3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
3UN3A 1EW2A 3SZZA 1EI6A 4ZGAA 1ALIA 1K7HA 3T00A 4MY4A 1SHQA 2W5SA 1ANIA 3BDGA 3MK0A 5AJ9A 4LREA 1ALHA 5IJQA 2GSNA 3CMRA 1KHLA 5LQQA 3IDDA 3M8ZA 5L0KA 3M8YA 4CXSA 1ALKA 3NKPA 4CXUA 1EJJA 3M7VA 1HDHA 4KJGA 3MK2A 4NWXA 3BDGB 5DLTA 5L0EA 3WBHA 2W5WA 3NKNA 1EW8A 1KHNA 2GSOA 3WAXA 5LIAA 5KXAA 5HRTA 3SZYA 4TN0A 4UPHA 3ED4A 5TJ3A 1P49A 5EGEA 1HQAA 1SHNA 5INHA 1AJCA 1ED9A 1E2SP 1ALJA 4LR2A 1ZEBA 4N7TA 3T02A 4LRAA 2W8DA 4ZG6A 4ZG9A 4FDJA 3IGYB 3WAYA 1EQJA 1E1ZP 1E3CP 1ZEFA 3DYCA 4LRDA 5GOVA 5IJSA 3IGZB 1KH5A 1E33P 4GTYA 1ZEDA 1ED8A 3E2DA 1AUKA 4KAYA 3WAVA 4UORA 3MK1A 3TG0A 5LRNA 1ANJA 2W5XA 3BDFA 4LRFA 4MHXA 3Q3QA 1ELYA 5DLVA 3B5QA 4GTXA 1KHJA 4UOOA 2W8SA 3OT9A 4LR8A 4FDIA 2XRGA 3LXQA 4LQYA 3UN5A 3NKOA 1ELZA 4MIVA 1N2KA 1O99A 2W5RA 4LRBA 4QAXA 3KD8A 1AJBA 3UNYA 5EGHA 4CXKA 2W5VA 4UOPA 1URAA 3UO0A 5LRMA 1N2LA 1ELXA 3NKRA 2IUCA 4NWJA 2RH6A 2X98A 1Y6VA 1EW9A 4KAVA 5L0BA 4ZG7A 4CYSA 1KH4A 2QZUA 4LRCA 2ANHA 2IUCB 1B8JA 1KHKA 3NVLA 3NKQA 3TX0A 4CYRA 2GA3A 4UPKA 4KJDA 1Y7AA 5DLWA 4UPLA 3M8WA 1AJDA 3TWZA 5K4PA 2XR9A 3UN2A 2IFYA 4GTZA 1URBA 3BDHA 4YR1A 4LR7A 1KH9A 1HJKA 2VQRA 2W5QA 4UPIA 2D1GA 2ZKTA 4GTWA 1FSUA 4B56A 5C66A 5GRRA 1O98A 1KH7A 2W5TA 2GLQA 3A52A 3DPCA 3NKMA 1AJAA 4KM4A 3WAWA 2GSUA 3T01A 4LR9A 2G9YA
chains in the Genus database with same CATH superfamily
2GAGC 4ILDA 3SZZA 1EI6A 3LAJA 1K7HA 4G0VA 3RZDK 3GTQC 3GSIA 3EQLA 2ZFZA 1INNA 3M8ZA 3S14K 3NKPA 4A3GK 1EJJA 2R7ZK 1TWHC 3MK2A 4KJGA 3M4OC 4RMFA 3TTGA 3WBHA 2W5WA 4XSXA 3NKNA 2GSOA 3WAXA 3SZYA 4G7OA 4A3CC 2NVXC 4UPHA 3S16K 5TJ3A 2R92K 5EGEA 4X6AK 3CAGA 3HOVC 1I3QA 4ZH4A 4MQ9A 4BLAA 1SFOC 1WQFA 1HI9A 4ZG9A 4Y7NC 4FDJA 1EFWA 3S2HC 3H3VD 4G7HA 1EQJA 3GTKK 3GTPK 4BBRC 4LRDA 5IYBK 1KH5A 4FM9A 2NVYK 4PAAA 3H3VL 2B63A 3E2DA 2R7ZA 5C44C 3AH5A 4KAYA 3WAVA 1R9TK 4UORA 4Y52C 4LRFA 5IOSA 4MHXA 4A3LK 3GTMK 4GTEA 4KDDA 4LK0A 2R92A 1ELYA 2WAQL 2YU9A 4UOOA 2W8SA 1Y1WA 4LR8A 3HOWC 4LQYA 1TWGK 3HOZC 2NVQK 1DCHA 5C4JK 2JA5C 1TWAK 2PMZD 3GTOC 4LRBA 5C3EK 3S17C 4J3NA 2NVTK 4CXKA 4BY1K 4OIPA 1URAA 3UO0A 3GTPA 5LRMA 5M5XK 2PMZL 3I4NK 4NWJA 3S1MC 3ADAC 2E2HC 4A3GC 4KN7A 4LRCA 2ANHA 1PJ6A 3NVLA 5HL8A 1IW7A 4GT9A 5DLWA 1VH2A 3TFIA 4UPLA 1TWFK 3S0XA 2JA6C 1AJDA 1TWHK 3BDHA 4BXXC 1TWAA 2PA8D 3FKIC 4A3CK 2NVXK 2P5MA 4OIQA 3GTKC 2E2IA 1XPPA 2ZKTA 1ISEA 2GAHC 4GTWA 4B56A 5GRRA 5IYBC 3HOVK 2KWAA 2NVYC 4OINA 3GTLC 1BJTA 2FQOA 3HKZL 4LR9A 3IGZB 4A3FK 1R9TC 1SFOK 3L4JA 4ZGAA 4YG2A 1WOPA 4XLPA 3GTQA 4MY4A 3WODA 4A3LC 1WCMK 3GTMC 3MK0A 5AJ9A 1VJEA 2JA8C 3HOYC 2JA7C 2VUMK 1O2BA 1TWGC 1ALKA 1YNNA 1DCPA 1TWHA 4MEYA 3QX3A 3GTJK 4Y52K 5C3EC 2PPBA 1EW8A 1KHNA 4BY1C 4TN0A 2NVXA 5M3MK 3I4NC 3GEHA 2O5IA 1HQAA 1TWCK 3ERED 3HOWK 1AJCA 1F7VA 3HOZK 1ZQ1C 4LRAA 4C3IK 2JA5K 4GTLA 3GTOK 4ZG6A 3S17K 1ZEFA 1E1ZP 3DYCA 5C4XK 5GOVA 3S1MK 1TWFC 5IJSA 2E2HK 2RGRA 1ZEDA 4GTCA 1IL2A 4P9SA 2XCOA 1AUKA 2A6EA 3RZOC 1WQHA 3TG0A 1AB4A 3G4CA 4KB2A 1ANJA 3BDFA 1WIHA 5IP7K 3Q3QA 1WSRA 1IS1A 2JA6K 4C2MK 1X31C 3MMLB 3CQZC 3OT9A 3FOFA 4A3FC 4BXXK 3NKOA 1ELZA 2JA5A 3AD8C 3GTOA 3FKIK 2W5RA 4GTDA 4C3HC 3L4KA 5EGHA 1Y1VC 1WCMC 4UOPA 5D4DA 2Y0SL 1USOA 5JFEA 4BY7C 2IUCA 3GTLK 5IYDK 4BLBA 2VUMC 4KAVA 2E2HA 4AYBD 1KH4A 3HOXC 3A8JA 3BUEA 2R93K 3GTJC 2XCRB 4A3KK 2WAQD 2IUCB 2PHCB 3NKQA 4AYBL 4DDQA 4C3JK 4KMUA 1YCLA 4KARA 1ZVUA 2JA8K 1TWCC 3S1RC 2E2JK 3HOYK 2JA7K 2XCQA 3M8WA 2JA6A 2V6TA 3TWZA 5K4PA 2XR9A 1J6VA 5IOTA 2IFYA 4LK1A 3S1QC 4C3IC 1EH1A 1O2FB 2VQRA 4C45A 1HJKA 4UPIA 3FKIA 5FJ8K 3GTKA 2D1GA 4A3JC 3GDZA 5C4XC 3FHZA 2GLQA 2NVYA 3DPCA 3GTLA 1O29A 3S1NK 1AJAA 4KM4A 4BKWA 1R9TA 1WORA 1F7UA 1ALIA 1PJ7A 1B4BA 2W5SA 5IP7C 3GTMA 4YFKA 1ALHA 4C2MC 2CFAA 3GTGC 2GSNA 2JA7A 3CMRA 1KHLA 1TWGA 5L0KA 1O28A 1DD5A 4CXUA 3M7VA 4QIWL 3RZOK 4NWXA 1ZXOA 4XSZA 5L0EA 2CFAB 1USMA 3AQPA 3AQOA 5LIAA 1O2AA 3HKZD 5HRTA 4QJVA 2Y3PA 3FOEA 1O25A 4OIRA 1SMYA 4YFXA 5IYDC 1YX2A 3CQZK 5INHA 1ALJA 4QJVB 4LR2A 1RU0A 2YU9C 4N7TA 1HQMA 2R93C 3VA7A 5M5WK 3BP8C 4A3KC 5L46A 1Y1WC 3OPFA 2W8DA 2P8TA 4KAWX 4C3HK 3DXJA 4KB4A 3IGYB 1WQGA 4C3JC 1Y1VK 3GEEA 1K83C 2E2JC 4BY7K 5IYCK 1BGWA 1O27A 1TWFA 3JSTA 4O2DA 1E33P 3H0GC 4GTYA 3HOXK 1ED8A 4OIOA 4A93K 3MK1A 4M1XA 2W5XA 5JVOA 3S1RK 1I50C 4LOWA 3B5QA 3TFJA 3S1NC 4A3IC 2ZUEA 3CQZA 3S1QK 2XRGA 3LXQA 3N0BA 3G4AA 1SFOA 1KQ4A 1GE9A 1VGXA 3N0CA 1O99A 1C0AA 4A3JK 1AJBA 4KASA 3PO2C 1Y1VA 1WCMA 2E2IC 1ELXA 2RH6A 2VUMA 1B4AA 2A69A 5L0BA 4ZG7A 2WB1D 4CYSA 3A8IA 1IQ0A 1JVIA 3GTJA 4LJZA 3OREA 2WB1L 3HOUC 1DCOA 1J98A 5E68A 4UPKA 1TWCA 3LPXA 3GTGK 4A3DC 1Y7AA 2O5JA 1XZPA 1XXBA 3M3YK 3UN2A 3GEIA 2Y0SD 4KM9A 2B63K 4XLNA 4LR7A 3S2DK 1XZPB 5IP9K 2W5QA 1UV7A 1FSUA 5IYCC 2W5TA 4NOIA 2EBBA 1O24A 2YU9K 4LLGA 1Y1WK 3PO3C 1I6HC 1IBAA 4GTXA 4A93C 3UN3A 1EW2A 5M3FK 2FQTA 5TMCA 4KMDA 1VLOA 3T00A 2ZUFA 1K83K 3N3YA 4GZYA 1SHQA 3GIRA 3NUHA 3TFHA 1ANIA 3BDGA 4LREA 3GTGA 5IJQA 1EK8A 5LQQA 3H0GK 4CXSA 3IDDA 3M8YA 4MEXA 5FLMK 2V6UA 1HDHA 4KC6A 5DLTA 3BDGB 1JOEA 2V6SA 3K7AC 3V4GA 4WJ3M 4BBSC 5KXAA 4A3MC 3S15C 1I50K 3ED4A 1PJ5A 1P49A 4A3IK 1SHNA 4KMHA 1ED9A 1ZYRA 1E2SP 1I3QC 1ZEBA 2R93A 3T02A 4A3BK 1G51A 4Q4ZA 4YFNA 3PO2K 3WAYA 3AD9C 4QIWD 3RZDC 1E3CP 3I4MK 1K83A 2E2IK 1F93A 4KN4A 1ZBSA 3M3YC 1V5VA 2A6HA 3H0GA 4A3EK 3S14C 1L0WA 2B63C 2A68A 2JH3A 2R7ZC 3S2DC 1JQWA 5IP9C 4KMAA 5LRNA 1BDFA 5CHPA 3HOUK 4WJ4A 1VRQC 3GTQK 5CJ9A 4A3DK 1I50A 3S16C 5DLVA 4G0UA 2R92C 2BE5A 1KHJA 1XXCA 4X6AC 4FDIA 3UN5A 3IPJA 4G7ZA 3A8KA 4GTBA 4P5BA 4MIVA 3BP3A 3M4OK 1N2KA 4QAXA 1BS2A 3KD8A 3OEPA 5IORA 3AD7C 3UNYA 4G0WA 2W5VA 5IOQA 4WILA 3GTPC 1N2LA 4GTAA 3NKRA 1J6WA 2X98A 1Y6VA 4Q5SA 1EW9A 5FLMC 2PA8L 2W7VA 3PO3K 5M5YK 1I6HK 1XXAA 1WOOA 2QZUA 4PABA 4KM8A 1XZQA 1B8JA 1KHKA 3TX0A 4AH6A 1J6XA 4Y7NK 3S2HK 4CYRA 1WOSA 3HXAA 2GA3A 4BBRK 4KJDA 1EQRA 1XZQB 1IE0A 5TMFA 4XCHA 1F9NA 4A3BC 3LAPA 1URBA 4GTZA 4FZBA 4GFQA 4KATA 2NVQC 4YR1A 4JK1A 2CW0A 3K7AK 5C44K 5C4JC 4GTFA 1KH9A 4BBSK 1TWAC 1O26A 4A3MK 3S15K 4P5AA 1I6VA 3I4MC 2NVTC 5C66A 2D6FC 1O98A 1KH7A 3A52A 1YNJA 3NKMA 1I3QK 4A3EC 3WAWA 1WSVA 2GSUA 3T01A 2G9YA
chains in the Genus database with same CATH topology
3UN3A 1EW2A 3SZZA 1EI6A 4ZGAA 1ALIA 1K7HA 3T00A 4MY4A 1SHQA 2W5SA 1ANIA 3BDGA 3MK0A 5AJ9A 4LREA 1ALHA 5IJQA 2GSNA 3CMRA 1KHLA 5LQQA 3IDDA 3M8ZA 5L0KA 3M8YA 4CXSA 1ALKA 3NKPA 4CXUA 1EJJA 3M7VA 1HDHA 4KJGA 3MK2A 4NWXA 3BDGB 5DLTA 5L0EA 3WBHA 2W5WA 3NKNA 1EW8A 1KHNA 2GSOA 3WAXA 5LIAA 5KXAA 5HRTA 3SZYA 4TN0A 4UPHA 3ED4A 5TJ3A 1P49A 5EGEA 1HQAA 1SHNA 5INHA 1AJCA 1ED9A 1E2SP 1ALJA 4LR2A 1ZEBA 4N7TA 3T02A 4LRAA 2W8DA 4ZG6A 4ZG9A 4FDJA 3IGYB 3WAYA 1EQJA 1E1ZP 1E3CP 1ZEFA 3DYCA 4LRDA 5GOVA 5IJSA 3IGZB 1KH5A 1E33P 4GTYA 1ZEDA 1ED8A 3E2DA 1AUKA 4KAYA 3WAVA 4UORA 3MK1A 3TG0A 5LRNA 1ANJA 2W5XA 3BDFA 4LRFA 4MHXA 3Q3QA 1ELYA 5DLVA 3B5QA 4GTXA 1KHJA 4UOOA 2W8SA 3OT9A 4LR8A 4FDIA 2XRGA 3LXQA 4LQYA 3UN5A 3NKOA 1ELZA 4MIVA 1N2KA 1O99A 2W5RA 4LRBA 4QAXA 3KD8A 1AJBA 3UNYA 5EGHA 4CXKA 2W5VA 4UOPA 1URAA 3UO0A 5LRMA 1N2LA 1ELXA 3NKRA 2IUCA 4NWJA 2RH6A 2X98A 1Y6VA 1EW9A 4KAVA 5L0BA 4ZG7A 4CYSA 1KH4A 2QZUA 4LRCA 2ANHA 2IUCB 1B8JA 1KHKA 3NVLA 3NKQA 3TX0A 4CYRA 2GA3A 4UPKA 4KJDA 1Y7AA 5DLWA 4UPLA 3M8WA 1AJDA 3TWZA 5K4PA 2XR9A 3UN2A 2IFYA 4GTZA 1URBA 3BDHA 4YR1A 4LR7A 1KH9A 1HJKA 2VQRA 2W5QA 4UPIA 2D1GA 2ZKTA 4GTWA 1FSUA 4B56A 5C66A 5GRRA 1O98A 1KH7A 2W5TA 2GLQA 3A52A 3DPCA 3NKMA 1AJAA 4KM4A 3WAWA 2GSUA 3T01A 4LR9A 2G9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN3 A;  1EW2 A;  3SZZ A;  1EI6 A;  4ZGA A;  1ALI A;  1K7H A;  3T00 A;  4MY4 A;  1SHQ A;  2W5S A;  1ANI A;  3BDG A;  3MK0 A;  5AJ9 A;  4LRE A;  1ALH A;  5IJQ A;  2GSN A;  3CMR A;  1KHL A;  5LQQ A;  3IDD A;  3M8Z A;  5L0K A;  3M8Y A;  4CXS A;  1ALK A;  3NKP A;  4CXU A;  1EJJ A;  3M7V A;  1HDH A;  4KJG A;  3MK2 A;  4NWX A;  3BDG B;  5DLT A;  5L0E A;  3WBH A;  2W5W A;  3NKN A;  1EW8 A;  1KHN A;  2GSO A;  3WAX A;  5LIA A;  5KXA A;  5HRT A;  3SZY A;  4TN0 A;  4UPH A;  3ED4 A;  5TJ3 A;  1P49 A;  5EGE A;  1HQA A;  1SHN A;  5INH A;  1AJC A;  1ED9 A;  1E2S P;  1ALJ A;  4LR2 A;  1ZEB A;  4N7T A;  3T02 A;  4LRA A;  2W8D A;  4ZG6 A;  4ZG9 A;  4FDJ A;  3IGY B;  3WAY A;  1EQJ A;  1E1Z P;  1E3C P;  1ZEF A;  3DYC A;  4LRD A;  5GOV A;  5IJS A;  3IGZ B;  1KH5 A;  1E33 P;  4GTY A;  1ZED A;  1ED8 A;  3E2D A;  1AUK A;  4KAY A;  3WAV A;  4UOR A;  3MK1 A;  3TG0 A;  5LRN A;  1ANJ A;  2W5X A;  3BDF A;  4LRF A;  4MHX A;  3Q3Q A;  1ELY A;  5DLV A;  3B5Q A;  4GTX A;  1KHJ A;  4UOO A;  2W8S A;  3OT9 A;  4LR8 A;  4FDI A;  2XRG A;  3LXQ A;  4LQY A;  3UN5 A;  3NKO A;  1ELZ A;  4MIV A;  1N2K A;  1O99 A;  2W5R A;  4LRB A;  4QAX A;  3KD8 A;  1AJB A;  3UNY A;  5EGH A;  4CXK A;  2W5V A;  4UOP A;  1URA A;  3UO0 A;  5LRM A;  1N2L A;  1ELX A;  3NKR A;  2IUC A;  4NWJ A;  2RH6 A;  2X98 A;  1Y6V A;  1EW9 A;  4KAV A;  5L0B A;  4ZG7 A;  4CYS A;  1KH4 A;  2QZU A;  4LRC A;  2ANH A;  2IUC B;  1B8J A;  1KHK A;  3NVL A;  3NKQ A;  3TX0 A;  4CYR A;  2GA3 A;  4UPK A;  4KJD A;  1Y7A A;  5DLW A;  4UPL A;  3M8W A;  1AJD A;  3TWZ A;  5K4P A;  2XR9 A;  3UN2 A;  2IFY A;  4GTZ A;  1URB A;  3BDH A;  4YR1 A;  4LR7 A;  1KH9 A;  1HJK A;  2VQR A;  2W5Q A;  4UPI A;  2D1G A;  2ZKT A;  4GTW A;  1FSU A;  4B56 A;  5C66 A;  5GRR A;  1O98 A;  1KH7 A;  2W5T A;  2GLQ A;  3A52 A;  3DPC A;  3NKM A;  1AJA A;  4KM4 A;  3WAW A;  2GSU A;  3T01 A;  4LR9 A;  2G9Y A; 
#chains in the Genus database with same CATH topology
 2GAG C;  4ILD A;  3SZZ A;  1EI6 A;  3LAJ A;  1K7H A;  4G0V A;  3RZD K;  3GTQ C;  3GSI A;  3EQL A;  2ZFZ A;  1INN A;  3M8Z A;  3S14 K;  3NKP A;  4A3G K;  1EJJ A;  2R7Z K;  1TWH C;  3MK2 A;  4KJG A;  3M4O C;  4RMF A;  3TTG A;  3WBH A;  2W5W A;  4XSX A;  3NKN A;  2GSO A;  3WAX A;  3SZY A;  4G7O A;  4A3C C;  2NVX C;  4UPH A;  3S16 K;  5TJ3 A;  2R92 K;  5EGE A;  4X6A K;  3CAG A;  3HOV C;  1I3Q A;  4ZH4 A;  4MQ9 A;  4BLA A;  1SFO C;  1WQF A;  1HI9 A;  4ZG9 A;  4Y7N C;  4FDJ A;  1EFW A;  3S2H C;  3H3V D;  4G7H A;  1EQJ A;  3GTK K;  3GTP K;  4BBR C;  4LRD A;  5IYB K;  1KH5 A;  4FM9 A;  2NVY K;  4PAA A;  3H3V L;  2B63 A;  3E2D A;  2R7Z A;  5C44 C;  3AH5 A;  4KAY A;  3WAV A;  1R9T K;  4UOR A;  4Y52 C;  4LRF A;  5IOS A;  4MHX A;  4A3L K;  3GTM K;  4GTE A;  4KDD A;  4LK0 A;  2R92 A;  1ELY A;  2WAQ L;  2YU9 A;  4UOO A;  2W8S A;  1Y1W A;  4LR8 A;  3HOW C;  4LQY A;  1TWG K;  3HOZ C;  2NVQ K;  1DCH A;  5C4J K;  2JA5 C;  1TWA K;  2PMZ D;  3GTO C;  4LRB A;  5C3E K;  3S17 C;  4J3N A;  2NVT K;  4CXK A;  4BY1 K;  4OIP A;  1URA A;  3UO0 A;  3GTP A;  5LRM A;  5M5X K;  2PMZ L;  3I4N K;  4NWJ A;  3S1M C;  3ADA C;  2E2H C;  4A3G C;  4KN7 A;  4LRC A;  2ANH A;  1PJ6 A;  3NVL A;  5HL8 A;  1IW7 A;  4GT9 A;  5DLW A;  1VH2 A;  3TFI A;  4UPL A;  1TWF K;  3S0X A;  2JA6 C;  1AJD A;  1TWH K;  3BDH A;  4BXX C;  1TWA A;  2PA8 D;  3FKI C;  4A3C K;  2NVX K;  2P5M A;  4OIQ A;  3GTK C;  2E2I A;  1XPP A;  2ZKT A;  1ISE A;  2GAH C;  4GTW A;  4B56 A;  5GRR A;  5IYB C;  3HOV K;  2KWA A;  2NVY C;  4OIN A;  3GTL C;  1BJT A;  2FQO A;  3HKZ L;  4LR9 A;  3IGZ B;  4A3F K;  1R9T C;  1SFO K;  3L4J A;  4ZGA A;  4YG2 A;  1WOP A;  4XLP A;  3GTQ A;  4MY4 A;  3WOD A;  4A3L C;  1WCM K;  3GTM C;  3MK0 A;  5AJ9 A;  1VJE A;  2JA8 C;  3HOY C;  2JA7 C;  2VUM K;  1O2B A;  1TWG C;  1ALK A;  1YNN A;  1DCP A;  1TWH A;  4MEY A;  3QX3 A;  3GTJ K;  4Y52 K;  5C3E C;  2PPB A;  1EW8 A;  1KHN A;  4BY1 C;  4TN0 A;  2NVX A;  5M3M K;  3I4N C;  3GEH A;  2O5I A;  1HQA A;  1TWC K;  3ERE D;  3HOW K;  1AJC A;  1F7V A;  3HOZ K;  1ZQ1 C;  4LRA A;  4C3I K;  2JA5 K;  4GTL A;  3GTO K;  4ZG6 A;  3S17 K;  1ZEF A;  1E1Z P;  3DYC A;  5C4X K;  5GOV A;  3S1M K;  1TWF C;  5IJS A;  2E2H K;  2RGR A;  1ZED A;  4GTC A;  1IL2 A;  4P9S A;  2XCO A;  1AUK A;  2A6E A;  3RZO C;  1WQH A;  3TG0 A;  1AB4 A;  3G4C A;  4KB2 A;  1ANJ A;  3BDF A;  1WIH A;  5IP7 K;  3Q3Q A;  1WSR A;  1IS1 A;  2JA6 K;  4C2M K;  1X31 C;  3MML B;  3CQZ C;  3OT9 A;  3FOF A;  4A3F C;  4BXX K;  3NKO A;  1ELZ A;  2JA5 A;  3AD8 C;  3GTO A;  3FKI K;  2W5R A;  4GTD A;  4C3H C;  3L4K A;  5EGH A;  1Y1V C;  1WCM C;  4UOP A;  5D4D A;  2Y0S L;  1USO A;  5JFE A;  4BY7 C;  2IUC A;  3GTL K;  5IYD K;  4BLB A;  2VUM C;  4KAV A;  2E2H A;  4AYB D;  1KH4 A;  3HOX C;  3A8J A;  3BUE A;  2R93 K;  3GTJ C;  2XCR B;  4A3K K;  2WAQ D;  2IUC B;  2PHC B;  3NKQ A;  4AYB L;  4DDQ A;  4C3J K;  4KMU A;  1YCL A;  4KAR A;  1ZVU A;  2JA8 K;  1TWC C;  3S1R C;  2E2J K;  3HOY K;  2JA7 K;  2XCQ A;  3M8W A;  2JA6 A;  2V6T A;  3TWZ A;  5K4P A;  2XR9 A;  1J6V A;  5IOT A;  2IFY A;  4LK1 A;  3S1Q C;  4C3I C;  1EH1 A;  1O2F B;  2VQR A;  4C45 A;  1HJK A;  4UPI A;  3FKI A;  5FJ8 K;  3GTK A;  2D1G A;  4A3J C;  3GDZ A;  5C4X C;  3FHZ A;  2GLQ A;  2NVY A;  3DPC A;  3GTL A;  1O29 A;  3S1N K;  1AJA A;  4KM4 A;  4BKW A;  1R9T A;  1WOR A;  1F7U A;  1ALI A;  1PJ7 A;  1B4B A;  2W5S A;  5IP7 C;  3GTM A;  4YFK A;  1ALH A;  4C2M C;  2CFA A;  3GTG C;  2GSN A;  2JA7 A;  3CMR A;  1KHL A;  1TWG A;  5L0K A;  1O28 A;  1DD5 A;  4CXU A;  3M7V A;  4QIW L;  3RZO K;  4NWX A;  1ZXO A;  4XSZ A;  5L0E A;  2CFA B;  1USM A;  3AQP A;  3AQO A;  5LIA A;  1O2A A;  3HKZ D;  5HRT A;  4QJV A;  2Y3P A;  3FOE A;  1O25 A;  4OIR A;  1SMY A;  4YFX A;  5IYD C;  1YX2 A;  3CQZ K;  5INH A;  1ALJ A;  4QJV B;  4LR2 A;  1RU0 A;  2YU9 C;  4N7T A;  1HQM A;  2R93 C;  3VA7 A;  5M5W K;  3BP8 C;  4A3K C;  5L46 A;  1Y1W C;  3OPF A;  2W8D A;  2P8T A;  4KAW X;  4C3H K;  3DXJ A;  4KB4 A;  3IGY B;  1WQG A;  4C3J C;  1Y1V K;  3GEE A;  1K83 C;  2E2J C;  4BY7 K;  5IYC K;  1BGW A;  1O27 A;  1TWF A;  3JST A;  4O2D A;  1E33 P;  3H0G C;  4GTY A;  3HOX K;  1ED8 A;  4OIO A;  4A93 K;  3MK1 A;  4M1X A;  2W5X A;  5JVO A;  3S1R K;  1I50 C;  4LOW A;  3B5Q A;  3TFJ A;  3S1N C;  4A3I C;  2ZUE A;  3CQZ A;  3S1Q K;  2XRG A;  3LXQ A;  3N0B A;  3G4A A;  1SFO A;  1KQ4 A;  1GE9 A;  1VGX A;  3N0C A;  1O99 A;  1C0A A;  4A3J K;  1AJB A;  4KAS A;  3PO2 C;  1Y1V A;  1WCM A;  2E2I C;  1ELX A;  2RH6 A;  2VUM A;  1B4A A;  2A69 A;  5L0B A;  4ZG7 A;  2WB1 D;  4CYS A;  3A8I A;  1IQ0 A;  1JVI A;  3GTJ A;  4LJZ A;  3ORE A;  2WB1 L;  3HOU C;  1DCO A;  1J98 A;  5E68 A;  4UPK A;  1TWC A;  3LPX A;  3GTG K;  4A3D C;  1Y7A A;  2O5J A;  1XZP A;  1XXB A;  3M3Y K;  3UN2 A;  3GEI A;  2Y0S D;  4KM9 A;  2B63 K;  4XLN A;  4LR7 A;  3S2D K;  1XZP B;  5IP9 K;  2W5Q A;  1UV7 A;  1FSU A;  5IYC C;  2W5T A;  4NOI A;  2EBB A;  1O24 A;  2YU9 K;  4LLG A;  1Y1W K;  3PO3 C;  1I6H C;  1IBA A;  4GTX A;  4A93 C;  3UN3 A;  1EW2 A;  5M3F K;  2FQT A;  5TMC A;  4KMD A;  1VLO A;  3T00 A;  2ZUF A;  1K83 K;  3N3Y A;  4GZY A;  1SHQ A;  3GIR A;  3NUH A;  3TFH A;  1ANI A;  3BDG A;  4LRE A;  3GTG A;  5IJQ A;  1EK8 A;  5LQQ A;  3H0G K;  4CXS A;  3IDD A;  3M8Y A;  4MEX A;  5FLM K;  2V6U A;  1HDH A;  4KC6 A;  5DLT A;  3BDG B;  1JOE A;  2V6S A;  3K7A C;  3V4G A;  4WJ3 M;  4BBS C;  5KXA A;  4A3M C;  3S15 C;  1I50 K;  3ED4 A;  1PJ5 A;  1P49 A;  4A3I K;  1SHN A;  4KMH A;  1ED9 A;  1ZYR A;  1E2S P;  1I3Q C;  1ZEB A;  2R93 A;  3T02 A;  4A3B K;  1G51 A;  4Q4Z A;  4YFN A;  3PO2 K;  3WAY A;  3AD9 C;  4QIW D;  3RZD C;  1E3C P;  3I4M K;  1K83 A;  2E2I K;  1F93 A;  4KN4 A;  1ZBS A;  3M3Y C;  1V5V A;  2A6H A;  3H0G A;  4A3E K;  3S14 C;  1L0W A;  2B63 C;  2A68 A;  2JH3 A;  2R7Z C;  3S2D C;  1JQW A;  5IP9 C;  4KMA A;  5LRN A;  1BDF A;  5CHP A;  3HOU K;  4WJ4 A;  1VRQ C;  3GTQ K;  5CJ9 A;  4A3D K;  1I50 A;  3S16 C;  5DLV A;  4G0U A;  2R92 C;  2BE5 A;  1KHJ A;  1XXC A;  4X6A C;  4FDI A;  3UN5 A;  3IPJ A;  4G7Z A;  3A8K A;  4GTB A;  4P5B A;  4MIV A;  3BP3 A;  3M4O K;  1N2K A;  4QAX A;  1BS2 A;  3KD8 A;  3OEP A;  5IOR A;  3AD7 C;  3UNY A;  4G0W A;  2W5V A;  5IOQ A;  4WIL A;  3GTP C;  1N2L A;  4GTA A;  3NKR A;  1J6W A;  2X98 A;  1Y6V A;  4Q5S A;  1EW9 A;  5FLM C;  2PA8 L;  2W7V A;  3PO3 K;  5M5Y K;  1I6H K;  1XXA A;  1WOO A;  2QZU A;  4PAB A;  4KM8 A;  1XZQ A;  1B8J A;  1KHK A;  3TX0 A;  4AH6 A;  1J6X A;  4Y7N K;  3S2H K;  4CYR A;  1WOS A;  3HXA A;  2GA3 A;  4BBR K;  4KJD A;  1EQR A;  1XZQ B;  1IE0 A;  5TMF A;  4XCH A;  1F9N A;  4A3B C;  3LAP A;  1URB A;  4GTZ A;  4FZB A;  4GFQ A;  4KAT A;  2NVQ C;  4YR1 A;  4JK1 A;  2CW0 A;  3K7A K;  5C44 K;  5C4J C;  4GTF A;  1KH9 A;  4BBS K;  1TWA C;  1O26 A;  4A3M K;  3S15 K;  4P5A A;  1I6V A;  3I4M C;  2NVT C;  5C66 A;  2D6F C;  1O98 A;  1KH7 A;  3A52 A;  1YNJ A;  3NKM A;  1I3Q K;  4A3E C;  3WAW A;  1WSV A;  2GSU A;  3T01 A;  2G9Y A; 
#chains in the Genus database with same CATH homology
 3UN3 A;  1EW2 A;  3SZZ A;  1EI6 A;  4ZGA A;  1ALI A;  1K7H A;  3T00 A;  4MY4 A;  1SHQ A;  2W5S A;  1ANI A;  3BDG A;  3MK0 A;  5AJ9 A;  4LRE A;  1ALH A;  5IJQ A;  2GSN A;  3CMR A;  1KHL A;  5LQQ A;  3IDD A;  3M8Z A;  5L0K A;  3M8Y A;  4CXS A;  1ALK A;  3NKP A;  4CXU A;  1EJJ A;  3M7V A;  1HDH A;  4KJG A;  3MK2 A;  4NWX A;  3BDG B;  5DLT A;  5L0E A;  3WBH A;  2W5W A;  3NKN A;  1EW8 A;  1KHN A;  2GSO A;  3WAX A;  5LIA A;  5KXA A;  5HRT A;  3SZY A;  4TN0 A;  4UPH A;  3ED4 A;  5TJ3 A;  1P49 A;  5EGE A;  1HQA A;  1SHN A;  5INH A;  1AJC A;  1ED9 A;  1E2S P;  1ALJ A;  4LR2 A;  1ZEB A;  4N7T A;  3T02 A;  4LRA A;  2W8D A;  4ZG6 A;  4ZG9 A;  4FDJ A;  3IGY B;  3WAY A;  1EQJ A;  1E1Z P;  1E3C P;  1ZEF A;  3DYC A;  4LRD A;  5GOV A;  5IJS A;  3IGZ B;  1KH5 A;  1E33 P;  4GTY A;  1ZED A;  1ED8 A;  3E2D A;  1AUK A;  4KAY A;  3WAV A;  4UOR A;  3MK1 A;  3TG0 A;  5LRN A;  1ANJ A;  2W5X A;  3BDF A;  4LRF A;  4MHX A;  3Q3Q A;  1ELY A;  5DLV A;  3B5Q A;  4GTX A;  1KHJ A;  4UOO A;  2W8S A;  3OT9 A;  4LR8 A;  4FDI A;  2XRG A;  3LXQ A;  4LQY A;  3UN5 A;  3NKO A;  1ELZ A;  4MIV A;  1N2K A;  1O99 A;  2W5R A;  4LRB A;  4QAX A;  3KD8 A;  1AJB A;  3UNY A;  5EGH A;  4CXK A;  2W5V A;  4UOP A;  1URA A;  3UO0 A;  5LRM A;  1N2L A;  1ELX A;  3NKR A;  2IUC A;  4NWJ A;  2RH6 A;  2X98 A;  1Y6V A;  1EW9 A;  4KAV A;  5L0B A;  4ZG7 A;  4CYS A;  1KH4 A;  2QZU A;  4LRC A;  2ANH A;  2IUC B;  1B8J A;  1KHK A;  3NVL A;  3NKQ A;  3TX0 A;  4CYR A;  2GA3 A;  4UPK A;  4KJD A;  1Y7A A;  5DLW A;  4UPL A;  3M8W A;  1AJD A;  3TWZ A;  5K4P A;  2XR9 A;  3UN2 A;  2IFY A;  4GTZ A;  1URB A;  3BDH A;  4YR1 A;  4LR7 A;  1KH9 A;  1HJK A;  2VQR A;  2W5Q A;  4UPI A;  2D1G A;  2ZKT A;  4GTW A;  1FSU A;  4B56 A;  5C66 A;  5GRR A;  1O98 A;  1KH7 A;  2W5T A;  2GLQ A;  3A52 A;  3DPC A;  3NKM A;  1AJA A;  4KM4 A;  3WAW A;  2GSU A;  3T01 A;  4LR9 A;  2G9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...