3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
1EI6A 1KHNA 2W5QA 3DPCA 2ANHA 2W5WA 3IGYB 1SHQA 3SZYA 5GRRA 3IDDA 3MK2A 4KM4A 4ZG7A 5L0BA 1FSUA 1ALHA 1HQAA 1KH9A 1B8JA 3E2DA 4NWXA 2XR9A 1ED8A 5EGEA 1E3CP 3M8ZA 1O98A 4GTXA 1N2LA 3NKPA 4GTWA 4GTYA 4UPHA 3UNYA 5LIAA 4KJDA 4KAYA 2ZKTA 4ZG9A 4UPIA 1ZEBA 2W5VA 4MIVA 4UPKA 1ALJA 4CXKA 3NKMA 2IUCB 3M8YA 1E1ZP 3NVLA 5GOVA 1AJDA 4ZG6A 1ALIA 5DLTA 3B5QA 3KD8A 1ELYA 3T01A 3SZZA 1AJBA 1KHJA 4LRFA 3M7VA 5EGHA 3MK1A 5HRTA 4LRBA 1ALKA 5K4PA 1ELXA 2GLQA 3UO0A 3WAWA 5LQQA 1EW9A 4CXSA 2IFYA 4B56A 4LR8A 3WBHA 2W8DA 2GA3A 5INHA 3TG0A 2VQRA 5LRMA 4GTZA 3BDHA 1E2SP 4FDIA 4FDJA 1KH7A 3OT9A 3BDFA 3CMRA 5DLWA 2X98A 3WAYA 2W8SA 1HJKA 3TX0A 1K7HA 4KJGA 3BDGA 4TN0A 3WAXA 1N2KA 5L0KA 1AJCA 4YR1A 4LRDA 3LXQA 4LR2A 4ZGAA 3NKNA 2D1GA 3WAVA 4UOOA 3UN3A 1EW2A 4LR7A 2GSUA 2GSNA 2RH6A 2QZUA 3ED4A 3NKQA 3DYCA 1P49A 1KH4A 1EW8A 4UOPA 1ANJA 5L0EA 3T00A 1ZEDA 1URBA 1ZEFA 1HDHA 4LREA 4N7TA 4LQYA 3M8WA 3NKOA 3MK0A 2W5TA 3A52A 1E33P 4MY4A 3TWZA 5LRNA 4LRAA 5TJ3A 1AUKA 1EJJA 1ELZA 3T02A 5IJSA 1URAA 3BDGB 3IGZB 4LR9A 4LRCA 3UN5A 3Q3QA 1KH5A 1Y6VA 2G9YA 4CXUA 4CYSA 4QAXA 4UORA 2W5RA 4KAVA 2XRGA 2W5SA 1AJAA 3NKRA 1Y7AA 3UN2A 1KHKA 5DLVA 4UPLA 2GSOA 4CYRA 5KXAA 1SHNA 2IUCA 2W5XA 4MHXA 5IJQA 1KHLA 1EQJA 1ED9A 1ANIA 1O99A 4NWJA 5AJ9A 5C66A
chains in the Genus database with same CATH superfamily
1KHNA 1TWAA 3L4JA 4X6AC 3DPCA 4BBSK 1TWHA 2W5WA 1I3QK 3HKZL 3GTJC 1KQ4A 4KMAA 2W7VA 3G4AA 3N3YA 5IOTA 1HQAA 3UN2A 2NVYA 1ED8A 3PO2K 2R7ZC 3S15K 1E3CP 1O98A 3M8ZA 4FZBA 3GTMK 1N2LA 3GTQC 3NKPA 4GTWA 4GTYA 5LIAA 4KAYA 2ZKTA 1TWGK 1C0AA 4G0VA 1VH2A 1HI9A 3S2DC 4KN7A 1E1ZP 1TWFA 3OEPA 5GOVA 1WOOA 1AJDA 4A3EC 2PA8L 1JOEA 2R93C 5DLTA 2NVTC 3RZDC 4KAWX 2R93A 2V6UA 4MEYA 1DCOA 2BE5A 3CQZC 5LQQA 1EW9A 3S16C 4BY7K 2IFYA 3S0XA 4PAAA 2JA5A 1F7VA 1SFOC 2W8DA 2GA3A 4LJZA 1BS2A 5INHA 5C4JC 4X6AK 2E2HC 2E2IA 1SFOA 1O28A 5LRMA 2GAHC 1BGWA 3FHZA 3S14C 4GTZA 3I4NK 1KH7A 4KARA 1Y1WK 3BUEA 4GT9A 3GTLA 1J6VA 2W8SA 4A93C 4J3NA 4G7HA 5IOQA 1JVIA 1TWCA 4A3GC 3BDGA 1R9TA 5IOSA 3S1RK 2JA7C 3LXQA 4ZGAA 2JH3A 2P8TA 3NKNA 3A8KA 1PJ7A 3LPXA 1XZPA 3S2HC 3GTPA 2NVXC 3RZDK 4A3LC 2WB1D 2O5JA 3GTOK 2FQOA 1P49A 2Y0SL 3GIRA 1KH4A 3HOXK 1EW8A 4A3MC 5L0EA 3T00A 1ZEFA 3M4OC 3S1MK 4LOWA 5IP9C 4FM9A 5IP7C 3I4MK 4GTAA 5LRNA 3FKIK 5M3MK 4KC6A 4A3FC 3MMLB 3S14K 4OINA 5IYCC 4Y7NK 1YX2A 1SMYA 1IW7A 3Q3QA 1WOSA 5IYDK 3N0CA 2P5MA 4A3GK 1Y6VA 2G9YA 2R92A 3ADAC 5FJ8K 3NKRA 4GTEA 3GTGA 4A3CC 5DLVA 1O2BA 1USOA 1RU0A 4GTCA 2VUMA 1J6WA 2IUCA 1I50A 1WCMK 1O25A 1KHLA 1EQJA 4PABA 5IJQA 1I3QA 5AJ9A 1J6XA 3TFHA 3PO2C 3HOYK 4KMHA 3S15C 4BXXK 2W5QA 4O2DA 2ANHA 3GTMC 1SHQA 3AD8C 1TWGC 4XLNA 4KM4A 4ZG7A 5IP9K 1KH9A 4NWXA 1ZQ1C 2JA6K 2YU9C 4AYBD 5IYCK 4BBRK 4ZG9A 2PMZL 1WORA 4MIVA 3NKMA 4BY7C 1XZQA 3KD8A 1ELYA 3T01A 1K83K 5HRTA 3AH5A 5HL8A 4P9SA 3G4CA 4G7ZA 3TFJA 5D4DA 3UO0A 3I4NC 5CHPA 4CXSA 1Y1VK 1Y1WC 4P5AA 3WBHA 3DXJA 3GTJA 1VJEA 3GEIA 3BDHA 1WQFA 1E2SP 4FDIA 4KB2A 4C3HC 2WB1L 2R7ZA 2V6TA 1O2AA 4QJVA 3S1RC 3GTQA 3CMRA 1EQRA 1XXBA 2D6FC 1HJKA 2YU9K 1K7HA 1VRQC 3L4KA 3WAXA 1N2KA 4YR1A 4LRDA 3GTOC 2WAQD 2O5IA 4WJ4A 4XCHA 3HOXC 2D1GA 3WAVA 3S17K 3S1MC 3CQZA 4LR7A 3I4MC 4JK1A 3FKIC 4KM8A 3H3VD 1ANJA 4Y7NC 1ZEDA 4GTFA 2E2HA 4KB4A 2CFAA 2CFAB 3K7AK 3NKOA 2FQTA 3TWZA 4LK0A 1EK8A 2JA8K 5TJ3A 5IYDC 3QX3A 3M3YK 1URAA 4C3HK 3BDGB 3TFIA 2CW0A 3GDZA 3GTKK 2B63K 1TWAK 3ERED 4G0WA 1HQMA 1IS1A 1TWHK 2JA7A 2XCQA 4C2MK 4Y52K 1WCMC 4CYSA 1XZPB 1USMA 2NVYK 4KAVA 2XRGA 1WSRA 1AJAA 1KHKA 3FOFA 3HOYC 4BXXC 1B4AA 1J98A 2NVXA 5TMCA 2E2JC 3HOZC 1O2FB 2W5XA 1ANIA 1O99A 3HKZD 5C66A 1TWFK 4G0UA 5L46A 2JA6C 5FLMC 4QIWL 3IGYB 5M5WK 1WIHA 4BBRC 5IYBK 3E2DA 1ALHA 2A6EA 2PPBA 4GTXA 4OIOA 4UPHA 2JA5K 3UNYA 4NOIA 4BKWA 2PA8D 5M5YK 1K83C 2E2IK 1ZEBA 4UPKA 1ALJA 2IUCB 3M8YA 4RMFA 3NVLA 3OREA 4GTDA 4A3DC 1Y1VC 5CJ9A 4ZG6A 3GTLK 3B5QA 3HOVK 1O27A 5JVOA 4A3KK 2ZUEA 1KHJA 4LRFA 3M7VA 1EH1A 1TWCK 2E2JK 3HOUK 3HOZK 3MK1A 1ALKA 4YFXA 1R9TK 2GLQA 5K4PA 3WAWA 3AQPA 5M5XK 4YFNA 1F9NA 1XPPA 1I6HK 3GTMA 4BLBA 1TWGA 4KASA 4XSXA 1DCPA 3BP3A 5FLMK 3H0GK 3AQOA 2A6HA 4GFQA 3EQLA 3GTPK 2YU9A 2XCRB 3BDFA 3N0BA 5IORA 5DLWA 2X98A 3WAYA 3S1QK 3TX0A 3AD7C 1XZQB 3S17C 1XXAA 4Q4ZA 4XLPA 5L0KA 1AB4A 2A69A 2A68A 1O24A 4WILA 4A3DK 3UN3A 2Y0SD 2GSUA 2GSNA 3CAGA 3K7AC 1BDFA 2RH6A 1Y1WA 4BY1K 3NKQA 2JA8C 4GZYA 4C3JK 3DYCA 3M3YC 1IE0A 2R92K 1VGXA 1ZBSA 4QJVB 3GTGK 4LREA 4LQYA 3PO3C 3GTKC 2B63C 1TWAC 2VUMK 3MK0A 5E68A 4A3IK 1TWHC 1I50K 4A3BC 1E33P 3A52A 4MY4A 3GTKA 1AUKA 4C2MC 2B63A 4Y52C 3NUHA 1ELZA 5IJSA 3A8JA 4C3IK 1F93A 1PJ5A 2NVYC 4G7OA 4LR9A 1V5VA 4A3JK 3UN5A 4MEXA 1KH5A 4BLAA 3GTOA 4KATA 4YFKA 1ZYRA 2Y3PA 5M3FK 4UORA 3GEHA 2NVQK 1O26A 1Y7AA 1TWFC 3AD9C 1ISEA 5KXAA 1SHNA 4ILDA 3FKIA 4GTBA 4MHXA 1WSVA 4LK1A 1ED9A 5IYBC 3A8IA 4KM9A 2RGRA 4ZH4A 1ZVUA 1BJTA 1EI6A 4YG2A 1INNA 4KN4A 1IQ0A 3SZYA 2JA5C 3RZOK 3BP8C 5GRRA 3PO3K 3IDDA 3MK2A 5L0BA 1FSUA 2E2IC 4A3BK 1B8JA 5EGEA 2XR9A 2PMZD 1DD5A 3LAJA 3S1NC 4MQ9A 3TTGA 4KJDA 3WODA 3GTJK 3GTLC 3HOVC 1GE9A 1WCMA 4WJ3M 4UPIA 4AYBL 4A3KC 4AH6A 1G51A 2W5VA 1VLOA 1TWCC 1WOPA 4OIPA 3HOUC 4GTLA 5C4XC 5C44C 4CXKA 1R9TC 2R7ZK 1PJ6A 3GTQK 1ALIA 1I6HC 2ZUFA 4XSZA 3SZZA 1AJBA 5EGHA 5JFEA 3H0GC 3S2DK 4LRBA 2XCOA 1ELXA 1YCLA 3GTPC 2JA6A 1ZXOA 4A3EK 2R93K 3H0GA 4KMDA 4B56A 4LR8A 2NVTK 4OIRA 1F7UA 3S1QC 2GAGC 3TG0A 4DDQA 2VQRA 3CQZK 1B4BA 4KDDA 4FDJA 3S16K 3OT9A 5C3EC 4P5BA 1SFOK 3V4GA 5C4JK 2V6SA 1JQWA 1K83A 2E2HK 1X31C 3S1NK 4KJGA 4KMUA 4TN0A 5TMFA 1Y1VA 3HOWC 1AJCA 4BY1C 3FOEA 4LR2A 5C4XK 1I6VA 4C3JC 5C44K 1IL2A 2R92C 4A93K 1WQGA 1XXCA 4UOOA 3GTGC 3GEEA 1EFWA 2WAQL 1EW2A 2JA7K 3OPFA 2VUMC 4A3IC 1I50C 2QZUA 3ED4A 1IBAA 4BBSC 4UOPA 1YNJA 4C3IC 1I3QC 4N7TA 1URBA 1HDHA 3S2HK 3M8WA 4A3JC 2NVXK 4A3LK 3H3VL 2W5TA 3HXAA 4LRAA 1EJJA 3GSIA 3VA7A 3T02A 1YNNA 4A3MK 4LLGA 3IGZB 3M4OK 5C3EK 2EBBA 4LRCA 2NVQC 3JSTA 2ZFZA 5IP7K 2PHCB 1DCHA 4A3FK 1UV7A 1O29A 4CXUA 1L0WA 4Q5SA 4QAXA 1WQHA 2W5RA 2W5SA 3HOWK 4UPLA 3LAPA 2GSOA 4CYRA 3IPJA 4OIQA 4C45A 3RZOC 2KWAA 4QIWD 4NWJA 4M1XA 4A3CK
chains in the Genus database with same CATH topology
1EI6A 1KHNA 2W5QA 3DPCA 2ANHA 2W5WA 3IGYB 1SHQA 3SZYA 5GRRA 3IDDA 3MK2A 4KM4A 4ZG7A 5L0BA 1FSUA 1ALHA 1HQAA 1KH9A 1B8JA 3E2DA 4NWXA 2XR9A 1ED8A 5EGEA 1E3CP 3M8ZA 1O98A 4GTXA 1N2LA 3NKPA 4GTWA 4GTYA 4UPHA 3UNYA 5LIAA 4KJDA 4KAYA 2ZKTA 4ZG9A 4UPIA 1ZEBA 2W5VA 4MIVA 4UPKA 1ALJA 4CXKA 3NKMA 2IUCB 3M8YA 1E1ZP 3NVLA 5GOVA 1AJDA 4ZG6A 1ALIA 5DLTA 3B5QA 3KD8A 1ELYA 3T01A 3SZZA 1AJBA 1KHJA 4LRFA 3M7VA 5EGHA 3MK1A 5HRTA 4LRBA 1ALKA 5K4PA 1ELXA 2GLQA 3UO0A 3WAWA 5LQQA 1EW9A 4CXSA 2IFYA 4B56A 4LR8A 3WBHA 2W8DA 2GA3A 5INHA 3TG0A 2VQRA 5LRMA 4GTZA 3BDHA 1E2SP 4FDIA 4FDJA 1KH7A 3OT9A 3BDFA 3CMRA 5DLWA 2X98A 3WAYA 2W8SA 1HJKA 3TX0A 1K7HA 4KJGA 3BDGA 4TN0A 3WAXA 1N2KA 5L0KA 1AJCA 4YR1A 4LRDA 3LXQA 4LR2A 4ZGAA 3NKNA 2D1GA 3WAVA 4UOOA 3UN3A 1EW2A 4LR7A 2GSUA 2GSNA 2RH6A 2QZUA 3ED4A 3NKQA 3DYCA 1P49A 1KH4A 1EW8A 4UOPA 1ANJA 5L0EA 3T00A 1ZEDA 1URBA 1ZEFA 1HDHA 4LREA 4N7TA 4LQYA 3M8WA 3NKOA 3MK0A 2W5TA 3A52A 1E33P 4MY4A 3TWZA 5LRNA 4LRAA 5TJ3A 1AUKA 1EJJA 1ELZA 3T02A 5IJSA 1URAA 3BDGB 3IGZB 4LR9A 4LRCA 3UN5A 3Q3QA 1KH5A 1Y6VA 2G9YA 4CXUA 4CYSA 4QAXA 4UORA 2W5RA 4KAVA 2XRGA 2W5SA 1AJAA 3NKRA 1Y7AA 3UN2A 1KHKA 5DLVA 4UPLA 2GSOA 4CYRA 5KXAA 1SHNA 2IUCA 2W5XA 4MHXA 5IJQA 1KHLA 1EQJA 1ED9A 1ANIA 1O99A 4NWJA 5AJ9A 5C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI6 A;  1KHN A;  2W5Q A;  3DPC A;  2ANH A;  2W5W A;  3IGY B;  1SHQ A;  3SZY A;  5GRR A;  3IDD A;  3MK2 A;  4KM4 A;  4ZG7 A;  5L0B A;  1FSU A;  1ALH A;  1HQA A;  1KH9 A;  1B8J A;  3E2D A;  4NWX A;  2XR9 A;  1ED8 A;  5EGE A;  1E3C P;  3M8Z A;  1O98 A;  4GTX A;  1N2L A;  3NKP A;  4GTW A;  4GTY A;  4UPH A;  3UNY A;  5LIA A;  4KJD A;  4KAY A;  2ZKT A;  4ZG9 A;  4UPI A;  1ZEB A;  2W5V A;  4MIV A;  4UPK A;  1ALJ A;  4CXK A;  3NKM A;  2IUC B;  3M8Y A;  1E1Z P;  3NVL A;  5GOV A;  1AJD A;  4ZG6 A;  1ALI A;  5DLT A;  3B5Q A;  3KD8 A;  1ELY A;  3T01 A;  3SZZ A;  1AJB A;  1KHJ A;  4LRF A;  3M7V A;  5EGH A;  3MK1 A;  5HRT A;  4LRB A;  1ALK A;  5K4P A;  1ELX A;  2GLQ A;  3UO0 A;  3WAW A;  5LQQ A;  1EW9 A;  4CXS A;  2IFY A;  4B56 A;  4LR8 A;  3WBH A;  2W8D A;  2GA3 A;  5INH A;  3TG0 A;  2VQR A;  5LRM A;  4GTZ A;  3BDH A;  1E2S P;  4FDI A;  4FDJ A;  1KH7 A;  3OT9 A;  3BDF A;  3CMR A;  5DLW A;  2X98 A;  3WAY A;  2W8S A;  1HJK A;  3TX0 A;  1K7H A;  4KJG A;  3BDG A;  4TN0 A;  3WAX A;  1N2K A;  5L0K A;  1AJC A;  4YR1 A;  4LRD A;  3LXQ A;  4LR2 A;  4ZGA A;  3NKN A;  2D1G A;  3WAV A;  4UOO A;  3UN3 A;  1EW2 A;  4LR7 A;  2GSU A;  2GSN A;  2RH6 A;  2QZU A;  3ED4 A;  3NKQ A;  3DYC A;  1P49 A;  1KH4 A;  1EW8 A;  4UOP A;  1ANJ A;  5L0E A;  3T00 A;  1ZED A;  1URB A;  1ZEF A;  1HDH A;  4LRE A;  4N7T A;  4LQY A;  3M8W A;  3NKO A;  3MK0 A;  2W5T A;  3A52 A;  1E33 P;  4MY4 A;  3TWZ A;  5LRN A;  4LRA A;  5TJ3 A;  1AUK A;  1EJJ A;  1ELZ A;  3T02 A;  5IJS A;  1URA A;  3BDG B;  3IGZ B;  4LR9 A;  4LRC A;  3UN5 A;  3Q3Q A;  1KH5 A;  1Y6V A;  2G9Y A;  4CXU A;  4CYS A;  4QAX A;  4UOR A;  2W5R A;  4KAV A;  2XRG A;  2W5S A;  1AJA A;  3NKR A;  1Y7A A;  3UN2 A;  1KHK A;  5DLV A;  4UPL A;  2GSO A;  4CYR A;  5KXA A;  1SHN A;  2IUC A;  2W5X A;  4MHX A;  5IJQ A;  1KHL A;  1EQJ A;  1ED9 A;  1ANI A;  1O99 A;  4NWJ A;  5AJ9 A;  5C66 A; 
#chains in the Genus database with same CATH topology
 1KHN A;  1TWA A;  3L4J A;  4X6A C;  3DPC A;  4BBS K;  1TWH A;  2W5W A;  1I3Q K;  3HKZ L;  3GTJ C;  1KQ4 A;  4KMA A;  2W7V A;  3G4A A;  3N3Y A;  5IOT A;  1HQA A;  3UN2 A;  2NVY A;  1ED8 A;  3PO2 K;  2R7Z C;  3S15 K;  1E3C P;  1O98 A;  3M8Z A;  4FZB A;  3GTM K;  1N2L A;  3GTQ C;  3NKP A;  4GTW A;  4GTY A;  5LIA A;  4KAY A;  2ZKT A;  1TWG K;  1C0A A;  4G0V A;  1VH2 A;  1HI9 A;  3S2D C;  4KN7 A;  1E1Z P;  1TWF A;  3OEP A;  5GOV A;  1WOO A;  1AJD A;  4A3E C;  2PA8 L;  1JOE A;  2R93 C;  5DLT A;  2NVT C;  3RZD C;  4KAW X;  2R93 A;  2V6U A;  4MEY A;  1DCO A;  2BE5 A;  3CQZ C;  5LQQ A;  1EW9 A;  3S16 C;  4BY7 K;  2IFY A;  3S0X A;  4PAA A;  2JA5 A;  1F7V A;  1SFO C;  2W8D A;  2GA3 A;  4LJZ A;  1BS2 A;  5INH A;  5C4J C;  4X6A K;  2E2H C;  2E2I A;  1SFO A;  1O28 A;  5LRM A;  2GAH C;  1BGW A;  3FHZ A;  3S14 C;  4GTZ A;  3I4N K;  1KH7 A;  4KAR A;  1Y1W K;  3BUE A;  4GT9 A;  3GTL A;  1J6V A;  2W8S A;  4A93 C;  4J3N A;  4G7H A;  5IOQ A;  1JVI A;  1TWC A;  4A3G C;  3BDG A;  1R9T A;  5IOS A;  3S1R K;  2JA7 C;  3LXQ A;  4ZGA A;  2JH3 A;  2P8T A;  3NKN A;  3A8K A;  1PJ7 A;  3LPX A;  1XZP A;  3S2H C;  3GTP A;  2NVX C;  3RZD K;  4A3L C;  2WB1 D;  2O5J A;  3GTO K;  2FQO A;  1P49 A;  2Y0S L;  3GIR A;  1KH4 A;  3HOX K;  1EW8 A;  4A3M C;  5L0E A;  3T00 A;  1ZEF A;  3M4O C;  3S1M K;  4LOW A;  5IP9 C;  4FM9 A;  5IP7 C;  3I4M K;  4GTA A;  5LRN A;  3FKI K;  5M3M K;  4KC6 A;  4A3F C;  3MML B;  3S14 K;  4OIN A;  5IYC C;  4Y7N K;  1YX2 A;  1SMY A;  1IW7 A;  3Q3Q A;  1WOS A;  5IYD K;  3N0C A;  2P5M A;  4A3G K;  1Y6V A;  2G9Y A;  2R92 A;  3ADA C;  5FJ8 K;  3NKR A;  4GTE A;  3GTG A;  4A3C C;  5DLV A;  1O2B A;  1USO A;  1RU0 A;  4GTC A;  2VUM A;  1J6W A;  2IUC A;  1I50 A;  1WCM K;  1O25 A;  1KHL A;  1EQJ A;  4PAB A;  5IJQ A;  1I3Q A;  5AJ9 A;  1J6X A;  3TFH A;  3PO2 C;  3HOY K;  4KMH A;  3S15 C;  4BXX K;  2W5Q A;  4O2D A;  2ANH A;  3GTM C;  1SHQ A;  3AD8 C;  1TWG C;  4XLN A;  4KM4 A;  4ZG7 A;  5IP9 K;  1KH9 A;  4NWX A;  1ZQ1 C;  2JA6 K;  2YU9 C;  4AYB D;  5IYC K;  4BBR K;  4ZG9 A;  2PMZ L;  1WOR A;  4MIV A;  3NKM A;  4BY7 C;  1XZQ A;  3KD8 A;  1ELY A;  3T01 A;  1K83 K;  5HRT A;  3AH5 A;  5HL8 A;  4P9S A;  3G4C A;  4G7Z A;  3TFJ A;  5D4D A;  3UO0 A;  3I4N C;  5CHP A;  4CXS A;  1Y1V K;  1Y1W C;  4P5A A;  3WBH A;  3DXJ A;  3GTJ A;  1VJE A;  3GEI A;  3BDH A;  1WQF A;  1E2S P;  4FDI A;  4KB2 A;  4C3H C;  2WB1 L;  2R7Z A;  2V6T A;  1O2A A;  4QJV A;  3S1R C;  3GTQ A;  3CMR A;  1EQR A;  1XXB A;  2D6F C;  1HJK A;  2YU9 K;  1K7H A;  1VRQ C;  3L4K A;  3WAX A;  1N2K A;  4YR1 A;  4LRD A;  3GTO C;  2WAQ D;  2O5I A;  4WJ4 A;  4XCH A;  3HOX C;  2D1G A;  3WAV A;  3S17 K;  3S1M C;  3CQZ A;  4LR7 A;  3I4M C;  4JK1 A;  3FKI C;  4KM8 A;  3H3V D;  1ANJ A;  4Y7N C;  1ZED A;  4GTF A;  2E2H A;  4KB4 A;  2CFA A;  2CFA B;  3K7A K;  3NKO A;  2FQT A;  3TWZ A;  4LK0 A;  1EK8 A;  2JA8 K;  5TJ3 A;  5IYD C;  3QX3 A;  3M3Y K;  1URA A;  4C3H K;  3BDG B;  3TFI A;  2CW0 A;  3GDZ A;  3GTK K;  2B63 K;  1TWA K;  3ERE D;  4G0W A;  1HQM A;  1IS1 A;  1TWH K;  2JA7 A;  2XCQ A;  4C2M K;  4Y52 K;  1WCM C;  4CYS A;  1XZP B;  1USM A;  2NVY K;  4KAV A;  2XRG A;  1WSR A;  1AJA A;  1KHK A;  3FOF A;  3HOY C;  4BXX C;  1B4A A;  1J98 A;  2NVX A;  5TMC A;  2E2J C;  3HOZ C;  1O2F B;  2W5X A;  1ANI A;  1O99 A;  3HKZ D;  5C66 A;  1TWF K;  4G0U A;  5L46 A;  2JA6 C;  5FLM C;  4QIW L;  3IGY B;  5M5W K;  1WIH A;  4BBR C;  5IYB K;  3E2D A;  1ALH A;  2A6E A;  2PPB A;  4GTX A;  4OIO A;  4UPH A;  2JA5 K;  3UNY A;  4NOI A;  4BKW A;  2PA8 D;  5M5Y K;  1K83 C;  2E2I K;  1ZEB A;  4UPK A;  1ALJ A;  2IUC B;  3M8Y A;  4RMF A;  3NVL A;  3ORE A;  4GTD A;  4A3D C;  1Y1V C;  5CJ9 A;  4ZG6 A;  3GTL K;  3B5Q A;  3HOV K;  1O27 A;  5JVO A;  4A3K K;  2ZUE A;  1KHJ A;  4LRF A;  3M7V A;  1EH1 A;  1TWC K;  2E2J K;  3HOU K;  3HOZ K;  3MK1 A;  1ALK A;  4YFX A;  1R9T K;  2GLQ A;  5K4P A;  3WAW A;  3AQP A;  5M5X K;  4YFN A;  1F9N A;  1XPP A;  1I6H K;  3GTM A;  4BLB A;  1TWG A;  4KAS A;  4XSX A;  1DCP A;  3BP3 A;  5FLM K;  3H0G K;  3AQO A;  2A6H A;  4GFQ A;  3EQL A;  3GTP K;  2YU9 A;  2XCR B;  3BDF A;  3N0B A;  5IOR A;  5DLW A;  2X98 A;  3WAY A;  3S1Q K;  3TX0 A;  3AD7 C;  1XZQ B;  3S17 C;  1XXA A;  4Q4Z A;  4XLP A;  5L0K A;  1AB4 A;  2A69 A;  2A68 A;  1O24 A;  4WIL A;  4A3D K;  3UN3 A;  2Y0S D;  2GSU A;  2GSN A;  3CAG A;  3K7A C;  1BDF A;  2RH6 A;  1Y1W A;  4BY1 K;  3NKQ A;  2JA8 C;  4GZY A;  4C3J K;  3DYC A;  3M3Y C;  1IE0 A;  2R92 K;  1VGX A;  1ZBS A;  4QJV B;  3GTG K;  4LRE A;  4LQY A;  3PO3 C;  3GTK C;  2B63 C;  1TWA C;  2VUM K;  3MK0 A;  5E68 A;  4A3I K;  1TWH C;  1I50 K;  4A3B C;  1E33 P;  3A52 A;  4MY4 A;  3GTK A;  1AUK A;  4C2M C;  2B63 A;  4Y52 C;  3NUH A;  1ELZ A;  5IJS A;  3A8J A;  4C3I K;  1F93 A;  1PJ5 A;  2NVY C;  4G7O A;  4LR9 A;  1V5V A;  4A3J K;  3UN5 A;  4MEX A;  1KH5 A;  4BLA A;  3GTO A;  4KAT A;  4YFK A;  1ZYR A;  2Y3P A;  5M3F K;  4UOR A;  3GEH A;  2NVQ K;  1O26 A;  1Y7A A;  1TWF C;  3AD9 C;  1ISE A;  5KXA A;  1SHN A;  4ILD A;  3FKI A;  4GTB A;  4MHX A;  1WSV A;  4LK1 A;  1ED9 A;  5IYB C;  3A8I A;  4KM9 A;  2RGR A;  4ZH4 A;  1ZVU A;  1BJT A;  1EI6 A;  4YG2 A;  1INN A;  4KN4 A;  1IQ0 A;  3SZY A;  2JA5 C;  3RZO K;  3BP8 C;  5GRR A;  3PO3 K;  3IDD A;  3MK2 A;  5L0B A;  1FSU A;  2E2I C;  4A3B K;  1B8J A;  5EGE A;  2XR9 A;  2PMZ D;  1DD5 A;  3LAJ A;  3S1N C;  4MQ9 A;  3TTG A;  4KJD A;  3WOD A;  3GTJ K;  3GTL C;  3HOV C;  1GE9 A;  1WCM A;  4WJ3 M;  4UPI A;  4AYB L;  4A3K C;  4AH6 A;  1G51 A;  2W5V A;  1VLO A;  1TWC C;  1WOP A;  4OIP A;  3HOU C;  4GTL A;  5C4X C;  5C44 C;  4CXK A;  1R9T C;  2R7Z K;  1PJ6 A;  3GTQ K;  1ALI A;  1I6H C;  2ZUF A;  4XSZ A;  3SZZ A;  1AJB A;  5EGH A;  5JFE A;  3H0G C;  3S2D K;  4LRB A;  2XCO A;  1ELX A;  1YCL A;  3GTP C;  2JA6 A;  1ZXO A;  4A3E K;  2R93 K;  3H0G A;  4KMD A;  4B56 A;  4LR8 A;  2NVT K;  4OIR A;  1F7U A;  3S1Q C;  2GAG C;  3TG0 A;  4DDQ A;  2VQR A;  3CQZ K;  1B4B A;  4KDD A;  4FDJ A;  3S16 K;  3OT9 A;  5C3E C;  4P5B A;  1SFO K;  3V4G A;  5C4J K;  2V6S A;  1JQW A;  1K83 A;  2E2H K;  1X31 C;  3S1N K;  4KJG A;  4KMU A;  4TN0 A;  5TMF A;  1Y1V A;  3HOW C;  1AJC A;  4BY1 C;  3FOE A;  4LR2 A;  5C4X K;  1I6V A;  4C3J C;  5C44 K;  1IL2 A;  2R92 C;  4A93 K;  1WQG A;  1XXC A;  4UOO A;  3GTG C;  3GEE A;  1EFW A;  2WAQ L;  1EW2 A;  2JA7 K;  3OPF A;  2VUM C;  4A3I C;  1I50 C;  2QZU A;  3ED4 A;  1IBA A;  4BBS C;  4UOP A;  1YNJ A;  4C3I C;  1I3Q C;  4N7T A;  1URB A;  1HDH A;  3S2H K;  3M8W A;  4A3J C;  2NVX K;  4A3L K;  3H3V L;  2W5T A;  3HXA A;  4LRA A;  1EJJ A;  3GSI A;  3VA7 A;  3T02 A;  1YNN A;  4A3M K;  4LLG A;  3IGZ B;  3M4O K;  5C3E K;  2EBB A;  4LRC A;  2NVQ C;  3JST A;  2ZFZ A;  5IP7 K;  2PHC B;  1DCH A;  4A3F K;  1UV7 A;  1O29 A;  4CXU A;  1L0W A;  4Q5S A;  4QAX A;  1WQH A;  2W5R A;  2W5S A;  3HOW K;  4UPL A;  3LAP A;  2GSO A;  4CYR A;  3IPJ A;  4OIQ A;  4C45 A;  3RZO C;  2KWA A;  4QIW D;  4NWJ A;  4M1X A;  4A3C K; 
#chains in the Genus database with same CATH homology
 1EI6 A;  1KHN A;  2W5Q A;  3DPC A;  2ANH A;  2W5W A;  3IGY B;  1SHQ A;  3SZY A;  5GRR A;  3IDD A;  3MK2 A;  4KM4 A;  4ZG7 A;  5L0B A;  1FSU A;  1ALH A;  1HQA A;  1KH9 A;  1B8J A;  3E2D A;  4NWX A;  2XR9 A;  1ED8 A;  5EGE A;  1E3C P;  3M8Z A;  1O98 A;  4GTX A;  1N2L A;  3NKP A;  4GTW A;  4GTY A;  4UPH A;  3UNY A;  5LIA A;  4KJD A;  4KAY A;  2ZKT A;  4ZG9 A;  4UPI A;  1ZEB A;  2W5V A;  4MIV A;  4UPK A;  1ALJ A;  4CXK A;  3NKM A;  2IUC B;  3M8Y A;  1E1Z P;  3NVL A;  5GOV A;  1AJD A;  4ZG6 A;  1ALI A;  5DLT A;  3B5Q A;  3KD8 A;  1ELY A;  3T01 A;  3SZZ A;  1AJB A;  1KHJ A;  4LRF A;  3M7V A;  5EGH A;  3MK1 A;  5HRT A;  4LRB A;  1ALK A;  5K4P A;  1ELX A;  2GLQ A;  3UO0 A;  3WAW A;  5LQQ A;  1EW9 A;  4CXS A;  2IFY A;  4B56 A;  4LR8 A;  3WBH A;  2W8D A;  2GA3 A;  5INH A;  3TG0 A;  2VQR A;  5LRM A;  4GTZ A;  3BDH A;  1E2S P;  4FDI A;  4FDJ A;  1KH7 A;  3OT9 A;  3BDF A;  3CMR A;  5DLW A;  2X98 A;  3WAY A;  2W8S A;  1HJK A;  3TX0 A;  1K7H A;  4KJG A;  3BDG A;  4TN0 A;  3WAX A;  1N2K A;  5L0K A;  1AJC A;  4YR1 A;  4LRD A;  3LXQ A;  4LR2 A;  4ZGA A;  3NKN A;  2D1G A;  3WAV A;  4UOO A;  3UN3 A;  1EW2 A;  4LR7 A;  2GSU A;  2GSN A;  2RH6 A;  2QZU A;  3ED4 A;  3NKQ A;  3DYC A;  1P49 A;  1KH4 A;  1EW8 A;  4UOP A;  1ANJ A;  5L0E A;  3T00 A;  1ZED A;  1URB A;  1ZEF A;  1HDH A;  4LRE A;  4N7T A;  4LQY A;  3M8W A;  3NKO A;  3MK0 A;  2W5T A;  3A52 A;  1E33 P;  4MY4 A;  3TWZ A;  5LRN A;  4LRA A;  5TJ3 A;  1AUK A;  1EJJ A;  1ELZ A;  3T02 A;  5IJS A;  1URA A;  3BDG B;  3IGZ B;  4LR9 A;  4LRC A;  3UN5 A;  3Q3Q A;  1KH5 A;  1Y6V A;  2G9Y A;  4CXU A;  4CYS A;  4QAX A;  4UOR A;  2W5R A;  4KAV A;  2XRG A;  2W5S A;  1AJA A;  3NKR A;  1Y7A A;  3UN2 A;  1KHK A;  5DLV A;  4UPL A;  2GSO A;  4CYR A;  5KXA A;  1SHN A;  2IUC A;  2W5X A;  4MHX A;  5IJQ A;  1KHL A;  1EQJ A;  1ED9 A;  1ANI A;  1O99 A;  4NWJ A;  5AJ9 A;  5C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...