3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 127
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
2W5TA 1EQJA 2W5WA 1E33P 1KH5A 4ZGAA 5L0BA 5DLTA 1URBA 4LRBA 3UN5A 3T01A 4NWJA 1ALIA 3LXQA 1KHLA 2W8DA 3CMRA 4GTZA 4UORA 3MK2A 4LRFA 4CXKA 2RH6A 3T02A 1E2SP 1URAA 2W5XA 4LR2A 4CYSA 4ZG7A 5L0EA 5TJ3A 3E2DA 5HRTA 1ALKA 3ED4A 4ZG6A 4GTWA 2VQRA 3BDFA 3DPCA 1EW2A 4GTYA 1O99A 1AJDA 1E1ZP 1KH4A 5EGHA 3NKMA 4KM4A 5LQQA 4FDIA 2G9YA 1ELZA 4LRCA 3TG0A 5KXAA 4CXUA 1KH7A 1ALHA 3IDDA 3NKNA 1HJKA 5INHA 4NWXA 2W8SA 1ELXA 3M8ZA 1Y7AA 1K7HA 3TX0A 5IJSA 2IUCA 4LREA 5LRNA 5GRRA 3OT9A 2W5RA 3WBHA 4MY4A 4LRDA 1EW8A 4LR7A 1ALJA 2ZKTA 5LIAA 3NKPA 3WAVA 3NVLA 4ZG9A 1EI6A 3MK1A 4YR1A 2GSUA 1EJJA 3SZYA 5IJQA 3IGYB 1AJBA 2IFYA 3BDGA 4LQYA 1B8JA 1E3CP 4N7TA 4UPKA 1SHQA 4KJGA 2W5QA 3DYCA 4UPHA 2XR9A 1AJAA 4UOPA 3WAWA 1N2KA 1AUKA 1KHNA 1KHJA 2D1GA 4KJDA 1ZEFA 4UPIA 3B5QA 4LR9A 3WAXA 2GA3A 3WAYA 3BDGB 3A52A 3M7VA 1KHKA 1N2LA 5EGEA 2XRGA 5AJ9A 4CYRA 3TWZA 1AJCA 1O98A 1HQAA 3NKRA 3MK0A 4LR8A 3BDHA 1KH9A 4GTXA 2GSOA 1ANJA 3Q3QA 2X98A 3UN3A 2IUCB 1EW9A 2GSNA 2W5VA 4TN0A 1P49A 4MHXA 3NKOA 3T00A 4LRAA 4UOOA 5GOVA 3M8WA 3UNYA 2QZUA 1ED9A 1ANIA 2W5SA 1FSUA 1ZEDA 3M8YA 5K4PA 3UN2A 3UO0A 4FDJA 5DLVA 3KD8A 4CXSA 4KAYA 2ANHA 4B56A 5DLWA 1Y6VA 4UPLA 3IGZB 1ELYA 4KAVA 3SZZA 1ZEBA 1ED8A 2GLQA 1HDHA 4MIVA 1SHNA 5LRMA 3NKQA 5L0KA 4QAXA 5C66A
chains in the Genus database with same CATH superfamily
2W5TA 2W5WA 3S2HK 3M4OC 4ZGAA 3V4GA 4LRBA 3T01A 4NWJA 2R7ZC 4LK0A 1ALIA 3CMRA 3LXQA 1WQGA 4LRFA 2W5XA 1TWCK 4A3JK 4A3EC 4YG2A 4PAAA 3I4NC 3N0CA 3CQZC 3HOYC 1DCOA 2VQRA 2VUMC 4BBSC 5TMCA 4A3MC 3GTQA 4C3IC 4XLPA 1AJDA 4LK1A 4C3JC 4OIQA 2JA6C 5FLMC 4P9SA 1SFOK 1TWGK 4XSXA 3PO3K 4A3IC 4GTAA 5IYCK 2D6FC 5E68A 3GTOA 3VA7A 3IDDA 4BXXC 5D4DA 1GE9A 4NWXA 5IP9K 1EFWA 1Y7AA 1R9TC 1TWHA 3HOZC 3TX0A 4A3DC 2IUCA 4PABA 5IP7C 4GTBA 1DCPA 4GTFA 2O5IA 2ZUEA 3FKIA 2W5RA 5IORA 4A3GC 1F7UA 4KM9A 3GTLK 4LR7A 4C3HK 2Y0SL 1BS2A 3S0XA 4YR1A 1F9NA 4OIPA 1EJJA 3SZYA 5C3EC 2JA7K 1IQ0A 4Y52K 3IGYB 1I3QA 1ZVUA 2A6HA 4FM9A 1B8JA 4N7TA 5IOQA 4UPKA 4KB2A 4KMUA 5IOSA 2NVTK 4UPHA 1TWAA 4UOPA 3WAWA 2A69A 1KHJA 3AD9C 2NVYA 4GFQA 1I6VA 4LR9A 4KB4A 3JSTA 1C0AA 4O2DA 3S17C 4MEXA 5EGEA 4MQ9A 3TWZA 1O98A 3AD8C 3S15C 3S14K 3GTJC 4Q5SA 1I50K 1PJ6A 3UN3A 1K83K 4MHXA 1ZBSA 2Y3PA 3GTMA 4KN7A 4OINA 1IE0A 3M4OK 1ED9A 3UNYA 2A68A 4OIOA 5DLVA 2R7ZK 3KD8A 4B56A 1Y6VA 1O2FB 1WIHA 4BLAA 2R92A 1ED8A 2B63C 4KAWX 1XZQA 2V6UA 4A3EK 3I4NK 3CQZK 3HOYK 1Y1VC 4WJ3M 5C66A 2VUMK 1Y1WC 4BBSK 1KH5A 4A3MK 4C3IK 4C2MC 5DLTA 2V6TA 2PA8L 4C3JK 3FHZA 3UN5A 3H0GA 2JA6K 4GTZA 5FLMK 4UORA 4A3BC 4WJ4A 1BGWA 1WOPA 2E2JC 2RH6A 1YNJA 2NVQC 1XZQB 3T02A 2E2HA 1ISEA 4A3IK 4A93C 5L0EA 2JH3A 1X31C 5HRTA 2Y0SD 4YFXA 4BXXK 1XPPA 3AQPA 1JQWA 4ZG6A 3S2DC 4NOIA 2P5MA 3BDFA 3TFIA 1R9TK 3HOZK 4A3DK 4QJVA 1E1ZP 2R92C 1KH4A 3NKMA 4GTEA 3MMLB 4ILDA 3N0BA 3RZDC 4A3GK 2G9YA 3PO2C 2R93C 4LRCA 3TG0A 3GTGC 1ZXOA 3WODA 3HOVC 4BY7C 4CXUA 3S1QC 1KH7A 1IL2A 3HXAA 5C3EK 1ELXA 3M8ZA 1K7HA 4A3CC 5IJSA 4LREA 5C4JC 1ZQ1C 2YU9A 1O2AA 2JA8C 3OT9A 2JA5A 3RZOC 4LRDA 2PPBA 2FQOA 3L4JA 1ALJA 3LAJA 4A3KC 3NKPA 1J6XA 3S16C 3WAVA 3GEEA 3NVLA 4A3LC 3DXJA 4YFKA 2GSUA 2WB1L 5IYDC 1INNA 1AB4A 3S17K 3BDGA 2E2IA 3NUHA 3S15K 1JVIA 3BP8C 3GTJK 1WSRA 2NVXA 1O25A 1O24A 3K7AC 1KHNA 1VJEA 4UPIA 2WAQL 3B5QA 5CJ9A 2PHCB 3HKZL 1I6HC 2YU9C 3A52A 3BDGB 3M7VA 5C44C 1KHKA 2PA8D 1TWCA 1O29A 2JA5C 2RGRA 1AJCA 3NKRA 4P5AA 1VRQC 2V6SA 3G4AA 2B63K 3GTQC 1KH9A 3BDHA 1ANJA 3Q3QA 1J6WA 4BLBA 2IUCB 2GSNA 4A3FC 1Y1VK 4RMFA 3T00A 1VGXA 1EQRA 3HOWC 1Y1WK 1TWFA 4XSZA 4C2MK 5C4XC 1SFOA 1TWGA 3GTOC 4FDJA 4CXSA 4AYBL 5DLWA 4A3BK 2E2JK 5M5XK 3IGZB 1RU0A 1WSVA 2NVQK 1IS1A 4XCHA 4Y7NC 3HOXC 1TWHC 1ZEBA 1EK8A 4A93K 1SHNA 4GTCA 3NKQA 5HL8A 3FKIC 1L0WA 3S2DK 3FOEA 4QAXA 4KATA 3GEIA 1EQJA 4GTLA 1ZYRA 5L0BA 2R92K 3GTLA 4GZYA 1URBA 1KHLA 4LOWA 3RZDK 3PO2K 3MK2A 2R93K 4CXKA 1JOEA 3GTGK 3H3VL 1I3QC 1E2SP 4LR2A 3HOVK 4BY7K 3S1QK 2JA7A 1J98A 1ALKA 1TWFC 3ED4A 4GTWA 3LPXA 1TWAC 2WB1D 4A3CK 3EQLA 4G0VA 3S1NC 1WCMA 3G4CA 5C4JK 1IW7A 3M3YC 2NVYC 2JA8K 4KM4A 5LQQA 4FDIA 1YNNA 1VLOA 5M3FK 5IOTA 3RZOK 4X6AC 5KXAA 4A3KK 3OREA 3S16K 4A3LK 3OPFA 1HJKA 3AD7C 4J3NA 1O27A 2WAQD 2CW0A 5IYDK 3HKZD 2ZFZA 1YX2A 1F93A 1I50A 1DD5A 3OEPA 3S1RC 3GTMC 5LRNA 1PJ5A 5GRRA 4DDQA 3WBHA 4MY4A 5M5YK 3K7AK 2ZKTA 3ADAC 4ZG9A 3MK1A 1BDFA 2R7ZA 1WCMC 5IYBK 3AH5A 3GEHA 5IJQA 2FQTA 1I6HK 2YU9K 2XCOA 1AJBA 5C44K 5CHPA 4LQYA 2JA5K 1E3CP 5TMFA 4AYBD 1SHQA 4KJGA 3GTQK 1G51A 4JK1A 4MEYA 1B4AA 2XR9A 1IBAA 4A3FK 3H0GC 4WILA 3AQOA 4QJVB 1AUKA 4KJDA 3HOWK 3S1MC 1ZEFA 1USMA 2ZUFA 1UV7A 4AH6A 5C4XK 2E2HC 3WAYA 3GTOK 2GAGC 4G7HA 5AJ9A 3CAGA 4CYRA 3GTKA 4Y7NK 3HOXK 1TWHK 3MK0A 4LR8A 1V5VA 3H3VD 4GTXA 4G0WA 1EW9A 1R9TA 4TN0A 1EH1A 3FKIK 4KMAA 3NKOA 4KARA 4UOOA 1SMYA 2QZUA 2GAHC 1ANIA 2W5SA 3GTPA 1FSUA 5K4PA 3UN2A 1VH2A 3A8KA 4KAYA 4UPLA 1ELYA 3TFHA 1I3QK 5IYBC 1HDHA 5LRMA 3N3YA 1TWFK 5L0KA 1HQMA 1TWAK 3L4KA 3S1NK 1E33P 4GT9A 3GTKC 3M3YK 2NVYK 4FZBA 1WQFA 1HI9A 2W7VA 4Q4ZA 2W8DA 4BBRC 1KQ4A 2EBBA 4X6AK 3HOUC 3TFJA 2O5JA 1URAA 4CYSA 1O28A 2E2IC 4ZG7A 5TJ3A 3E2DA 1O2BA 2BE5A 4KASA 2NVXC 4M1XA 3I4MC 2XCQA 4P5BA 3GTPC 3DPCA 1YCLA 1EW2A 4GTYA 3S2HC 4G7ZA 3GTJA 1O99A 4G7OA 4BY1K 3GTMK 1XXAA 5EGHA 2PMZL 3S1RK 4OIRA 2KWAA 1ELZA 5M3MK 1XXBA 5FJ8K 4BKWA 4QIWL 4KMDA 4G0UA 1TWCC 4A3JC 1ALHA 3NKNA 1WCMK 5JFEA 2XCRB 4KDDA 5INHA 4C45A 2W8SA 2P8TA 2B63A 1O26A 3QX3A 4KM8A 1Y1VA 4LLGA 1WOSA 2A6EA 1TWGC 1SFOC 3H0GK 1Y1WA 1EW8A 5LIAA 1XZPA 3PO3C 4KN4A 5IYCC 3S1MK 1EI6A 2E2HK 1BJTA 5IP9C 2IFYA 3TTGA 3A8JA 2W5QA 3DYCA 4ZH4A 3IPJA 3GTLC 1AJAA 1XZPB 1B4BA 1N2KA 4LJZA 4C3HC 1USOA 2D1GA 1XXCA 4BY1C 3LAPA 1K83A 3WAXA 2GA3A 1WOOA 2R93A 2JA7C 4Y52C 3GTGA 1DCHA 5JVOA 1N2LA 2XRGA 1J6VA 4YFNA 1HQAA 3GSIA 2NVTC 3A8IA 2GSOA 2X98A 4KC6A 2W5VA 1P49A 2CFAA 3ERED 4KMHA 3BP3A 4LRAA 5M5WK 3M8WA 5GOVA 3GTKK 1WQHA 3CQZA 3UO0A 1ZEDA 1WORA 1PJ7A 3M8YA 2VUMA 2ANHA 4BBRK 2PMZD 4XLNA 3HOUK 3GIRA 4KAVA 3SZZA 4GTDA 2E2IK 3S14C 3GDZA 4QIWD 3BUEA 2JA6A 5IP7K 2GLQA 4MIVA 1I50C 2CFAB 2NVXK 1F7VA 3I4MK 1K83C 5L46A 3GTPK 3FOFA
chains in the Genus database with same CATH topology
2W5TA 1EQJA 2W5WA 1E33P 1KH5A 4ZGAA 5L0BA 5DLTA 1URBA 4LRBA 3UN5A 3T01A 4NWJA 1ALIA 3LXQA 1KHLA 2W8DA 3CMRA 4GTZA 4UORA 3MK2A 4LRFA 4CXKA 2RH6A 3T02A 1E2SP 1URAA 2W5XA 4LR2A 4CYSA 4ZG7A 5L0EA 5TJ3A 3E2DA 5HRTA 1ALKA 3ED4A 4ZG6A 4GTWA 2VQRA 3BDFA 3DPCA 1EW2A 4GTYA 1O99A 1AJDA 1E1ZP 1KH4A 5EGHA 3NKMA 4KM4A 5LQQA 4FDIA 2G9YA 1ELZA 4LRCA 3TG0A 5KXAA 4CXUA 1KH7A 1ALHA 3IDDA 3NKNA 1HJKA 5INHA 4NWXA 2W8SA 1ELXA 3M8ZA 1Y7AA 1K7HA 3TX0A 5IJSA 2IUCA 4LREA 5LRNA 5GRRA 3OT9A 2W5RA 3WBHA 4MY4A 4LRDA 1EW8A 4LR7A 1ALJA 2ZKTA 5LIAA 3NKPA 3WAVA 3NVLA 4ZG9A 1EI6A 3MK1A 4YR1A 2GSUA 1EJJA 3SZYA 5IJQA 3IGYB 1AJBA 2IFYA 3BDGA 4LQYA 1B8JA 1E3CP 4N7TA 4UPKA 1SHQA 4KJGA 2W5QA 3DYCA 4UPHA 2XR9A 1AJAA 4UOPA 3WAWA 1N2KA 1AUKA 1KHNA 1KHJA 2D1GA 4KJDA 1ZEFA 4UPIA 3B5QA 4LR9A 3WAXA 2GA3A 3WAYA 3BDGB 3A52A 3M7VA 1KHKA 1N2LA 5EGEA 2XRGA 5AJ9A 4CYRA 3TWZA 1AJCA 1O98A 1HQAA 3NKRA 3MK0A 4LR8A 3BDHA 1KH9A 4GTXA 2GSOA 1ANJA 3Q3QA 2X98A 3UN3A 2IUCB 1EW9A 2GSNA 2W5VA 4TN0A 1P49A 4MHXA 3NKOA 3T00A 4LRAA 4UOOA 5GOVA 3M8WA 3UNYA 2QZUA 1ED9A 1ANIA 2W5SA 1FSUA 1ZEDA 3M8YA 5K4PA 3UN2A 3UO0A 4FDJA 5DLVA 3KD8A 4CXSA 4KAYA 2ANHA 4B56A 5DLWA 1Y6VA 4UPLA 3IGZB 1ELYA 4KAVA 3SZZA 1ZEBA 1ED8A 2GLQA 1HDHA 4MIVA 1SHNA 5LRMA 3NKQA 5L0KA 4QAXA 5C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5T A;  1EQJ A;  2W5W A;  1E33 P;  1KH5 A;  4ZGA A;  5L0B A;  5DLT A;  1URB A;  4LRB A;  3UN5 A;  3T01 A;  4NWJ A;  1ALI A;  3LXQ A;  1KHL A;  2W8D A;  3CMR A;  4GTZ A;  4UOR A;  3MK2 A;  4LRF A;  4CXK A;  2RH6 A;  3T02 A;  1E2S P;  1URA A;  2W5X A;  4LR2 A;  4CYS A;  4ZG7 A;  5L0E A;  5TJ3 A;  3E2D A;  5HRT A;  1ALK A;  3ED4 A;  4ZG6 A;  4GTW A;  2VQR A;  3BDF A;  3DPC A;  1EW2 A;  4GTY A;  1O99 A;  1AJD A;  1E1Z P;  1KH4 A;  5EGH A;  3NKM A;  4KM4 A;  5LQQ A;  4FDI A;  2G9Y A;  1ELZ A;  4LRC A;  3TG0 A;  5KXA A;  4CXU A;  1KH7 A;  1ALH A;  3IDD A;  3NKN A;  1HJK A;  5INH A;  4NWX A;  2W8S A;  1ELX A;  3M8Z A;  1Y7A A;  1K7H A;  3TX0 A;  5IJS A;  2IUC A;  4LRE A;  5LRN A;  5GRR A;  3OT9 A;  2W5R A;  3WBH A;  4MY4 A;  4LRD A;  1EW8 A;  4LR7 A;  1ALJ A;  2ZKT A;  5LIA A;  3NKP A;  3WAV A;  3NVL A;  4ZG9 A;  1EI6 A;  3MK1 A;  4YR1 A;  2GSU A;  1EJJ A;  3SZY A;  5IJQ A;  3IGY B;  1AJB A;  2IFY A;  3BDG A;  4LQY A;  1B8J A;  1E3C P;  4N7T A;  4UPK A;  1SHQ A;  4KJG A;  2W5Q A;  3DYC A;  4UPH A;  2XR9 A;  1AJA A;  4UOP A;  3WAW A;  1N2K A;  1AUK A;  1KHN A;  1KHJ A;  2D1G A;  4KJD A;  1ZEF A;  4UPI A;  3B5Q A;  4LR9 A;  3WAX A;  2GA3 A;  3WAY A;  3BDG B;  3A52 A;  3M7V A;  1KHK A;  1N2L A;  5EGE A;  2XRG A;  5AJ9 A;  4CYR A;  3TWZ A;  1AJC A;  1O98 A;  1HQA A;  3NKR A;  3MK0 A;  4LR8 A;  3BDH A;  1KH9 A;  4GTX A;  2GSO A;  1ANJ A;  3Q3Q A;  2X98 A;  3UN3 A;  2IUC B;  1EW9 A;  2GSN A;  2W5V A;  4TN0 A;  1P49 A;  4MHX A;  3NKO A;  3T00 A;  4LRA A;  4UOO A;  5GOV A;  3M8W A;  3UNY A;  2QZU A;  1ED9 A;  1ANI A;  2W5S A;  1FSU A;  1ZED A;  3M8Y A;  5K4P A;  3UN2 A;  3UO0 A;  4FDJ A;  5DLV A;  3KD8 A;  4CXS A;  4KAY A;  2ANH A;  4B56 A;  5DLW A;  1Y6V A;  4UPL A;  3IGZ B;  1ELY A;  4KAV A;  3SZZ A;  1ZEB A;  1ED8 A;  2GLQ A;  1HDH A;  4MIV A;  1SHN A;  5LRM A;  3NKQ A;  5L0K A;  4QAX A;  5C66 A; 
#chains in the Genus database with same CATH topology
 2W5T A;  2W5W A;  3S2H K;  3M4O C;  4ZGA A;  3V4G A;  4LRB A;  3T01 A;  4NWJ A;  2R7Z C;  4LK0 A;  1ALI A;  3CMR A;  3LXQ A;  1WQG A;  4LRF A;  2W5X A;  1TWC K;  4A3J K;  4A3E C;  4YG2 A;  4PAA A;  3I4N C;  3N0C A;  3CQZ C;  3HOY C;  1DCO A;  2VQR A;  2VUM C;  4BBS C;  5TMC A;  4A3M C;  3GTQ A;  4C3I C;  4XLP A;  1AJD A;  4LK1 A;  4C3J C;  4OIQ A;  2JA6 C;  5FLM C;  4P9S A;  1SFO K;  1TWG K;  4XSX A;  3PO3 K;  4A3I C;  4GTA A;  5IYC K;  2D6F C;  5E68 A;  3GTO A;  3VA7 A;  3IDD A;  4BXX C;  5D4D A;  1GE9 A;  4NWX A;  5IP9 K;  1EFW A;  1Y7A A;  1R9T C;  1TWH A;  3HOZ C;  3TX0 A;  4A3D C;  2IUC A;  4PAB A;  5IP7 C;  4GTB A;  1DCP A;  4GTF A;  2O5I A;  2ZUE A;  3FKI A;  2W5R A;  5IOR A;  4A3G C;  1F7U A;  4KM9 A;  3GTL K;  4LR7 A;  4C3H K;  2Y0S L;  1BS2 A;  3S0X A;  4YR1 A;  1F9N A;  4OIP A;  1EJJ A;  3SZY A;  5C3E C;  2JA7 K;  1IQ0 A;  4Y52 K;  3IGY B;  1I3Q A;  1ZVU A;  2A6H A;  4FM9 A;  1B8J A;  4N7T A;  5IOQ A;  4UPK A;  4KB2 A;  4KMU A;  5IOS A;  2NVT K;  4UPH A;  1TWA A;  4UOP A;  3WAW A;  2A69 A;  1KHJ A;  3AD9 C;  2NVY A;  4GFQ A;  1I6V A;  4LR9 A;  4KB4 A;  3JST A;  1C0A A;  4O2D A;  3S17 C;  4MEX A;  5EGE A;  4MQ9 A;  3TWZ A;  1O98 A;  3AD8 C;  3S15 C;  3S14 K;  3GTJ C;  4Q5S A;  1I50 K;  1PJ6 A;  3UN3 A;  1K83 K;  4MHX A;  1ZBS A;  2Y3P A;  3GTM A;  4KN7 A;  4OIN A;  1IE0 A;  3M4O K;  1ED9 A;  3UNY A;  2A68 A;  4OIO A;  5DLV A;  2R7Z K;  3KD8 A;  4B56 A;  1Y6V A;  1O2F B;  1WIH A;  4BLA A;  2R92 A;  1ED8 A;  2B63 C;  4KAW X;  1XZQ A;  2V6U A;  4A3E K;  3I4N K;  3CQZ K;  3HOY K;  1Y1V C;  4WJ3 M;  5C66 A;  2VUM K;  1Y1W C;  4BBS K;  1KH5 A;  4A3M K;  4C3I K;  4C2M C;  5DLT A;  2V6T A;  2PA8 L;  4C3J K;  3FHZ A;  3UN5 A;  3H0G A;  2JA6 K;  4GTZ A;  5FLM K;  4UOR A;  4A3B C;  4WJ4 A;  1BGW A;  1WOP A;  2E2J C;  2RH6 A;  1YNJ A;  2NVQ C;  1XZQ B;  3T02 A;  2E2H A;  1ISE A;  4A3I K;  4A93 C;  5L0E A;  2JH3 A;  1X31 C;  5HRT A;  2Y0S D;  4YFX A;  4BXX K;  1XPP A;  3AQP A;  1JQW A;  4ZG6 A;  3S2D C;  4NOI A;  2P5M A;  3BDF A;  3TFI A;  1R9T K;  3HOZ K;  4A3D K;  4QJV A;  1E1Z P;  2R92 C;  1KH4 A;  3NKM A;  4GTE A;  3MML B;  4ILD A;  3N0B A;  3RZD C;  4A3G K;  2G9Y A;  3PO2 C;  2R93 C;  4LRC A;  3TG0 A;  3GTG C;  1ZXO A;  3WOD A;  3HOV C;  4BY7 C;  4CXU A;  3S1Q C;  1KH7 A;  1IL2 A;  3HXA A;  5C3E K;  1ELX A;  3M8Z A;  1K7H A;  4A3C C;  5IJS A;  4LRE A;  5C4J C;  1ZQ1 C;  2YU9 A;  1O2A A;  2JA8 C;  3OT9 A;  2JA5 A;  3RZO C;  4LRD A;  2PPB A;  2FQO A;  3L4J A;  1ALJ A;  3LAJ A;  4A3K C;  3NKP A;  1J6X A;  3S16 C;  3WAV A;  3GEE A;  3NVL A;  4A3L C;  3DXJ A;  4YFK A;  2GSU A;  2WB1 L;  5IYD C;  1INN A;  1AB4 A;  3S17 K;  3BDG A;  2E2I A;  3NUH A;  3S15 K;  1JVI A;  3BP8 C;  3GTJ K;  1WSR A;  2NVX A;  1O25 A;  1O24 A;  3K7A C;  1KHN A;  1VJE A;  4UPI A;  2WAQ L;  3B5Q A;  5CJ9 A;  2PHC B;  3HKZ L;  1I6H C;  2YU9 C;  3A52 A;  3BDG B;  3M7V A;  5C44 C;  1KHK A;  2PA8 D;  1TWC A;  1O29 A;  2JA5 C;  2RGR A;  1AJC A;  3NKR A;  4P5A A;  1VRQ C;  2V6S A;  3G4A A;  2B63 K;  3GTQ C;  1KH9 A;  3BDH A;  1ANJ A;  3Q3Q A;  1J6W A;  4BLB A;  2IUC B;  2GSN A;  4A3F C;  1Y1V K;  4RMF A;  3T00 A;  1VGX A;  1EQR A;  3HOW C;  1Y1W K;  1TWF A;  4XSZ A;  4C2M K;  5C4X C;  1SFO A;  1TWG A;  3GTO C;  4FDJ A;  4CXS A;  4AYB L;  5DLW A;  4A3B K;  2E2J K;  5M5X K;  3IGZ B;  1RU0 A;  1WSV A;  2NVQ K;  1IS1 A;  4XCH A;  4Y7N C;  3HOX C;  1TWH C;  1ZEB A;  1EK8 A;  4A93 K;  1SHN A;  4GTC A;  3NKQ A;  5HL8 A;  3FKI C;  1L0W A;  3S2D K;  3FOE A;  4QAX A;  4KAT A;  3GEI A;  1EQJ A;  4GTL A;  1ZYR A;  5L0B A;  2R92 K;  3GTL A;  4GZY A;  1URB A;  1KHL A;  4LOW A;  3RZD K;  3PO2 K;  3MK2 A;  2R93 K;  4CXK A;  1JOE A;  3GTG K;  3H3V L;  1I3Q C;  1E2S P;  4LR2 A;  3HOV K;  4BY7 K;  3S1Q K;  2JA7 A;  1J98 A;  1ALK A;  1TWF C;  3ED4 A;  4GTW A;  3LPX A;  1TWA C;  2WB1 D;  4A3C K;  3EQL A;  4G0V A;  3S1N C;  1WCM A;  3G4C A;  5C4J K;  1IW7 A;  3M3Y C;  2NVY C;  2JA8 K;  4KM4 A;  5LQQ A;  4FDI A;  1YNN A;  1VLO A;  5M3F K;  5IOT A;  3RZO K;  4X6A C;  5KXA A;  4A3K K;  3ORE A;  3S16 K;  4A3L K;  3OPF A;  1HJK A;  3AD7 C;  4J3N A;  1O27 A;  2WAQ D;  2CW0 A;  5IYD K;  3HKZ D;  2ZFZ A;  1YX2 A;  1F93 A;  1I50 A;  1DD5 A;  3OEP A;  3S1R C;  3GTM C;  5LRN A;  1PJ5 A;  5GRR A;  4DDQ A;  3WBH A;  4MY4 A;  5M5Y K;  3K7A K;  2ZKT A;  3ADA C;  4ZG9 A;  3MK1 A;  1BDF A;  2R7Z A;  1WCM C;  5IYB K;  3AH5 A;  3GEH A;  5IJQ A;  2FQT A;  1I6H K;  2YU9 K;  2XCO A;  1AJB A;  5C44 K;  5CHP A;  4LQY A;  2JA5 K;  1E3C P;  5TMF A;  4AYB D;  1SHQ A;  4KJG A;  3GTQ K;  1G51 A;  4JK1 A;  4MEY A;  1B4A A;  2XR9 A;  1IBA A;  4A3F K;  3H0G C;  4WIL A;  3AQO A;  4QJV B;  1AUK A;  4KJD A;  3HOW K;  3S1M C;  1ZEF A;  1USM A;  2ZUF A;  1UV7 A;  4AH6 A;  5C4X K;  2E2H C;  3WAY A;  3GTO K;  2GAG C;  4G7H A;  5AJ9 A;  3CAG A;  4CYR A;  3GTK A;  4Y7N K;  3HOX K;  1TWH K;  3MK0 A;  4LR8 A;  1V5V A;  3H3V D;  4GTX A;  4G0W A;  1EW9 A;  1R9T A;  4TN0 A;  1EH1 A;  3FKI K;  4KMA A;  3NKO A;  4KAR A;  4UOO A;  1SMY A;  2QZU A;  2GAH C;  1ANI A;  2W5S A;  3GTP A;  1FSU A;  5K4P A;  3UN2 A;  1VH2 A;  3A8K A;  4KAY A;  4UPL A;  1ELY A;  3TFH A;  1I3Q K;  5IYB C;  1HDH A;  5LRM A;  3N3Y A;  1TWF K;  5L0K A;  1HQM A;  1TWA K;  3L4K A;  3S1N K;  1E33 P;  4GT9 A;  3GTK C;  3M3Y K;  2NVY K;  4FZB A;  1WQF A;  1HI9 A;  2W7V A;  4Q4Z A;  2W8D A;  4BBR C;  1KQ4 A;  2EBB A;  4X6A K;  3HOU C;  3TFJ A;  2O5J A;  1URA A;  4CYS A;  1O28 A;  2E2I C;  4ZG7 A;  5TJ3 A;  3E2D A;  1O2B A;  2BE5 A;  4KAS A;  2NVX C;  4M1X A;  3I4M C;  2XCQ A;  4P5B A;  3GTP C;  3DPC A;  1YCL A;  1EW2 A;  4GTY A;  3S2H C;  4G7Z A;  3GTJ A;  1O99 A;  4G7O A;  4BY1 K;  3GTM K;  1XXA A;  5EGH A;  2PMZ L;  3S1R K;  4OIR A;  2KWA A;  1ELZ A;  5M3M K;  1XXB A;  5FJ8 K;  4BKW A;  4QIW L;  4KMD A;  4G0U A;  1TWC C;  4A3J C;  1ALH A;  3NKN A;  1WCM K;  5JFE A;  2XCR B;  4KDD A;  5INH A;  4C45 A;  2W8S A;  2P8T A;  2B63 A;  1O26 A;  3QX3 A;  4KM8 A;  1Y1V A;  4LLG A;  1WOS A;  2A6E A;  1TWG C;  1SFO C;  3H0G K;  1Y1W A;  1EW8 A;  5LIA A;  1XZP A;  3PO3 C;  4KN4 A;  5IYC C;  3S1M K;  1EI6 A;  2E2H K;  1BJT A;  5IP9 C;  2IFY A;  3TTG A;  3A8J A;  2W5Q A;  3DYC A;  4ZH4 A;  3IPJ A;  3GTL C;  1AJA A;  1XZP B;  1B4B A;  1N2K A;  4LJZ A;  4C3H C;  1USO A;  2D1G A;  1XXC A;  4BY1 C;  3LAP A;  1K83 A;  3WAX A;  2GA3 A;  1WOO A;  2R93 A;  2JA7 C;  4Y52 C;  3GTG A;  1DCH A;  5JVO A;  1N2L A;  2XRG A;  1J6V A;  4YFN A;  1HQA A;  3GSI A;  2NVT C;  3A8I A;  2GSO A;  2X98 A;  4KC6 A;  2W5V A;  1P49 A;  2CFA A;  3ERE D;  4KMH A;  3BP3 A;  4LRA A;  5M5W K;  3M8W A;  5GOV A;  3GTK K;  1WQH A;  3CQZ A;  3UO0 A;  1ZED A;  1WOR A;  1PJ7 A;  3M8Y A;  2VUM A;  2ANH A;  4BBR K;  2PMZ D;  4XLN A;  3HOU K;  3GIR A;  4KAV A;  3SZZ A;  4GTD A;  2E2I K;  3S14 C;  3GDZ A;  4QIW D;  3BUE A;  2JA6 A;  5IP7 K;  2GLQ A;  4MIV A;  1I50 C;  2CFA B;  2NVX K;  1F7V A;  3I4M K;  1K83 C;  5L46 A;  3GTP K;  3FOF A; 
#chains in the Genus database with same CATH homology
 2W5T A;  1EQJ A;  2W5W A;  1E33 P;  1KH5 A;  4ZGA A;  5L0B A;  5DLT A;  1URB A;  4LRB A;  3UN5 A;  3T01 A;  4NWJ A;  1ALI A;  3LXQ A;  1KHL A;  2W8D A;  3CMR A;  4GTZ A;  4UOR A;  3MK2 A;  4LRF A;  4CXK A;  2RH6 A;  3T02 A;  1E2S P;  1URA A;  2W5X A;  4LR2 A;  4CYS A;  4ZG7 A;  5L0E A;  5TJ3 A;  3E2D A;  5HRT A;  1ALK A;  3ED4 A;  4ZG6 A;  4GTW A;  2VQR A;  3BDF A;  3DPC A;  1EW2 A;  4GTY A;  1O99 A;  1AJD A;  1E1Z P;  1KH4 A;  5EGH A;  3NKM A;  4KM4 A;  5LQQ A;  4FDI A;  2G9Y A;  1ELZ A;  4LRC A;  3TG0 A;  5KXA A;  4CXU A;  1KH7 A;  1ALH A;  3IDD A;  3NKN A;  1HJK A;  5INH A;  4NWX A;  2W8S A;  1ELX A;  3M8Z A;  1Y7A A;  1K7H A;  3TX0 A;  5IJS A;  2IUC A;  4LRE A;  5LRN A;  5GRR A;  3OT9 A;  2W5R A;  3WBH A;  4MY4 A;  4LRD A;  1EW8 A;  4LR7 A;  1ALJ A;  2ZKT A;  5LIA A;  3NKP A;  3WAV A;  3NVL A;  4ZG9 A;  1EI6 A;  3MK1 A;  4YR1 A;  2GSU A;  1EJJ A;  3SZY A;  5IJQ A;  3IGY B;  1AJB A;  2IFY A;  3BDG A;  4LQY A;  1B8J A;  1E3C P;  4N7T A;  4UPK A;  1SHQ A;  4KJG A;  2W5Q A;  3DYC A;  4UPH A;  2XR9 A;  1AJA A;  4UOP A;  3WAW A;  1N2K A;  1AUK A;  1KHN A;  1KHJ A;  2D1G A;  4KJD A;  1ZEF A;  4UPI A;  3B5Q A;  4LR9 A;  3WAX A;  2GA3 A;  3WAY A;  3BDG B;  3A52 A;  3M7V A;  1KHK A;  1N2L A;  5EGE A;  2XRG A;  5AJ9 A;  4CYR A;  3TWZ A;  1AJC A;  1O98 A;  1HQA A;  3NKR A;  3MK0 A;  4LR8 A;  3BDH A;  1KH9 A;  4GTX A;  2GSO A;  1ANJ A;  3Q3Q A;  2X98 A;  3UN3 A;  2IUC B;  1EW9 A;  2GSN A;  2W5V A;  4TN0 A;  1P49 A;  4MHX A;  3NKO A;  3T00 A;  4LRA A;  4UOO A;  5GOV A;  3M8W A;  3UNY A;  2QZU A;  1ED9 A;  1ANI A;  2W5S A;  1FSU A;  1ZED A;  3M8Y A;  5K4P A;  3UN2 A;  3UO0 A;  4FDJ A;  5DLV A;  3KD8 A;  4CXS A;  4KAY A;  2ANH A;  4B56 A;  5DLW A;  1Y6V A;  4UPL A;  3IGZ B;  1ELY A;  4KAV A;  3SZZ A;  1ZEB A;  1ED8 A;  2GLQ A;  1HDH A;  4MIV A;  1SHN A;  5LRM A;  3NKQ A;  5L0K A;  4QAX A;  5C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...