AA 1YROB 4BMAA 3R1WA 3VBIA 3V0OA 3EG4A 1QGQA 2C0NA 2JF2A 1QGSA 1K4VA 4ARWA 1VH1A 3V91A 5AJOA 3MQHA 3CKOA 1ZI3A 1J2ZA 1T3DA 4KXOA 1FR8A 4CJCA 1NQIB 3OGZA 3V8YA 1VZXA 2WEEA 3PKQA 2RJ9A 3OH1A 3CU0A 4B4MA 4KPXA 2E3DA 1IIMA 3D98A 3SRTA 3O3PA 4B42A 1E5KA 3I3AA 4HCQA 3SX3A 2JCJA 1GWWA 3N9WA 5CQNX 4EGGA 2WLCA 1TW1A 3BSYA 2P73A 2XMEA 2YQHA 3T7OA 5C47A 1TVYA 1H7HA 1KRRA 1FRWA 2BO4A 3OAMA 4KPZA 2GGQA 1FXOA 2JCLA 4HURA 1SSMA 4YS8A 3U2TA 4HZCA 1NMMB 2WLGA 1MP5A 1TDTA 5D92A 1WVCA 2Y6PA 4FCEA 3TDTA 5EJ1A 2PA4A 5CMFX 2Y7AA 3TIOA 4M2BA 2Q4JA 3U2UA 3GVDA 3JUKA 4ECMA 2OEFA 2ICXA 3I0KA 3FOQA 1VH3A 4EQYA 2DPWA 2VS3A 3LW6A 3D5NA 5DEMA 3F1XA 3R5DA 3FWWA 1NHEB 1G2VA 1VZUA 3BCVA 4AAWA 3I0HA 1LL3A 2XATA 4HO3A 4C2SA 1SSTA 3V90A 4B4BA 2WLDA 3R3RA 1TW5A 4M28A 1EWWA 1G8OA 2Y4LA 4HO9A 4J09A 1PZTA 4MNDA 4LW3A 3E25A 3OC9A 1V67A 3MQGA 3KWEA 1JVGA 4G3SA 3VBMA 1W77A 5CMIA 1ZJ0A 3GQ7A 4Y63A 4D48A 4HO2A 5BXCA 1ZJ3A 4CVHA 2FYCB 3GQ9A 2QGIA 1MP4A 5D91A 1FZWA 4KRVA 4KT7A 5C3AA 2D0JA 1VGUA 2X60A 2V0IA 3V0NA 2OI6A 2YQJA 2IU9A 4Y7GA 1FXJA 3V0PA 3OH3A 3TWDA 4J18A 4Y6UA 1WT2A 1G0RA 3OKRA 5C4FA 3SPTA 4KQLA 3MC4A 1ZI1A 2XWNA 4FIXA 5CMJA 3TQDA 5E3RA 2A8UA 5E3PA 1O0RA 2XWMA 2QIAA 4KNXA 3VNPA 3SXDA 4FRBA 2QKXA 1FWYA 2ZU9A 4Y7FA 3Q4SA 1H5SD 4FRMA 2J0BA 1V82A 3OUPA 5DEPA 4NANA 4D0TA 1H7FA 4EE5A 2AE7A 2JCKA 2VHEA 1H7EA 4E79A 2PGYA 3SX7A 3I0EA 4B2WA 1R7TA 1XZ6A 1R7XA 3SX8A 4P02A 1ON8A 4E6UA 3I0DA 3ZLLA 2Z86A 3I0LA 4ZDQA 3OU9A 1HJJA 2P6WA 3VBKA 1PZYB 3IOJA 3SX5A 1V84A 4NAKA 2IUAA 3FS8A 5JQQA 2OEGA 1FG5N 4ISXA 4HO8A 1EYRA 4GBPA 3T7NA 4EEGA 3VBJA 1H3MA 4FREA 4Y6NA 3U0XA 1KK4A 5ADXV 1JYKA 2AECA 1R81A 1Z90A 4EE3A 1XATA 4FRQA 4R37A 5C1GA 4HUSA 3TISA 1FGGA 5E3QA 3JTJA 1KK6A 1ZCTA 1ZJOA 2AM3A 4FRPA 2VK9A 2JF3A 1SS9A 3U2XA 4DECA 4JD0A 2VD4A 3CKVA 4Q7CA 1THJA 2BO8A 1ZCUA 1HM8A 3P1BA 4G87A 1VM8A 4IRQA 1O7QA 5CQPA 3OTZA 2Y4KA 2OI7A 2YQCA 1KQAA 3R3IA 3HL3A 1FGXA 3KWCA 1OMXA 2V0JA 1S4PA 1KHRA 2WGZA 5C4DA 4EVWA 1LVWA 4FRLA 4G3PA 4NAIA 1O7OA 5CMGX 3F1CA 3USQA 4FCUA 2RIYA 5J49A 1QRMA 5CQOA 2VSHA 2GGOA 3ZLKA 1INJA 5C36A 3FSXA 3GUEA 4H7OA 4EAAA 1INIA 2RITA 1XHBA 2APCA 3RSBA 4AYLA 2RJ6A 4BQHA 2AESA 4DE7A 1JV1A 5ADXU 1GA8A 3T57A 2VS4A 4FRHA 4MYBA 3C8VA 3RMVA 2X65A 2Y4MA 3PKPA 3K8DA 1YP2A 2OI5A 1MR9A 1GX0A 5L6VA 4NALA 2E8BA 1FR9A 1W57A 1ON6A 3DUVA 3DK5A 3HJJA 2PGVA 3EE5A 3I0FA 2AGDA 2D7IA 2QH5A 4UEGA 2IC7A 5C1LA 4IHFA 1FOAA 3NZ2A 2V0KA 3VBPA 2O1GA 1HV9A 4HO4A 3I0CA 5FV9A 1G97A 3DJ4A 1ZHJA 1ZJ2A 4Y9XA 3BFPA 3VBNA 1QWJA 1LZ0A 2VSIA 3HSQA 1GWVA 1H7GA 4D11C 2D7RA 2O1HA 5L6SA 5FTSA 3RMWA 2XMHA 3I0GA 2WLEA 1GX4A 1VICA 4ASJA 2FFVA 3Q80A 4HG6A 3FTTA 3JUJA 2VXMA 4CJBA 3R8YA 5C4EA 3P47A 3TZTA 1S80A 1QRLA 2FYBA 1G95A 4D0ZA 4EA9A 1W55A 2O1FA 3BSSA 4EE4A 4Y7VA 4EA7A 2RJ7A 3GQ8A 4KNRA 1FO9A 3SXGA 3CGXA 1JYLA 1KGQA 4B4GA 1YP4A 5C1HA 1HM9A 3JQYA 1H5RB 1QRGA 4EABA 2CU2A 4R7PA 2FYDB 1GQ9A 4IHGA 2I5EA 1H7TA 3FSYA 3OH4A 1QG8A 1R7UA 1JV3A 1VPAA 3PMOA 1MP3A 3PNNA 4IRPA 2PX7A 1R7VA 1ZDGA 4E1KA 5FTVA 5C38A 2WAWA 1OCXA 2TDTA 3DHOA 4HZDA 4D11A 5DG3A 3GQAA 4FRAA 1MC3A 1LL2A 3D8VA 2VS5A 1KK5A 4MIXA 1MRLA 1I52A 4KC4A 1R80A 3EH0A 3U0YA 1KWSA 1O23B 1OQMB 5C48A 1ZI4A 2BO6A 3GOSA 2P72A 4M9CA 1ZDFA 2JCOA 3QVBA 1ZCVA 3CJ8A 1G23A 5FU8A 1H5SC 1V3WA 4K6RA 2WVLA 1HM0A 1SSQA 2FFUA 3BXYA 1S4OA 3CKJA 3R5AA 2UX8A 4AC3A 1WT1A 3U2WA 2RIJA 1OMZA 4B2XA 4E75A 2P2OA 5EJZA 1QRFA 1YP3A 1NKHB 5I1FA 1LL0A 2RIZA 4DCLA 2YC3A 4AYJA 2AM5A 3BSWA 2FYAA 3CKQA 2RJ4A 5EIYA 1H7LA 2RJ8A 1EZIA 4N6AA 2RIXA 2V0HA 1L0SA 1IINA 5C4CA 3R0SA 2VXLA 2AH9A 4ASYA 5AFUU 1H4EA 2X5ZA 1JVDA 1VGZA 1LZJA 1N4IA 5AJNA 4EA8A 4KC1A 3SXCA 4MFGA 1H5SB 3V8ZA 3TK8A 3SXBA 2WVMA 4M99A 2XWLA 3KIAA 4L41C 1H5SA 1WT0A 1LXAA 3ZF8A 5IFYA 1M8NA 2NPOA 2QIVX 3R2WA 3I0IX 2W0WA 3OH0A 4E6TA 1VGTA 4B3UA 5HS2A 2YC5A 3OW5A 1NF5B 1V83A 2ICYA 3NGWA
chains in the Genus database with same CATH topology
3V0QA 3CKNA 4KC2A 4P00A 2VFZA 1KRVA 5FU0A 4EEOA 2MZBA 1WT3A 5IDSA 4FQWA 3V0MA 2A8WA 2W0VA 2WVKA 5C8RA 4EEAA 3TV0A 2ZU8A 3I3XA 2RJ0A 3BRKX 3Q1XA 4CJ8A 3ZGFA 2FKOA 2Z87A 3T7MA 4HO0A 3IOIA 1G9RA 2NXVA 3IOHA 5C3BA 3OH2A 4O6NA 4FROA 4MZUA 3IGJA 4M4KA 4Y7UA 2YQSA 1FO8A 4Y64A 3U2VA 2FY7A 5CMHA 3F1YA 1H4DA 1VGWA 1KGTA 1MR7A 1QQ0A 4B5BA 3ECTA 1H5TB 1R82A 4MYOA 4G3QA 4N6BA 5CQMX 1G1LA 1H5TA 5U2KA 5C3DA 4FRDA 2YCMA 4LW6A 5FUHA 4Y62A 3R5CA 3VBLA 5C4BA 1WSZA 3R5BA 4FIYA 1LZIA 3SXAA 1ZIZA 2BO7A 3ZGGA 2WE9A 3V4EA 1H5RA 1ZJPA 2ZU7A 4AA7A 3USRA 1ZI5A 4M98A 3Q7UA 1KRUA 1H4CA 2Y4JA 2I7BA 1LZ7A 4IHHA 4R36A 4DDZA 3K8EA 4O6MA 1NWGB 4N69A 1ZCYA 5F42A 3POLA 2IU8A 1GQCA 2AQ9A 1H7QA 3I0JA 5DDVA 2J0AA 1VZTA 4HO6A 3EEVA 3SXEA 1XHDA 3IXCA 2RJ1A 1G3LA 2I5KA 5AFUV 3E26A 4HO5A 3OTMA 5C49A 1R7YA 1QREA 5AJPA 2WLFA 2RJ5A 4EEMA 3V0LA 1ZJ1A 1HJLA 3FSCA 2X5SA 5FYEA 3ST8A 1S4NA 4JISA 1TZFA 3FSBA 4HOCA 4Y7TA 4XWIA 2AM4A 4N27A 5CQLX 5DDTA 5IDTA 2V0LA 2YESA 1G93A 3KWDA 4M2AA 1YROB 4BMAA 3R1WA 3VBIA 3V0OA 3EG4A 1QGQA 2C0NA 2JF2A 1QGSA 1K4VA 4ARWA 1VH1A 3V91A 5AJOA 3MQHA 3CKOA 1ZI3A 1J2ZA 1T3DA 4KXOA 1FR8A 4CJCA 1NQIB 3OGZA 3V8YA 1VZXA 2WEEA 3PKQA 2RJ9A 3CU0A 3OH1A 4B4MA 4KPXA 2E3DA 1IIMA 3D98A 3SRTA 3O3PA 4B42A 1E5KA 3I3AA 4HCQA 3SX3A 2JCJA 1GWWA 3N9WA 5CQNX 4EGGA 2WLCA 1TW1A 3BSYA 2P73A 2XMEA 2YQHA 3T7OA 5C47A 1TVYA 1H7HA 1KRRA 1FRWA 2BO4A 3OAMA 4KPZA 2GGQA 1FXOA 2JCLA 4HURA 1SSMA 4YS8A 3U2TA 4HZCA 1NMMB 2WLGA 1MP5A 1TDTA 5D92A 1WVCA 2Y6PA 4FCEA 3TDTA 5EJ1A 2PA4A 5CMFX 2Y7AA 3TIOA 4M2BA 2Q4JA 3U2UA 3GVDA 3JUKA 4ECMA 2OEFA 2ICXA 3I0KA 3FOQA 1VH3A 4EQYA 2DPWA 2VS3A 3LW6A 3D5NA 5DEMA 3F1XA 3R5DA 3FWWA 1NHEB 1G2VA 1VZUA 3BCVA 4AAWA 3I0HA 1LL3A 2XATA 4HO3A 4C2SA 1SSTA 3V90A 4B4BA 2WLDA 3R3RA 1TW5A 4M28A 2Y4LA 1G8OA 4HO9A 4J09A 1PZTA 4MNDA 4LW3A 3E25A 3OC9A 1V67A 3MQGA 1JVGA 3KWEA 4G3SA 3VBMA 1W77A 5CMIA 1ZJ0A 4Y63A 4D48A 4HO2A 5BXCA 1ZJ3A 4CVHA 2FYCB 2QGIA 1MP4A 5D91A 1FZWA 4KRVA 4KT7A 5C3AA 2D0JA 1VGUA 2X60A 2V0IA 3V0NA 2OI6A 2YQJA 2IU9A 4Y7GA 1FXJA 3V0PA 3OH3A 3TWDA 4J18A 4Y6UA 1WT2A 1G0RA 3OKRA 5C4FA 3SPTA 4KQLA 3MC4A 1ZI1A 2XWNA 4FIXA 5CMJA 3TQDA 5E3RA 2A8UA 5E3PA 1O0RA 2XWMA 2QIAA 4KNXA 3VNPA 3SXDA 4FRBA 2QKXA 1FWYA 2ZU9A 4Y7FA 3Q4SA 1H5SD 4FRMA 2J0BA 1V82A 3OUPA 5DEPA 4NANA 4D0TA 1H7FA 4EE5A 2AE7A 2JCKA 2VHEA 1H7EA 4E79A 2PGYA 3SX7A 3I0EA 4B2WA 1R7TA 1XZ6A 1R7XA 3SX8A 4P02A 1ON8A 4E6UA 3I0DA 3ZLLA 2Z86A 3I0LA 4ZDQA 3OU9A 1HJJA 2P6WA 3VBKA 1PZYB 3IOJA 3SX5A 1V84A 4NAKA 2IUAA 3FS8A 5JQQA 2OEGA 1FG5N 4ISXA 4HO8A 1EYRA 4GBPA 3T7NA 4EEGA 3VBJA 1H3MA 4FREA 4Y6NA 3U0XA 1KK4A 5ADXV 1JYKA 2AECA 1R81A 1Z90A 4EE3A 1XATA 4FRQA 4R37A 5C1GA 4HUSA 3TISA 1FGGA 5E3QA 3JTJA 1KK6A 1ZCTA 1ZJOA 2AM3A 4FRPA 2VK9A 2JF3A 1SS9A 3U2XA 4DECA 4JD0A 2VD4A 3CKVA 4Q7CA 1THJA 2BO8A 1ZCUA 1HM8A 3P1BA 4G87A 1VM8A 4IRQA 1O7QA 5CQPA 3OTZA 2Y4KA 2OI7A 2YQCA 1KQAA 3R3IA 3HL3A 1FGXA 3KWCA 1OMXA 2V0JA 1S4PA 1KHRA 2WGZA 5C4DA 4EVWA 1LVWA 4FRLA 4G3PA 4NAIA 1O7OA 5CMGX 3F1CA 3USQA 4FCUA 2RIYA 5J49A 1QRMA 5CQOA 2VSHA 2GGOA 3ZLKA 1INJA 5C36A 3FSXA 3GUEA 4H7OA 4EAAA 1INIA 2RITA 1XHBA 2APCA 3RSBA 4AYLA 2RJ6A 4BQHA 2AESA 4DE7A 1JV1A 5ADXU 1GA8A 3T57A 2VS4A 4FRHA 4MYBA 3C8VA 3RMVA 2X65A 2Y4MA 3PKPA 3K8DA 1YP2A 2OI5A 1MR9A 1GX0A 5L6VA 4NALA 2E8BA 1FR9A 1W57A 1ON6A 3DUVA 3DK5A 3HJJA 2PGVA 3EE5A 3I0FA 2AGDA 2D7IA 2QH5A 4UEGA 2IC7A 5C1LA 4IHFA 1FOAA 3NZ2A 2V0KA 3VBPA 2O1GA 1HV9A 4HO4A 3I0CA 5FV9A 1G97A 3DJ4A 1ZHJA 1ZJ2A 4Y9XA 3BFPA 3VBNA 1QWJA 1LZ0A 2VSIA 3HSQA 1GWVA 1H7GA 4D11C 2D7RA 2O1HA 5L6SA 5FTSA 3RMWA 2XMHA 3I0GA 2WLEA 1GX4A 1VICA 4ASJA 2FFVA 3Q80A 4HG6A 3FTTA 3JUJA 2VXMA 4CJBA 3R8YA 5C4EA 3P47A 3TZTA 1S80A 1QRLA 2FYBA 1G95A 4D0ZA 4EA9A 1W55A 2O1FA 3BSSA 4EE4A 4Y7VA 4EA7A 2RJ7A 4KNRA 1FO9A 3SXGA 3CGXA 1JYLA 1KGQA 4B4GA 1YP4A 5C1HA 1HM9A 3JQYA 1H5RB 1QRGA 4EABA 2CU2A 4R7PA 2FYDB 1GQ9A 4IHGA 2I5EA 1H7TA 3FSYA 1QG8A 1R7UA 1VPAA 1JV3A 3OH4A 3PMOA 1MP3A 3PNNA 4IRPA 2PX7A 1R7VA 1ZDGA 4E1KA 5FTVA 5C38A 2WAWA 1OCXA 2TDTA 3DHOA 4HZDA 4D11A 5DG3A 4FRAA 1MC3A 1LL2A 3D8VA 2VS5A 1KK5A 4MIXA 1MRLA 1I52A 4KC4A 1R80A 3EH0A 3U0YA 1KWSA 1O23B 1OQMB 5C48A 1ZI4A 2BO6A 3GOSA 2P72A 4M9CA 1ZDFA 2JCOA 3QVBA 1ZCVA 3CJ8A 1G23A 5FU8A 1H5SC 1V3WA 4K6RA 2WVLA 1HM0A 1SSQA 2FFUA 3BXYA 1S4OA 3CKJA 3R5AA 2UX8A 4AC3A 1WT1A 3U2WA 2RIJA 1OMZA 4B2XA 4E75A 2P2OA 5EJZA 1QRFA 1YP3A 1NKHB 5I1FA 1LL0A 2RIZA 4DCLA 2YC3A 4AYJA 2AM5A 3BSWA 2FYAA 3CKQA 2RJ4A 5EIYA 1H7LA 2RJ8A 1EZIA 4N6AA 2RIXA 2V0HA 1IINA 5C4CA 3R0SA 2VXLA 2AH9A 4ASYA 5AFUU 1H4EA 2X5ZA 1JVDA 1VGZA 1LZJA 5AJNA 4EA8A 4KC1A 3SXCA 4MFGA 1H5SB 3V8ZA 3TK8A 3SXBA 2WVMA 4M99A 2XWLA 3KIAA 4L41C 1H5SA 1WT0A 1LXAA 3ZF8A 5IFYA 2QIVX 2NPOA 3R2WA 3I0IX 2W0WA 4E6TA 3OH0A 1VGTA 4B3UA 5HS2A 2YC5A 3OW5A 1NF5B 1V83A 2ICYA 3NGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0Q A;  3CKN A;  4KC2 A;  4P00 A;  2VFZ A;  1KRV A;  5FU0 A;  4EEO A;  2MZB A;  1WT3 A;  5IDS A;  4FQW A;  3V0M A;  2A8W A;  2W0V A;  2WVK A;  5C8R A;  4EEA A;  3TV0 A;  2ZU8 A;  3I3X A;  2RJ0 A;  3BRK X;  3Q1X A;  4CJ8 A;  3ZGF A;  2FKO A;  2Z87 A;  3T7M A;  4HO0 A;  3IOI A;  1G9R A;  2NXV A;  3IOH A;  5C3B A;  3OH2 A;  4FRO A;  4MZU A;  3IGJ A;  4M4K A;  4Y7U A;  2YQS A;  1FO8 A;  4Y64 A;  3U2V A;  2FY7 A;  5CMH A;  3F1Y A;  1H4D A;  1VGW A;  1KGT A;  1MR7 A;  1QQ0 A;  4B5B A;  3ECT A;  1H5T B;  1R82 A;  4MYO A;  4G3Q A;  4N6B A;  5CQM X;  1G1L A;  1H5T A;  5U2K A;  5C3D A;  4FRD A;  2YCM A;  4LW6 A;  5FUH A;  4Y62 A;  3R5C A;  3VBL A;  5C4B A;  1WSZ A;  3R5B A;  1LZI A;  3SXA A;  1ZIZ A;  2BO7 A;  3ZGG A;  2WE9 A;  3V4E A;  1H5R A;  1ZJP A;  2ZU7 A;  4AA7 A;  3USR A;  1ZI5 A;  4M98 A;  3Q7U A;  1KRU A;  1H4C A;  2Y4J A;  2I7B A;  1LZ7 A;  4IHH A;  4R36 A;  4DDZ A;  3K8E A;  1NWG B;  4N69 A;  1ZCY A;  5F42 A;  3POL A;  2IU8 A;  1GQC A;  2AQ9 A;  1H7Q A;  3I0J A;  5DDV A;  1VZT A;  4HO6 A;  3EEV A;  3SXE A;  1XHD A;  3IXC A;  2RJ1 A;  1G3L A;  2I5K A;  5AFU V;  3E26 A;  4HO5 A;  3OTM A;  5C49 A;  1R7Y A;  1QRE A;  5AJP A;  2WLF A;  2RJ5 A;  4EEM A;  3V0L A;  1ZJ1 A;  1HJL A;  3FSC A;  2X5S A;  5FYE A;  3ST8 A;  1S4N A;  4JIS A;  1TZF A;  3FSB A;  4HOC A;  4Y7T A;  4XWI A;  2AM4 A;  4N27 A;  5CQL X;  5DDT A;  5IDT A;  2V0L A;  2YES A;  1G93 A;  3KWD A;  4M2A A;  1YRO B;  4BMA A;  3R1W A;  3VBI A;  3V0O A;  3EG4 A;  1QGQ A;  2JF2 A;  1QGS A;  1K4V A;  4ARW A;  1VH1 A;  3V91 A;  5AJO A;  3MQH A;  3CKO A;  1ZI3 A;  1J2Z A;  1T3D A;  4KXO A;  1FR8 A;  4CJC A;  1NQI B;  3OGZ A;  3V8Y A;  1VZX A;  2WEE A;  3PKQ A;  2RJ9 A;  3CU0 A;  3OH1 A;  4B4M A;  4KPX A;  2E3D A;  1IIM A;  3D98 A;  3SRT A;  3O3P A;  4B42 A;  1E5K A;  3I3A A;  4HCQ A;  3SX3 A;  2JCJ A;  1GWW A;  3N9W A;  5CQN X;  4EGG A;  2WLC A;  1TW1 A;  3BSY A;  2P73 A;  2XME A;  2YQH A;  3T7O A;  5C47 A;  1TVY A;  1H7H A;  1KRR A;  1FRW A;  2BO4 A;  3OAM A;  4KPZ A;  2GGQ A;  1FXO A;  2JCL A;  4HUR A;  1SSM A;  4YS8 A;  3U2T A;  4HZC A;  1NMM B;  2WLG A;  1MP5 A;  1TDT A;  1WVC A;  2Y6P A;  4FCE A;  3TDT A;  5EJ1 A;  2PA4 A;  5CMF X;  2Y7A A;  3TIO A;  4M2B A;  2Q4J A;  3U2U A;  3GVD A;  3JUK A;  4ECM A;  2OEF A;  2ICX A;  3I0K A;  3FOQ A;  1VH3 A;  4EQY A;  2DPW A;  2VS3 A;  3LW6 A;  3D5N A;  5DEM A;  3F1X A;  3R5D A;  3FWW A;  1NHE B;  1G2V A;  1VZU A;  3BCV A;  4AAW A;  3I0H A;  1LL3 A;  2XAT A;  4HO3 A;  4C2S A;  1SST A;  3V90 A;  4B4B A;  2WLD A;  3R3R A;  1TW5 A;  4M28 A;  2Y4L A;  1G8O A;  4HO9 A;  4J09 A;  1PZT A;  4MND A;  4LW3 A;  3E25 A;  3OC9 A;  1V67 A;  3MQG A;  1JVG A;  3KWE A;  4G3S A;  3VBM A;  1W77 A;  5CMI A;  1ZJ0 A;  4Y63 A;  4D48 A;  4HO2 A;  5BXC A;  1ZJ3 A;  4CVH A;  2FYC B;  2QGI A;  1MP4 A;  1FZW A;  4KRV A;  4KT7 A;  5C3A A;  2D0J A;  1VGU A;  2X60 A;  2V0I A;  3V0N A;  2OI6 A;  2YQJ A;  2IU9 A;  4Y7G A;  1FXJ A;  3V0P A;  3OH3 A;  3TWD A;  4J18 A;  4Y6U A;  1WT2 A;  1G0R A;  3OKR A;  5C4F A;  3SPT A;  4KQL A;  3MC4 A;  1ZI1 A;  2XWN A;  5CMJ A;  3TQD A;  5E3R A;  2A8U A;  5E3P A;  1O0R A;  2XWM A;  2QIA A;  4KNX A;  3VNP A;  3SXD A;  4FRB A;  2QKX A;  1FWY A;  2ZU9 A;  4Y7F A;  3Q4S A;  1H5S D;  4FRM A;  1V82 A;  3OUP A;  5DEP A;  4NAN A;  4D0T A;  1H7F A;  4EE5 A;  2AE7 A;  2JCK A;  2VHE A;  1H7E A;  4E79 A;  2PGY A;  3SX7 A;  3I0E A;  4B2W A;  1R7T A;  1XZ6 A;  1R7X A;  3SX8 A;  4P02 A;  1ON8 A;  4E6U A;  3I0D A;  3ZLL A;  2Z86 A;  3I0L A;  4ZDQ A;  3OU9 A;  1HJJ A;  2P6W A;  3VBK A;  1PZY B;  3IOJ A;  3SX5 A;  1V84 A;  4NAK A;  2IUA A;  3FS8 A;  5JQQ A;  2OEG A;  1FG5 N;  4ISX A;  4HO8 A;  1EYR A;  4GBP A;  3T7N A;  4EEG A;  3VBJ A;  1H3M A;  4FRE A;  4Y6N A;  3U0X A;  1KK4 A;  5ADX V;  1JYK A;  2AEC A;  1R81 A;  1Z90 A;  4EE3 A;  1XAT A;  4FRQ A;  4R37 A;  5C1G A;  4HUS A;  3TIS A;  1FGG A;  5E3Q A;  3JTJ A;  1KK6 A;  1ZCT A;  1ZJO A;  2AM3 A;  4FRP A;  2JF3 A;  1SS9 A;  3U2X A;  4DEC A;  4JD0 A;  2VD4 A;  3CKV A;  1THJ A;  2BO8 A;  1ZCU A;  1HM8 A;  3P1B A;  4G87 A;  1VM8 A;  4IRQ A;  1O7Q A;  5CQP A;  3OTZ A;  2Y4K A;  2OI7 A;  2YQC A;  1KQA A;  3R3I A;  3HL3 A;  1FGX A;  3KWC A;  1OMX A;  2V0J A;  1S4P A;  1KHR A;  2WGZ A;  5C4D A;  4EVW A;  1LVW A;  4FRL A;  4G3P A;  4NAI A;  1O7O A;  5CMG X;  3F1C A;  3USQ A;  4FCU A;  2RIY A;  5J49 A;  1QRM A;  5CQO A;  2VSH A;  2GGO A;  3ZLK A;  1INJ A;  5C36 A;  3FSX A;  3GUE A;  4H7O A;  4EAA A;  1INI A;  2RIT A;  1XHB A;  2APC A;  3RSB A;  4AYL A;  2RJ6 A;  4BQH A;  2AES A;  4DE7 A;  1JV1 A;  5ADX U;  1GA8 A;  3T57 A;  2VS4 A;  4FRH A;  4MYB A;  3C8V A;  3RMV A;  2X65 A;  2Y4M A;  3PKP A;  3K8D A;  1YP2 A;  2OI5 A;  1MR9 A;  1GX0 A;  5L6V A;  4NAL A;  2E8B A;  1FR9 A;  1W57 A;  1ON6 A;  3DUV A;  3DK5 A;  3HJJ A;  2PGV A;  3EE5 A;  3I0F A;  2AGD A;  2D7I A;  2QH5 A;  4UEG A;  2IC7 A;  5C1L A;  4IHF A;  1FOA A;  3NZ2 A;  2V0K A;  3VBP A;  2O1G A;  1HV9 A;  4HO4 A;  3I0C A;  5FV9 A;  1G97 A;  3DJ4 A;  1ZHJ A;  1ZJ2 A;  4Y9X A;  3BFP A;  3VBN A;  1QWJ A;  1LZ0 A;  2VSI A;  3HSQ A;  1GWV A;  1H7G A;  4D11 C;  2D7R A;  2O1H A;  5L6S A;  5FTS A;  3RMW A;  2XMH A;  3I0G A;  2WLE A;  1GX4 A;  1VIC A;  4ASJ A;  2FFV A;  3Q80 A;  4HG6 A;  3FTT A;  3JUJ A;  2VXM A;  4CJB A;  3R8Y A;  5C4E A;  3P47 A;  3TZT A;  1S80 A;  1QRL A;  2FYB A;  1G95 A;  4D0Z A;  4EA9 A;  1W55 A;  2O1F A;  3BSS A;  4EE4 A;  4Y7V A;  4EA7 A;  2RJ7 A;  4KNR A;  1FO9 A;  3SXG A;  3CGX A;  1JYL A;  1KGQ A;  4B4G A;  1YP4 A;  5C1H A;  1HM9 A;  3JQY A;  1H5R B;  1QRG A;  4EAB A;  2CU2 A;  4R7P A;  2FYD B;  1GQ9 A;  4IHG A;  2I5E A;  1H7T A;  3FSY A;  1QG8 A;  1R7U A;  1VPA A;  1JV3 A;  3OH4 A;  3PMO A;  1MP3 A;  3PNN A;  4IRP A;  2PX7 A;  1R7V A;  1ZDG A;  4E1K A;  5FTV A;  5C38 A;  2WAW A;  1OCX A;  2TDT A;  3DHO A;  4HZD A;  4D11 A;  5DG3 A;  4FRA A;  1MC3 A;  1LL2 A;  3D8V A;  2VS5 A;  1KK5 A;  1MRL A;  1I52 A;  4KC4 A;  1R80 A;  3EH0 A;  3U0Y A;  1KWS A;  1O23 B;  1OQM B;  5C48 A;  1ZI4 A;  2BO6 A;  3GOS A;  2P72 A;  4M9C A;  1ZDF A;  2JCO A;  3QVB A;  1ZCV A;  3CJ8 A;  1G23 A;  5FU8 A;  1H5S C;  1V3W A;  4K6R A;  2WVL A;  1HM0 A;  1SSQ A;  2FFU A;  3BXY A;  1S4O A;  3CKJ A;  3R5A A;  2UX8 A;  4AC3 A;  1WT1 A;  3U2W A;  2RIJ A;  1OMZ A;  4B2X A;  4E75 A;  2P2O A;  5EJZ A;  1QRF A;  1YP3 A;  1NKH B;  5I1F A;  1LL0 A;  2RIZ A;  4DCL A;  2YC3 A;  4AYJ A;  2AM5 A;  3BSW A;  2FYA A;  3CKQ A;  2RJ4 A;  5EIY A;  1H7L A;  2RJ8 A;  1EZI A;  4N6A A;  2RIX A;  2V0H A;  1IIN A;  5C4C A;  3R0S A;  2VXL A;  2AH9 A;  4ASY A;  5AFU U;  1H4E A;  2X5Z A;  1JVD A;  1VGZ A;  1LZJ A;  5AJN A;  4EA8 A;  4KC1 A;  3SXC A;  4MFG A;  1H5S B;  3V8Z A;  3TK8 A;  3SXB A;  2WVM A;  4M99 A;  2XWL A;  3KIA A;  4L41 C;  1H5S A;  1WT0 A;  1LXA A;  3ZF8 A;  5IFY A;  2QIV X;  2NPO A;  3R2W A;  3I0I X;  2W0W A;  4E6T A;  3OH0 A;  1VGT A;  4B3U A;  5HS2 A;  2YC5 A;  3OW5 A;  1NF5 B;  1V83 A;  2ICY A;  3NGW A; 
#chains in the Genus database with same CATH topology
 3V0Q A;  3CKN A;  4KC2 A;  4P00 A;  3SUC A;  1KRV A;  2VFZ A;  5FU0 A;  2MZB A;  4EEO A;  1WT3 A;  5IDS A;  4FQW A;  3V0M A;  2A8W A;  2W0V A;  2WVK A;  5C8R A;  4EEA A;  3TV0 A;  2ZU8 A;  3I3X A;  2RJ0 A;  3BRK X;  3Q1X A;  4CJ8 A;  3ZGF A;  2FKO A;  2Z87 A;  3T7M A;  4HO0 A;  3IOI A;  1G9R A;  2NXV A;  3IOH A;  5C3B A;  3OH2 A;  4O6N A;  4FRO A;  4MZU A;  3IGJ A;  4M4K A;  4Y7U A;  2YQS A;  1FO8 A;  4Y64 A;  3U2V A;  2FY7 A;  5CMH A;  3F1Y A;  1H4D A;  1VGW A;  1KGT A;  1MR7 A;  1QQ0 A;  4B5B A;  3ECT A;  1H5T B;  1R82 A;  4MYO A;  4G3Q A;  4N6B A;  5CQM X;  1G1L A;  1H5T A;  5U2K A;  5C3D A;  4FRD A;  2YCM A;  4LW6 A;  5FUH A;  4Y62 A;  3R5C A;  3VBL A;  5C4B A;  1WSZ A;  3R5B A;  4FIY A;  1LZI A;  3SXA A;  1ZIZ A;  2BO7 A;  3ZGG A;  2WE9 A;  3V4E A;  1H5R A;  1ZJP A;  2ZU7 A;  4AA7 A;  3USR A;  1ZI5 A;  4M98 A;  3Q7U A;  1KRU A;  1H4C A;  2Y4J A;  2I7B A;  1LZ7 A;  4IHH A;  4R36 A;  4DDZ A;  3K8E A;  4O6M A;  1NWG B;  4N69 A;  1ZCY A;  5F42 A;  3POL A;  2IU8 A;  1GQC A;  2AQ9 A;  1H7Q A;  3I0J A;  5DDV A;  2J0A A;  1VZT A;  4HO6 A;  3EEV A;  3SXE A;  1XHD A;  3IXC A;  2RJ1 A;  1G3L A;  2I5K A;  5AFU V;  3E26 A;  4HO5 A;  3OTM A;  5C49 A;  1R7Y A;  1QRE A;  5AJP A;  2WLF A;  2RJ5 A;  4EEM A;  3V0L A;  1ZJ1 A;  1HJL A;  3FSC A;  2X5S A;  5FYE A;  3ST8 A;  1S4N A;  4JIS A;  1TZF A;  3FSB A;  4HOC A;  4Y7T A;  4XWI A;  2AM4 A;  4N27 A;  5CQL X;  5DDT A;  5IDT A;  1Z2F A;  2V0L A;  2YES A;  1G93 A;  3KWD A;  4M2A A;  1YRO B;  4BMA A;  3R1W A;  3VBI A;  3V0O A;  3EG4 A;  1QGQ A;  2C0N A;  2JF2 A;  1QGS A;  1K4V A;  4ARW A;  1VH1 A;  3V91 A;  5AJO A;  3MQH A;  3CKO A;  1ZI3 A;  1J2Z A;  1T3D A;  4KXO A;  1FR8 A;  4CJC A;  1NQI B;  3OGZ A;  3V8Y A;  1VZX A;  2WEE A;  3PKQ A;  2RJ9 A;  3OH1 A;  3CU0 A;  4B4M A;  4KPX A;  2E3D A;  1IIM A;  3D98 A;  3SRT A;  3O3P A;  4B42 A;  1E5K A;  3I3A A;  4HCQ A;  3SX3 A;  2JCJ A;  1GWW A;  3N9W A;  5CQN X;  4EGG A;  2WLC A;  1TW1 A;  3BSY A;  2P73 A;  2XME A;  2YQH A;  3T7O A;  5C47 A;  1TVY A;  1H7H A;  1KRR A;  1FRW A;  2BO4 A;  3OAM A;  4KPZ A;  2GGQ A;  1FXO A;  2JCL A;  4HUR A;  1SSM A;  4YS8 A;  3U2T A;  4HZC A;  1NMM B;  2WLG A;  1MP5 A;  1TDT A;  5D92 A;  1WVC A;  2Y6P A;  4FCE A;  3TDT A;  5EJ1 A;  2PA4 A;  5CMF X;  2Y7A A;  3TIO A;  4M2B A;  2Q4J A;  3U2U A;  3GVD A;  3JUK A;  4ECM A;  2OEF A;  2ICX A;  3I0K A;  3FOQ A;  1VH3 A;  4EQY A;  2DPW A;  2VS3 A;  3LW6 A;  3D5N A;  5DEM A;  3F1X A;  3R5D A;  3FWW A;  1NHE B;  1G2V A;  1VZU A;  3BCV A;  4AAW A;  3I0H A;  1LL3 A;  2XAT A;  4HO3 A;  4C2S A;  1SST A;  3V90 A;  4B4B A;  2WLD A;  3R3R A;  1TW5 A;  4M28 A;  1EWW A;  1G8O A;  2Y4L A;  4HO9 A;  4J09 A;  1PZT A;  4MND A;  4LW3 A;  3E25 A;  3OC9 A;  1V67 A;  3MQG A;  3KWE A;  1JVG A;  4G3S A;  3VBM A;  1W77 A;  5CMI A;  1ZJ0 A;  3GQ7 A;  4Y63 A;  4D48 A;  4HO2 A;  5BXC A;  1ZJ3 A;  4CVH A;  2FYC B;  3GQ9 A;  2QGI A;  1MP4 A;  5D91 A;  1FZW A;  4KRV A;  4KT7 A;  5C3A A;  2D0J A;  1VGU A;  2X60 A;  2V0I A;  3V0N A;  2OI6 A;  2YQJ A;  2IU9 A;  4Y7G A;  1FXJ A;  3V0P A;  3OH3 A;  3TWD A;  4J18 A;  4Y6U A;  1WT2 A;  1G0R A;  3OKR A;  5C4F A;  3SPT A;  4KQL A;  3MC4 A;  1ZI1 A;  2XWN A;  4FIX A;  5CMJ A;  3TQD A;  5E3R A;  2A8U A;  5E3P A;  1O0R A;  2XWM A;  2QIA A;  4KNX A;  3VNP A;  3SXD A;  4FRB A;  2QKX A;  1FWY A;  2ZU9 A;  4Y7F A;  3Q4S A;  1H5S D;  4FRM A;  2J0B A;  1V82 A;  3OUP A;  5DEP A;  4NAN A;  4D0T A;  1H7F A;  4EE5 A;  2AE7 A;  2JCK A;  2VHE A;  1H7E A;  4E79 A;  2PGY A;  3SX7 A;  3I0E A;  4B2W A;  1R7T A;  1XZ6 A;  1R7X A;  3SX8 A;  4P02 A;  1ON8 A;  4E6U A;  3I0D A;  3ZLL A;  2Z86 A;  3I0L A;  4ZDQ A;  3OU9 A;  1HJJ A;  2P6W A;  3VBK A;  1PZY B;  3IOJ A;  3SX5 A;  1V84 A;  4NAK A;  2IUA A;  3FS8 A;  5JQQ A;  2OEG A;  1FG5 N;  4ISX A;  4HO8 A;  1EYR A;  4GBP A;  3T7N A;  4EEG A;  3VBJ A;  1H3M A;  4FRE A;  4Y6N A;  3U0X A;  1KK4 A;  5ADX V;  1JYK A;  2AEC A;  1R81 A;  1Z90 A;  4EE3 A;  1XAT A;  4FRQ A;  4R37 A;  5C1G A;  4HUS A;  3TIS A;  1FGG A;  5E3Q A;  3JTJ A;  1KK6 A;  1ZCT A;  1ZJO A;  2AM3 A;  4FRP A;  2VK9 A;  2JF3 A;  1SS9 A;  3U2X A;  4DEC A;  4JD0 A;  2VD4 A;  3CKV A;  4Q7C A;  1THJ A;  2BO8 A;  1ZCU A;  1HM8 A;  3P1B A;  4G87 A;  1VM8 A;  4IRQ A;  1O7Q A;  5CQP A;  3OTZ A;  2Y4K A;  2OI7 A;  2YQC A;  1KQA A;  3R3I A;  3HL3 A;  1FGX A;  3KWC A;  1OMX A;  2V0J A;  1S4P A;  1KHR A;  2WGZ A;  5C4D A;  4EVW A;  1LVW A;  4FRL A;  4G3P A;  4NAI A;  1O7O A;  5CMG X;  3F1C A;  3USQ A;  4FCU A;  2RIY A;  5J49 A;  1QRM A;  5CQO A;  2VSH A;  2GGO A;  3ZLK A;  1INJ A;  5C36 A;  3FSX A;  3GUE A;  4H7O A;  4EAA A;  1INI A;  2RIT A;  1XHB A;  2APC A;  3RSB A;  4AYL A;  2RJ6 A;  4BQH A;  2AES A;  4DE7 A;  1JV1 A;  5ADX U;  1GA8 A;  3T57 A;  2VS4 A;  4FRH A;  4MYB A;  3C8V A;  3RMV A;  2X65 A;  2Y4M A;  3PKP A;  3K8D A;  1YP2 A;  2OI5 A;  1MR9 A;  1GX0 A;  5L6V A;  4NAL A;  2E8B A;  1FR9 A;  1W57 A;  1ON6 A;  3DUV A;  3DK5 A;  3HJJ A;  2PGV A;  3EE5 A;  3I0F A;  2AGD A;  2D7I A;  2QH5 A;  4UEG A;  2IC7 A;  5C1L A;  4IHF A;  1FOA A;  3NZ2 A;  2V0K A;  3VBP A;  2O1G A;  1HV9 A;  4HO4 A;  3I0C A;  5FV9 A;  1G97 A;  3DJ4 A;  1ZHJ A;  1ZJ2 A;  4Y9X A;  3BFP A;  3VBN A;  1QWJ A;  1LZ0 A;  2VSI A;  3HSQ A;  1GWV A;  1H7G A;  4D11 C;  2D7R A;  2O1H A;  5L6S A;  5FTS A;  3RMW A;  2XMH A;  3I0G A;  2WLE A;  1GX4 A;  1VIC A;  4ASJ A;  2FFV A;  3Q80 A;  4HG6 A;  3FTT A;  3JUJ A;  2VXM A;  4CJB A;  3R8Y A;  5C4E A;  3P47 A;  3TZT A;  1S80 A;  1QRL A;  2FYB A;  1G95 A;  4D0Z A;  4EA9 A;  1W55 A;  2O1F A;  3BSS A;  4EE4 A;  4Y7V A;  4EA7 A;  2RJ7 A;  3GQ8 A;  4KNR A;  1FO9 A;  3SXG A;  3CGX A;  1JYL A;  1KGQ A;  4B4G A;  1YP4 A;  5C1H A;  1HM9 A;  3JQY A;  1H5R B;  1QRG A;  4EAB A;  2CU2 A;  4R7P A;  2FYD B;  1GQ9 A;  4IHG A;  2I5E A;  1H7T A;  3FSY A;  3OH4 A;  1QG8 A;  1R7U A;  1JV3 A;  1VPA A;  3PMO A;  1MP3 A;  3PNN A;  4IRP A;  2PX7 A;  1R7V A;  1ZDG A;  4E1K A;  5FTV A;  5C38 A;  2WAW A;  1OCX A;  2TDT A;  3DHO A;  4HZD A;  4D11 A;  5DG3 A;  3GQA A;  4FRA A;  1MC3 A;  1LL2 A;  3D8V A;  2VS5 A;  1KK5 A;  4MIX A;  1MRL A;  1I52 A;  4KC4 A;  1R80 A;  3EH0 A;  3U0Y A;  1KWS A;  1O23 B;  1OQM B;  5C48 A;  1ZI4 A;  2BO6 A;  3GOS A;  2P72 A;  4M9C A;  1ZDF A;  2JCO A;  3QVB A;  1ZCV A;  3CJ8 A;  1G23 A;  5FU8 A;  1H5S C;  1V3W A;  4K6R A;  2WVL A;  1HM0 A;  1SSQ A;  2FFU A;  3BXY A;  1S4O A;  3CKJ A;  3R5A A;  2UX8 A;  4AC3 A;  1WT1 A;  3U2W A;  2RIJ A;  1OMZ A;  4B2X A;  4E75 A;  2P2O A;  5EJZ A;  1QRF A;  1YP3 A;  1NKH B;  5I1F A;  1LL0 A;  2RIZ A;  4DCL A;  2YC3 A;  4AYJ A;  2AM5 A;  3BSW A;  2FYA A;  3CKQ A;  2RJ4 A;  5EIY A;  1H7L A;  2RJ8 A;  1EZI A;  4N6A A;  2RIX A;  2V0H A;  1L0S A;  1IIN A;  5C4C A;  3R0S A;  2VXL A;  2AH9 A;  4ASY A;  5AFU U;  1H4E A;  2X5Z A;  1JVD A;  1VGZ A;  1LZJ A;  1N4I A;  5AJN A;  4EA8 A;  4KC1 A;  3SXC A;  4MFG A;  1H5S B;  3V8Z A;  3TK8 A;  3SXB A;  2WVM A;  4M99 A;  2XWL A;  3KIA A;  4L41 C;  1H5S A;  1WT0 A;  1LXA A;  3ZF8 A;  5IFY A;  1M8N A;  2NPO A;  2QIV X;  3R2W A;  3I0I X;  2W0W A;  3OH0 A;  4E6T A;  1VGT A;  4B3U A;  5HS2 A;  2YC5 A;  3OW5 A;  1NF5 B;  1V83 A;  2ICY A;  3NGW A; 
#chains in the Genus database with same CATH homology
 3V0Q A;  3CKN A;  4KC2 A;  4P00 A;  2VFZ A;  1KRV A;  5FU0 A;  4EEO A;  2MZB A;  1WT3 A;  5IDS A;  4FQW A;  3V0M A;  2A8W A;  2W0V A;  2WVK A;  5C8R A;  4EEA A;  3TV0 A;  2ZU8 A;  3I3X A;  2RJ0 A;  3BRK X;  3Q1X A;  4CJ8 A;  3ZGF A;  2FKO A;  2Z87 A;  3T7M A;  4HO0 A;  3IOI A;  1G9R A;  2NXV A;  3IOH A;  5C3B A;  3OH2 A;  4O6N A;  4FRO A;  4MZU A;  3IGJ A;  4M4K A;  4Y7U A;  2YQS A;  1FO8 A;  4Y64 A;  3U2V A;  2FY7 A;  5CMH A;  3F1Y A;  1H4D A;  1VGW A;  1KGT A;  1MR7 A;  1QQ0 A;  4B5B A;  3ECT A;  1H5T B;  1R82 A;  4MYO A;  4G3Q A;  4N6B A;  5CQM X;  1G1L A;  1H5T A;  5U2K A;  5C3D A;  4FRD A;  2YCM A;  4LW6 A;  5FUH A;  4Y62 A;  3R5C A;  3VBL A;  5C4B A;  1WSZ A;  3R5B A;  4FIY A;  1LZI A;  3SXA A;  1ZIZ A;  2BO7 A;  3ZGG A;  2WE9 A;  3V4E A;  1H5R A;  1ZJP A;  2ZU7 A;  4AA7 A;  3USR A;  1ZI5 A;  4M98 A;  3Q7U A;  1KRU A;  1H4C A;  2Y4J A;  2I7B A;  1LZ7 A;  4IHH A;  4R36 A;  4DDZ A;  3K8E A;  4O6M A;  1NWG B;  4N69 A;  1ZCY A;  5F42 A;  3POL A;  2IU8 A;  1GQC A;  2AQ9 A;  1H7Q A;  3I0J A;  5DDV A;  2J0A A;  1VZT A;  4HO6 A;  3EEV A;  3SXE A;  1XHD A;  3IXC A;  2RJ1 A;  1G3L A;  2I5K A;  5AFU V;  3E26 A;  4HO5 A;  3OTM A;  5C49 A;  1R7Y A;  1QRE A;  5AJP A;  2WLF A;  2RJ5 A;  4EEM A;  3V0L A;  1ZJ1 A;  1HJL A;  3FSC A;  2X5S A;  5FYE A;  3ST8 A;  1S4N A;  4JIS A;  1TZF A;  3FSB A;  4HOC A;  4Y7T A;  4XWI A;  2AM4 A;  4N27 A;  5CQL X;  5DDT A;  5IDT A;  2V0L A;  2YES A;  1G93 A;  3KWD A;  4M2A A;  1YRO B;  4BMA A;  3R1W A;  3VBI A;  3V0O A;  3EG4 A;  1QGQ A;  2C0N A;  2JF2 A;  1QGS A;  1K4V A;  4ARW A;  1VH1 A;  3V91 A;  5AJO A;  3MQH A;  3CKO A;  1ZI3 A;  1J2Z A;  1T3D A;  4KXO A;  1FR8 A;  4CJC A;  1NQI B;  3OGZ A;  3V8Y A;  1VZX A;  2WEE A;  3PKQ A;  2RJ9 A;  3CU0 A;  3OH1 A;  4B4M A;  4KPX A;  2E3D A;  1IIM A;  3D98 A;  3SRT A;  3O3P A;  4B42 A;  1E5K A;  3I3A A;  4HCQ A;  3SX3 A;  2JCJ A;  1GWW A;  3N9W A;  5CQN X;  4EGG A;  2WLC A;  1TW1 A;  3BSY A;  2P73 A;  2XME A;  2YQH A;  3T7O A;  5C47 A;  1TVY A;  1H7H A;  1KRR A;  1FRW A;  2BO4 A;  3OAM A;  4KPZ A;  2GGQ A;  1FXO A;  2JCL A;  4HUR A;  1SSM A;  4YS8 A;  3U2T A;  4HZC A;  1NMM B;  2WLG A;  1MP5 A;  1TDT A;  5D92 A;  1WVC A;  2Y6P A;  4FCE A;  3TDT A;  5EJ1 A;  2PA4 A;  5CMF X;  2Y7A A;  3TIO A;  4M2B A;  2Q4J A;  3U2U A;  3GVD A;  3JUK A;  4ECM A;  2OEF A;  2ICX A;  3I0K A;  3FOQ A;  1VH3 A;  4EQY A;  2DPW A;  2VS3 A;  3LW6 A;  3D5N A;  5DEM A;  3F1X A;  3R5D A;  3FWW A;  1NHE B;  1G2V A;  1VZU A;  3BCV A;  4AAW A;  3I0H A;  1LL3 A;  2XAT A;  4HO3 A;  4C2S A;  1SST A;  3V90 A;  4B4B A;  2WLD A;  3R3R A;  1TW5 A;  4M28 A;  2Y4L A;  1G8O A;  4HO9 A;  4J09 A;  1PZT A;  4MND A;  4LW3 A;  3E25 A;  3OC9 A;  1V67 A;  3MQG A;  1JVG A;  3KWE A;  4G3S A;  3VBM A;  1W77 A;  5CMI A;  1ZJ0 A;  4Y63 A;  4D48 A;  4HO2 A;  5BXC A;  1ZJ3 A;  4CVH A;  2FYC B;  2QGI A;  1MP4 A;  5D91 A;  1FZW A;  4KRV A;  4KT7 A;  5C3A A;  2D0J A;  1VGU A;  2X60 A;  2V0I A;  3V0N A;  2OI6 A;  2YQJ A;  2IU9 A;  4Y7G A;  1FXJ A;  3V0P A;  3OH3 A;  3TWD A;  4J18 A;  4Y6U A;  1WT2 A;  1G0R A;  3OKR A;  5C4F A;  3SPT A;  4KQL A;  3MC4 A;  1ZI1 A;  2XWN A;  4FIX A;  5CMJ A;  3TQD A;  5E3R A;  2A8U A;  5E3P A;  1O0R A;  2XWM A;  2QIA A;  4KNX A;  3VNP A;  3SXD A;  4FRB A;  2QKX A;  1FWY A;  2ZU9 A;  4Y7F A;  3Q4S A;  1H5S D;  4FRM A;  2J0B A;  1V82 A;  3OUP A;  5DEP A;  4NAN A;  4D0T A;  1H7F A;  4EE5 A;  2AE7 A;  2JCK A;  2VHE A;  1H7E A;  4E79 A;  2PGY A;  3SX7 A;  3I0E A;  4B2W A;  1R7T A;  1XZ6 A;  1R7X A;  3SX8 A;  4P02 A;  1ON8 A;  4E6U A;  3I0D A;  3ZLL A;  2Z86 A;  3I0L A;  4ZDQ A;  3OU9 A;  1HJJ A;  2P6W A;  3VBK A;  1PZY B;  3IOJ A;  3SX5 A;  1V84 A;  4NAK A;  2IUA A;  3FS8 A;  5JQQ A;  2OEG A;  1FG5 N;  4ISX A;  4HO8 A;  1EYR A;  4GBP A;  3T7N A;  4EEG A;  3VBJ A;  1H3M A;  4FRE A;  4Y6N A;  3U0X A;  1KK4 A;  5ADX V;  1JYK A;  2AEC A;  1R81 A;  1Z90 A;  4EE3 A;  1XAT A;  4FRQ A;  4R37 A;  5C1G A;  4HUS A;  3TIS A;  1FGG A;  5E3Q A;  3JTJ A;  1KK6 A;  1ZCT A;  1ZJO A;  2AM3 A;  4FRP A;  2VK9 A;  2JF3 A;  1SS9 A;  3U2X A;  4DEC A;  4JD0 A;  2VD4 A;  3CKV A;  4Q7C A;  1THJ A;  2BO8 A;  1ZCU A;  1HM8 A;  3P1B A;  4G87 A;  1VM8 A;  4IRQ A;  1O7Q A;  5CQP A;  3OTZ A;  2Y4K A;  2OI7 A;  2YQC A;  1KQA A;  3R3I A;  3HL3 A;  1FGX A;  3KWC A;  1OMX A;  2V0J A;  1S4P A;  1KHR A;  2WGZ A;  5C4D A;  4EVW A;  1LVW A;  4FRL A;  4G3P A;  4NAI A;  1O7O A;  5CMG X;  3F1C A;  3USQ A;  4FCU A;  2RIY A;  5J49 A;  1QRM A;  5CQO A;  2VSH A;  2GGO A;  3ZLK A;  1INJ A;  5C36 A;  3FSX A;  3GUE A;  4H7O A;  4EAA A;  1INI A;  2RIT A;  1XHB A;  2APC A;  3RSB A;  4AYL A;  2RJ6 A;  4BQH A;  2AES A;  4DE7 A;  1JV1 A;  5ADX U;  1GA8 A;  3T57 A;  2VS4 A;  4FRH A;  4MYB A;  3C8V A;  3RMV A;  2X65 A;  2Y4M A;  3PKP A;  3K8D A;  1YP2 A;  2OI5 A;  1MR9 A;  1GX0 A;  5L6V A;  4NAL A;  2E8B A;  1FR9 A;  1W57 A;  1ON6 A;  3DUV A;  3DK5 A;  3HJJ A;  2PGV A;  3EE5 A;  3I0F A;  2AGD A;  2D7I A;  2QH5 A;  4UEG A;  2IC7 A;  5C1L A;  4IHF A;  1FOA A;  3NZ2 A;  2V0K A;  3VBP A;  2O1G A;  1HV9 A;  4HO4 A;  3I0C A;  5FV9 A;  1G97 A;  3DJ4 A;  1ZHJ A;  1ZJ2 A;  4Y9X A;  3BFP A;  3VBN A;  1QWJ A;  1LZ0 A;  2VSI A;  3HSQ A;  1GWV A;  1H7G A;  4D11 C;  2D7R A;  2O1H A;  5L6S A;  5FTS A;  3RMW A;  2XMH A;  3I0G A;  2WLE A;  1GX4 A;  1VIC A;  4ASJ A;  2FFV A;  3Q80 A;  4HG6 A;  3FTT A;  3JUJ A;  2VXM A;  4CJB A;  3R8Y A;  5C4E A;  3P47 A;  3TZT A;  1S80 A;  1QRL A;  2FYB A;  1G95 A;  4D0Z A;  4EA9 A;  1W55 A;  2O1F A;  3BSS A;  4EE4 A;  4Y7V A;  4EA7 A;  2RJ7 A;  4KNR A;  1FO9 A;  3SXG A;  3CGX A;  1JYL A;  1KGQ A;  4B4G A;  1YP4 A;  5C1H A;  1HM9 A;  3JQY A;  1H5R B;  1QRG A;  4EAB A;  2CU2 A;  4R7P A;  2FYD B;  1GQ9 A;  4IHG A;  2I5E A;  1H7T A;  3FSY A;  1QG8 A;  1R7U A;  1VPA A;  1JV3 A;  3OH4 A;  3PMO A;  1MP3 A;  3PNN A;  4IRP A;  2PX7 A;  1R7V A;  1ZDG A;  4E1K A;  5FTV A;  5C38 A;  2WAW A;  1OCX A;  2TDT A;  3DHO A;  4HZD A;  4D11 A;  5DG3 A;  4FRA A;  1MC3 A;  1LL2 A;  3D8V A;  2VS5 A;  1KK5 A;  4MIX A;  1MRL A;  1I52 A;  4KC4 A;  1R80 A;  3EH0 A;  3U0Y A;  1KWS A;  1O23 B;  1OQM B;  5C48 A;  1ZI4 A;  2BO6 A;  3GOS A;  2P72 A;  4M9C A;  1ZDF A;  2JCO A;  3QVB A;  1ZCV A;  3CJ8 A;  1G23 A;  5FU8 A;  1H5S C;  1V3W A;  4K6R A;  2WVL A;  1HM0 A;  1SSQ A;  2FFU A;  3BXY A;  1S4O A;  3CKJ A;  3R5A A;  2UX8 A;  4AC3 A;  1WT1 A;  3U2W A;  2RIJ A;  1OMZ A;  4B2X A;  4E75 A;  2P2O A;  5EJZ A;  1QRF A;  1YP3 A;  1NKH B;  5I1F A;  1LL0 A;  2RIZ A;  4DCL A;  2YC3 A;  4AYJ A;  2AM5 A;  3BSW A;  2FYA A;  3CKQ A;  2RJ4 A;  5EIY A;  1H7L A;  2RJ8 A;  1EZI A;  4N6A A;  2RIX A;  2V0H A;  1IIN A;  5C4C A;  3R0S A;  2VXL A;  2AH9 A;  4ASY A;  5AFU U;  1H4E A;  2X5Z A;  1JVD A;  1VGZ A;  1LZJ A;  5AJN A;  4EA8 A;  4KC1 A;  3SXC A;  4MFG A;  1H5S B;  3V8Z A;  3TK8 A;  3SXB A;  2WVM A;  4M99 A;  2XWL A;  3KIA A;  4L41 C;  1H5S A;  1WT0 A;  1LXA A;  3ZF8 A;  5IFY A;  2QIV X;  2NPO A;  3R2W A;  3I0I X;  2W0W A;  4E6T A;  3OH0 A;  1VGT A;  4B3U A;  5HS2 A;  2YC5 A;  3OW5 A;  1NF5 B;  1V83 A;  2ICY A;  3NGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...