3T02A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoacetate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFANPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 126
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t02A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t02A01
1Y6VA 3T01A 4KAVA 3UNYA 3MK2A 1ANJA 2IUCA 5EGHA 5INHA 1P49A 2W5SA 3M8WA 4UOPA 1K7HA 5L0EA 4LR9A 1HDHA 5IJSA 1E1ZP 2GSNA 3Q3QA 3BDGB 3M8ZA 2GLQA 3WAXA 3UN3A 5L0KA 3NKNA 3T00A 5DLWA 2W5TA 3BDHA 3CMRA 4LR2A 3WAYA 5HRTA 1ALJA 1URBA 3MK1A 4GTWA 5C66A 3A52A 2D1GA 1EJJA 1EI6A 1N2KA 1KHNA 4GTZA 3DPCA 2X98A 4ZG6A 3NKOA 4ZG7A 4ZG9A 1Y7AA 5L0BA 3IGZB 2XRGA 2GSOA 3NKPA 1E33P 1ED8A 5LRMA 4QAXA 5GOVA 1EW9A 2W5XA 1KH7A 1N2LA 4LQYA 1ED9A 1URAA 1E3CP 4UPIA 4LREA 4B56A 1AJAA 1KHJA 2RH6A 1SHNA 2W5WA 2XR9A 4FDIA 2QZUA 5IJQA 5K4PA 1SHQA 4CYSA 5LRNA 1ALKA 3OT9A 3NKRA 3MK0A 2IUCB 1KH4A 2W5QA 4FDJA 2W5VA 3M8YA 4KAYA 1ELYA 3KD8A 3UN5A 4LRDA 2VQRA 1AJDA 1ALHA 2W8SA 3B5QA 4KM4A 4MHXA 5KXAA 4GTXA 3DYCA 1B8JA 1ALIA 2GSUA 4TN0A 1AJBA 3TX0A 1AJCA 2GA3A 1ANIA 3M7VA 4UPLA 1FSUA 2ANHA 2W5RA 1ZEBA 1KH5A 4CXKA 1ZEFA 1O98A 4UORA 1AUKA 2W8DA 4UOOA 4N7TA 1KHKA 4CXUA 5GRRA 3NVLA 3E2DA 4LRBA 3BDGA 1EW8A 4NWXA 5EGEA 4ZGAA 3NKQA 3WBHA 3SZZA 1KH9A 3WAVA 4LRAA 1KHLA 3T02A 3IGYB 4MIVA 3NKMA 3BDFA 4KJGA 4CYRA 4GTYA 5DLVA 3IDDA 4LRFA 2IFYA 4LR7A 5LIAA 1O99A 4MY4A 3WAWA 1EW2A 1HQAA 5DLTA 2G9YA 1ELXA 4LRCA 1E2SP 1ZEDA 5AJ9A 1EQJA 3TWZA 3UN2A 3SZYA 3UO0A 3ED4A 5TJ3A 5LQQA 1HJKA 3TG0A 4YR1A 4CXSA 4UPKA 1ELZA 2ZKTA 4UPHA 4NWJA 3LXQA 4LR8A 4KJDA
chains in the Genus database with same CATH superfamily
4KM9A 1Y6VA 4OIPA 3UNYA 1PJ6A 1IS1A 2B63A 1P49A 1VJEA 1VRQC 1K7HA 5L0EA 1BS2A 3EQLA 4GTCA 1HDHA 2Y0SL 4LR9A 3FOFA 3M3YK 5IJSA 2E2JK 2R92A 5M5YK 2ZUEA 2BE5A 3OEPA 4GTLA 3BDGB 3GTKK 3WAXA 1AB4A 3HOYK 1C0AA 1L0WA 4GFQA 3T00A 2XCQA 5IP7C 1TWHK 1ISEA 4BY1K 2W5TA 2V6UA 4RMFA 1F9NA 1O2FB 3N0BA 2NVXC 2R93K 3A52A 5IYCC 3PO3C 4O2DA 3S15K 1EI6A 5M3FK 2WAQL 4GTZA 1XXCA 3HOZC 4XSZA 2X98A 1YNNA 1IW7A 1K83C 4M1XA 2NVYK 3NKPA 5M5XK 3DXJA 1EW9A 2W5XA 1KH7A 1ZQ1C 4LREA 2W7VA 5IOSA 4GTAA 2RH6A 3GTOK 1SHNA 1I50C 1O25A 3AD7C 3S1MK 3FHZA 3CAGA 2XR9A 1SMYA 1SFOA 1WOOA 4CYSA 4MEYA 4G0WA 3A8JA 3OT9A 3NKRA 4FDJA 1JVIA 2W5VA 4XSXA 4KAYA 3CQZA 2NVTK 3GTMK 4C3IC 4G0VA 2W8SA 3FKIC 4KM4A 3S17K 2NVQC 1O29A 1I3QC 3IPJA 2GA3A 1TWCK 4Q5SA 4G7HA 4UPLA 3RZOK 2ANHA 5IOQA 1ZEBA 3GEHA 3GTLK 4CXKA 2JA5A 5FLMC 4KN7A 4A3JK 2JH3A 3AH5A 4X6AK 1O98A 4A3FC 1BGWA 2W8DA 5GRRA 3JSTA 4WJ4A 5HL8A 3S1NK 3NKQA 4KN4A 3HOXK 2B63C 3GTQA 2GAGC 4A3LK 2R7ZK 1DCOA 5JFEA 5C4JK 2E2HA 4A3CC 1YNJA 1IE0A 3AQOA 4C3HK 2E2IK 3NKMA 2NVXA 4MIVA 5IYDC 2R92C 3NUHA 4LR7A 1O99A 4FM9A 3VA7A 4A3BK 5TMCA 3K7AK 4GTDA 2VUMA 4BXXC 1EQJA 3UO0A 3ED4A 5TJ3A 5LQQA 5C4XC 2JA8K 4YR1A 1I50A 1I6VA 4UPHA 3V4GA 4NWJA 1PJ5A 2CFAA 4A3GC 1EFWA 4GZYA 4QJVA 3H0GK 3T01A 1O2BA 4P9SA 2JA7A 3LAJA 3S1QC 1Y1WK 4C3JC 5JVOA 5INHA 3M8WA 4UOPA 2A6EA 3H3VD 2RGRA 1Y1VC 2R93C 1XZQA 4AH6A 3AQPA 1SFOC 3Q3QA 1E1ZP 5E68A 3M4OC 1I6HC 4Y7NK 1DCHA 4KB2A 3UN3A 1R9TC 5DLWA 1DCPA 3CMRA 3WAYA 5CJ9A 4BLBA 4A3MK 4BLAA 4KATA 4BBSC 5C3EC 2D1GA 1TWFC 5C44C 1EJJA 1TWAC 2O5IA 1N2KA 2PHCB 3S16K 3RZDC 1KQ4A 1KHNA 5IP9C 4A93K 2V6SA 1Y7AA 1B4BA 3IGZB 2GSOA 4KMUA 4P5BA 3GTPA 1E33P 2A68A 2JA5C 5GOVA 1WCMC 4LQYA 1N2LA 1E3CP 1KHJA 4A3IC 2W5WA 1WIHA 3AD8C 4WJ3M 3FOEA 2QZUA 5K4PA 5IJQA 3GTGC 1SHQA 4KMHA 4QIWD 4BY7C 5LRNA 4GTBA 3S14C 4C2MC 3GTQC 4XLPA 2W5QA 3M8YA 2E2HC 3I4MC 3I4NK 1GE9A 3H3VL 1USMA 3GEEA 4BKWA 4MHXA 2YU9C 3GTKA 4A3EC 1BDFA 1B8JA 1ALIA 4PABA 4A3DK 3S1RC 5IYBC 2VUMC 1AJCA 1TWHA 4OIOA 3BUEA 5M3MK 1KH5A 1Y1VA 4DDQA 2R93A 1AUKA 1XZPA 4N7TA 2JA6C 1KHKA 4CXUA 1WQGA 2CW0A 3G4CA 3GTJC 4A3KK 4G7ZA 2GAHC 2JA7C 4KARA 1TWGK 3SZZA 1R9TA 4KDDA 2PPBA 4G0UA 1KH9A 5D4DA 4BBRK 3T02A 5FJ8K 1KHLA 3L4KA 3GTOA 3IGYB 3LXQA 3HKZD 1TWFA 3CQZK 1G51A 1TWAA 1PJ7A 4KMDA 3S2HC 5DLTA 3HOWC 3PO2K 1IL2A 1ZBSA 4QIWL 2A69A 4LK1A 1J6XA 4WILA 1WCMA 3GEIA 3QX3A 2PMZD 4KB4A 1ZXOA 3LAPA 3S2DC 3GTMA 4Y52C 3HOVC 5L46A 4ZGAA 3GTGA 4OIRA 2P8TA 1XPPA 3MK2A 2FQTA 1ANJA 3GSIA 3GTPC 1INNA 3GTLA 2IUCA 2W5SA 4A3MC 1O26A 5IP7K 2YU9A 3OREA 1F93A 3OPFA 5IYCK 4FZBA 3PO3K 1IBAA 3HOZK 1K83K 1WQHA 4NOIA 1ZVUA 3M3YC 2E2JC 5HRTA 1JQWA 4MEXA 3MK1A 2JA6A 4GTWA 3HOUK 3HKZL 5C66A 3L4JA 3GTKC 3GTJA 1HI9A 1I50K 3HOYC 3DPCA 4ZG6A 3NKOA 4ZG9A 5IORA 5L0BA 1TWHC 4BY1C 2XRGA 4GT9A 1ED8A 5LRMA 1ED9A 1URAA 4B56A 3S15C 2PMZL 1AJAA 4FDIA 2CFAB 5CHPA 1WOSA 4C3IK 1WQFA 3FKIK 4QJVB 2NVYC 1ALKA 4ILDA 4LJZA 1O27A 3MK0A 2NVQK 1I3QK 2XCOA 4P5AA 4KM8A 3GTOC 3S1MC 3UN5A 1XZQB 2VQRA 4KMAA 2A6HA 5FLMK 3MMLB 3B5QA 3TTGA 4JK1A 4A3FK 4GTXA 5KXAA 4ZH4A 2GSUA 4LLGA 1UV7A 4TN0A 4Q4ZA 4XCHA 3TX0A 1ANIA 1FSUA 4OINA 2W5RA 2B63K 2NVTC 3GTMC 5IOTA 2ZUFA 3TFHA 4A3CK 4KAWX 3S17C 4C45A 2FQOA 5IYDK 2R92K 2PA8D 2XCRB 1TWCC 1EW8A 3BDGA 4NWXA 4KC6A 3RZOC 3WBHA 3GTLC 1X31C 4A3JC 4X6AC 2WB1D 4BXXK 3BDFA 2IFYA 5C4XK 3WAWA 4MQ9A 3S1NC 5M5WK 1EW2A 3HOXC 1HQAA 2G9YA 4LK0A 1E2SP 4LOWA 4A3GK 4LRCA 4A3LC 2R7ZC 1DD5A 1ZEDA 5AJ9A 5C4JC 3UN2A 4C3HC 3S1QK 2E2IC 3HXAA 4C3JK 4YFNA 1V5VA 4A3BC 1ELZA 2ZKTA 1Y1VK 4LR8A 3K7AC 4KJDA 1WOPA 1SFOK 2NVYA 3M4OK 1I6HK 1WSRA 4KAVA 2D6FC 1J6VA 1RU0A 5EGHA 2JA8C 1R9TK 4OIQA 1F7VA 1XZPB 3HOUC 1B4AA 1YX2A 2GSNA 3H0GC 4BBSK 2ZFZA 5C3EK 1TWFK 1TWGA 5C44K 1TWAK 2PA8L 3M8ZA 2GLQA 3GDZA 1Y1WC 3RZDK 5L0KA 1J6WA 4KASA 1JOEA 5IP9K 3NKNA 4LR2A 3BDHA 4GTEA 1O2AA 1ALJA 2WB1L 1URBA 3A8KA 2JA5K 1WCMK 4Y7NC 1XXAA 4AYBD 3GIRA 4A3IK 1TWCA 2V6TA 1EK8A 1HQMA 3BP8C 4ZG7A 3N3YA 3GTGK 4BY7K 1EH1A 3S14K 4C2MK 3GTQK 4QAXA 4UPIA 2Y3PA 2E2HK 3G4AA 3I4MK 3S16C 2NVXK 1XXBA 3BP3A 4A93C 1J98A 2YU9K 4A3EK 2R7ZA 3A8IA 1EQRA 2IUCB 1KH4A 3S1RK 5IYBK 2E2IA 2VUMK 1F7UA 3S0XA 1IQ0A 1YCLA 2P5MA 3TFIA 1ELYA 3KD8A 4J3NA 4LRDA 3N0CA 1AJDA 1ALHA 2O5JA 1O28A 3DYCA 1WSVA 2JA6K 3TFJA 4G7OA 1AJBA 3GTJK 4GTFA 2JA7K 3M7VA 1K83A 1USOA 1VGXA 3I4NC 1ZYRA 2Y0SD 1ZEFA 4UORA 3WODA 1WORA 1VLOA 3ADAC 4UOOA 4PAAA 3H0GA 4XLNA 4A3DC 1BJTA 3NVLA 4AYBL 3LPXA 3E2DA 4LRBA 4YFXA 3AD9C 1Y1WA 5EGEA 3S2HK 5TMFA 3HOWK 1VH2A 3WAVA 4LRAA 4KJGA 4A3KC 4GTYA 4CYRA 1O24A 3IDDA 4LRFA 5DLVA 5LIAA 3S2DK 2WAQD 4MY4A 1TWGC 3FKIA 4Y52K 2KWAA 3ERED 3HOVK 1ELXA 1I3QA 4BBRC 4YFKA 3TWZA 3SZYA 1HJKA 3GTPK 3CQZC 3TG0A 4CXSA 4UPKA 3PO2C 4YG2A 2EBBA
chains in the Genus database with same CATH topology
1Y6VA 3T01A 4KAVA 3UNYA 3MK2A 1ANJA 2IUCA 5EGHA 5INHA 1P49A 2W5SA 3M8WA 4UOPA 1K7HA 5L0EA 4LR9A 1HDHA 5IJSA 1E1ZP 2GSNA 3Q3QA 3BDGB 3M8ZA 2GLQA 3WAXA 3UN3A 5L0KA 3NKNA 3T00A 5DLWA 2W5TA 3BDHA 3CMRA 4LR2A 3WAYA 5HRTA 1ALJA 1URBA 3MK1A 4GTWA 5C66A 3A52A 2D1GA 1EJJA 1EI6A 1N2KA 1KHNA 4GTZA 3DPCA 2X98A 4ZG6A 3NKOA 4ZG7A 4ZG9A 1Y7AA 5L0BA 3IGZB 2XRGA 2GSOA 3NKPA 1E33P 1ED8A 5LRMA 4QAXA 5GOVA 1EW9A 2W5XA 1KH7A 1N2LA 4LQYA 1ED9A 1URAA 1E3CP 4UPIA 4LREA 4B56A 1AJAA 1KHJA 2RH6A 1SHNA 2W5WA 2XR9A 4FDIA 2QZUA 5IJQA 5K4PA 1SHQA 4CYSA 5LRNA 1ALKA 3OT9A 3NKRA 3MK0A 2IUCB 1KH4A 2W5QA 4FDJA 2W5VA 3M8YA 4KAYA 1ELYA 3KD8A 3UN5A 4LRDA 2VQRA 1AJDA 1ALHA 2W8SA 3B5QA 4KM4A 4MHXA 5KXAA 4GTXA 3DYCA 1B8JA 1ALIA 2GSUA 4TN0A 1AJBA 3TX0A 1AJCA 2GA3A 1ANIA 3M7VA 4UPLA 1FSUA 2ANHA 2W5RA 1ZEBA 1KH5A 4CXKA 1ZEFA 1O98A 4UORA 1AUKA 2W8DA 4UOOA 4N7TA 1KHKA 4CXUA 5GRRA 3NVLA 3E2DA 4LRBA 3BDGA 1EW8A 4NWXA 5EGEA 4ZGAA 3NKQA 3WBHA 3SZZA 1KH9A 3WAVA 4LRAA 1KHLA 3T02A 3IGYB 4MIVA 3NKMA 3BDFA 4KJGA 4CYRA 4GTYA 5DLVA 3IDDA 4LRFA 2IFYA 4LR7A 5LIAA 1O99A 4MY4A 3WAWA 1EW2A 1HQAA 5DLTA 2G9YA 1ELXA 4LRCA 1E2SP 1ZEDA 5AJ9A 1EQJA 3TWZA 3UN2A 3SZYA 3UO0A 3ED4A 5TJ3A 5LQQA 1HJKA 3TG0A 4YR1A 4CXSA 4UPKA 1ELZA 2ZKTA 4UPHA 4NWJA 3LXQA 4LR8A 4KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6V A;  3T01 A;  4KAV A;  3UNY A;  3MK2 A;  1ANJ A;  2IUC A;  5EGH A;  5INH A;  1P49 A;  2W5S A;  3M8W A;  4UOP A;  1K7H A;  5L0E A;  4LR9 A;  1HDH A;  5IJS A;  1E1Z P;  2GSN A;  3Q3Q A;  3BDG B;  3M8Z A;  2GLQ A;  3WAX A;  3UN3 A;  5L0K A;  3NKN A;  3T00 A;  5DLW A;  2W5T A;  3BDH A;  3CMR A;  4LR2 A;  3WAY A;  5HRT A;  1ALJ A;  1URB A;  3MK1 A;  4GTW A;  5C66 A;  3A52 A;  2D1G A;  1EJJ A;  1EI6 A;  1N2K A;  1KHN A;  4GTZ A;  3DPC A;  2X98 A;  4ZG6 A;  3NKO A;  4ZG7 A;  4ZG9 A;  1Y7A A;  5L0B A;  3IGZ B;  2XRG A;  2GSO A;  3NKP A;  1E33 P;  1ED8 A;  5LRM A;  4QAX A;  5GOV A;  1EW9 A;  2W5X A;  1KH7 A;  1N2L A;  4LQY A;  1ED9 A;  1URA A;  1E3C P;  4UPI A;  4LRE A;  4B56 A;  1AJA A;  1KHJ A;  2RH6 A;  1SHN A;  2W5W A;  2XR9 A;  4FDI A;  2QZU A;  5IJQ A;  5K4P A;  1SHQ A;  4CYS A;  5LRN A;  1ALK A;  3OT9 A;  3NKR A;  3MK0 A;  2IUC B;  1KH4 A;  2W5Q A;  4FDJ A;  2W5V A;  3M8Y A;  4KAY A;  1ELY A;  3KD8 A;  3UN5 A;  4LRD A;  2VQR A;  1AJD A;  1ALH A;  2W8S A;  3B5Q A;  4KM4 A;  4MHX A;  5KXA A;  4GTX A;  3DYC A;  1B8J A;  1ALI A;  2GSU A;  4TN0 A;  1AJB A;  3TX0 A;  1AJC A;  2GA3 A;  1ANI A;  3M7V A;  4UPL A;  1FSU A;  2ANH A;  2W5R A;  1ZEB A;  1KH5 A;  4CXK A;  1ZEF A;  1O98 A;  4UOR A;  1AUK A;  2W8D A;  4UOO A;  4N7T A;  1KHK A;  4CXU A;  5GRR A;  3NVL A;  3E2D A;  4LRB A;  3BDG A;  1EW8 A;  4NWX A;  5EGE A;  4ZGA A;  3NKQ A;  3WBH A;  3SZZ A;  1KH9 A;  3WAV A;  4LRA A;  1KHL A;  3T02 A;  3IGY B;  4MIV A;  3NKM A;  3BDF A;  4KJG A;  4CYR A;  4GTY A;  5DLV A;  3IDD A;  4LRF A;  2IFY A;  4LR7 A;  5LIA A;  1O99 A;  4MY4 A;  3WAW A;  1EW2 A;  1HQA A;  5DLT A;  2G9Y A;  1ELX A;  4LRC A;  1E2S P;  1ZED A;  5AJ9 A;  1EQJ A;  3TWZ A;  3UN2 A;  3SZY A;  3UO0 A;  3ED4 A;  5TJ3 A;  5LQQ A;  1HJK A;  3TG0 A;  4YR1 A;  4CXS A;  4UPK A;  1ELZ A;  2ZKT A;  4UPH A;  4NWJ A;  3LXQ A;  4LR8 A;  4KJD A; 
#chains in the Genus database with same CATH topology
 4KM9 A;  1Y6V A;  4OIP A;  3UNY A;  1PJ6 A;  1IS1 A;  2B63 A;  1P49 A;  1VJE A;  1VRQ C;  1K7H A;  5L0E A;  1BS2 A;  3EQL A;  4GTC A;  1HDH A;  2Y0S L;  4LR9 A;  3FOF A;  3M3Y K;  5IJS A;  2E2J K;  2R92 A;  5M5Y K;  2ZUE A;  2BE5 A;  3OEP A;  4GTL A;  3BDG B;  3GTK K;  3WAX A;  1AB4 A;  3HOY K;  1C0A A;  1L0W A;  4GFQ A;  3T00 A;  2XCQ A;  5IP7 C;  1TWH K;  1ISE A;  4BY1 K;  2W5T A;  2V6U A;  4RMF A;  1F9N A;  1O2F B;  3N0B A;  2NVX C;  2R93 K;  3A52 A;  5IYC C;  3PO3 C;  4O2D A;  3S15 K;  1EI6 A;  5M3F K;  2WAQ L;  4GTZ A;  1XXC A;  3HOZ C;  4XSZ A;  2X98 A;  1YNN A;  1IW7 A;  1K83 C;  4M1X A;  2NVY K;  3NKP A;  5M5X K;  3DXJ A;  1EW9 A;  2W5X A;  1KH7 A;  1ZQ1 C;  4LRE A;  2W7V A;  5IOS A;  4GTA A;  2RH6 A;  3GTO K;  1SHN A;  1I50 C;  1O25 A;  3AD7 C;  3S1M K;  3FHZ A;  3CAG A;  2XR9 A;  1SMY A;  1SFO A;  1WOO A;  4CYS A;  4MEY A;  4G0W A;  3A8J A;  3OT9 A;  3NKR A;  4FDJ A;  1JVI A;  2W5V A;  4XSX A;  4KAY A;  3CQZ A;  2NVT K;  3GTM K;  4C3I C;  4G0V A;  2W8S A;  3FKI C;  4KM4 A;  3S17 K;  2NVQ C;  1O29 A;  1I3Q C;  3IPJ A;  2GA3 A;  1TWC K;  4Q5S A;  4G7H A;  4UPL A;  3RZO K;  2ANH A;  5IOQ A;  1ZEB A;  3GEH A;  3GTL K;  4CXK A;  2JA5 A;  5FLM C;  4KN7 A;  4A3J K;  2JH3 A;  3AH5 A;  4X6A K;  1O98 A;  4A3F C;  1BGW A;  2W8D A;  5GRR A;  3JST A;  4WJ4 A;  5HL8 A;  3S1N K;  3NKQ A;  4KN4 A;  3HOX K;  2B63 C;  3GTQ A;  2GAG C;  4A3L K;  2R7Z K;  1DCO A;  5JFE A;  5C4J K;  2E2H A;  4A3C C;  1YNJ A;  1IE0 A;  3AQO A;  4C3H K;  2E2I K;  3NKM A;  2NVX A;  4MIV A;  5IYD C;  2R92 C;  3NUH A;  4LR7 A;  1O99 A;  4FM9 A;  3VA7 A;  4A3B K;  5TMC A;  3K7A K;  4GTD A;  2VUM A;  4BXX C;  1EQJ A;  3UO0 A;  3ED4 A;  5TJ3 A;  5LQQ A;  5C4X C;  2JA8 K;  4YR1 A;  1I50 A;  1I6V A;  4UPH A;  3V4G A;  4NWJ A;  1PJ5 A;  2CFA A;  4A3G C;  1EFW A;  4GZY A;  4QJV A;  3H0G K;  3T01 A;  1O2B A;  4P9S A;  2JA7 A;  3LAJ A;  3S1Q C;  1Y1W K;  4C3J C;  5JVO A;  5INH A;  3M8W A;  4UOP A;  2A6E A;  3H3V D;  2RGR A;  1Y1V C;  2R93 C;  1XZQ A;  4AH6 A;  3AQP A;  1SFO C;  3Q3Q A;  1E1Z P;  5E68 A;  3M4O C;  1I6H C;  4Y7N K;  1DCH A;  4KB2 A;  3UN3 A;  1R9T C;  5DLW A;  1DCP A;  3CMR A;  3WAY A;  5CJ9 A;  4BLB A;  4A3M K;  4BLA A;  4KAT A;  4BBS C;  5C3E C;  2D1G A;  1TWF C;  5C44 C;  1EJJ A;  1TWA C;  2O5I A;  1N2K A;  2PHC B;  3S16 K;  3RZD C;  1KQ4 A;  1KHN A;  5IP9 C;  4A93 K;  2V6S A;  1Y7A A;  1B4B A;  3IGZ B;  2GSO A;  4KMU A;  4P5B A;  3GTP A;  1E33 P;  2A68 A;  2JA5 C;  5GOV A;  1WCM C;  4LQY A;  1N2L A;  1E3C P;  1KHJ A;  4A3I C;  2W5W A;  1WIH A;  3AD8 C;  4WJ3 M;  3FOE A;  2QZU A;  5K4P A;  5IJQ A;  3GTG C;  1SHQ A;  4KMH A;  4QIW D;  4BY7 C;  5LRN A;  4GTB A;  3S14 C;  4C2M C;  3GTQ C;  4XLP A;  2W5Q A;  3M8Y A;  2E2H C;  3I4M C;  3I4N K;  1GE9 A;  3H3V L;  1USM A;  3GEE A;  4BKW A;  4MHX A;  2YU9 C;  3GTK A;  4A3E C;  1BDF A;  1B8J A;  1ALI A;  4PAB A;  4A3D K;  3S1R C;  5IYB C;  2VUM C;  1AJC A;  1TWH A;  4OIO A;  3BUE A;  5M3M K;  1KH5 A;  1Y1V A;  4DDQ A;  2R93 A;  1AUK A;  1XZP A;  4N7T A;  2JA6 C;  1KHK A;  4CXU A;  1WQG A;  2CW0 A;  3G4C A;  3GTJ C;  4A3K K;  4G7Z A;  2GAH C;  2JA7 C;  4KAR A;  1TWG K;  3SZZ A;  1R9T A;  4KDD A;  2PPB A;  4G0U A;  1KH9 A;  5D4D A;  4BBR K;  3T02 A;  5FJ8 K;  1KHL A;  3L4K A;  3GTO A;  3IGY B;  3LXQ A;  3HKZ D;  1TWF A;  3CQZ K;  1G51 A;  1TWA A;  1PJ7 A;  4KMD A;  3S2H C;  5DLT A;  3HOW C;  3PO2 K;  1IL2 A;  1ZBS A;  4QIW L;  2A69 A;  4LK1 A;  1J6X A;  4WIL A;  1WCM A;  3GEI A;  3QX3 A;  2PMZ D;  4KB4 A;  1ZXO A;  3LAP A;  3S2D C;  3GTM A;  4Y52 C;  3HOV C;  5L46 A;  4ZGA A;  3GTG A;  4OIR A;  2P8T A;  1XPP A;  3MK2 A;  2FQT A;  1ANJ A;  3GSI A;  3GTP C;  1INN A;  3GTL A;  2IUC A;  2W5S A;  4A3M C;  1O26 A;  5IP7 K;  2YU9 A;  3ORE A;  1F93 A;  3OPF A;  5IYC K;  4FZB A;  3PO3 K;  1IBA A;  3HOZ K;  1K83 K;  1WQH A;  4NOI A;  1ZVU A;  3M3Y C;  2E2J C;  5HRT A;  1JQW A;  4MEX A;  3MK1 A;  2JA6 A;  4GTW A;  3HOU K;  3HKZ L;  5C66 A;  3L4J A;  3GTK C;  3GTJ A;  1HI9 A;  1I50 K;  3HOY C;  3DPC A;  4ZG6 A;  3NKO A;  4ZG9 A;  5IOR A;  5L0B A;  1TWH C;  4BY1 C;  2XRG A;  4GT9 A;  1ED8 A;  5LRM A;  1ED9 A;  1URA A;  4B56 A;  3S15 C;  2PMZ L;  1AJA A;  4FDI A;  2CFA B;  5CHP A;  1WOS A;  4C3I K;  1WQF A;  3FKI K;  4QJV B;  2NVY C;  1ALK A;  4ILD A;  4LJZ A;  1O27 A;  3MK0 A;  2NVQ K;  1I3Q K;  2XCO A;  4P5A A;  4KM8 A;  3GTO C;  3S1M C;  3UN5 A;  1XZQ B;  2VQR A;  4KMA A;  2A6H A;  5FLM K;  3MML B;  3B5Q A;  3TTG A;  4JK1 A;  4A3F K;  4GTX A;  5KXA A;  4ZH4 A;  2GSU A;  4LLG A;  1UV7 A;  4TN0 A;  4Q4Z A;  4XCH A;  3TX0 A;  1ANI A;  1FSU A;  4OIN A;  2W5R A;  2B63 K;  2NVT C;  3GTM C;  5IOT A;  2ZUF A;  3TFH A;  4A3C K;  4KAW X;  3S17 C;  4C45 A;  2FQO A;  5IYD K;  2R92 K;  2PA8 D;  2XCR B;  1TWC C;  1EW8 A;  3BDG A;  4NWX A;  4KC6 A;  3RZO C;  3WBH A;  3GTL C;  1X31 C;  4A3J C;  4X6A C;  2WB1 D;  4BXX K;  3BDF A;  2IFY A;  5C4X K;  3WAW A;  4MQ9 A;  3S1N C;  5M5W K;  1EW2 A;  3HOX C;  1HQA A;  2G9Y A;  4LK0 A;  1E2S P;  4LOW A;  4A3G K;  4LRC A;  4A3L C;  2R7Z C;  1DD5 A;  1ZED A;  5AJ9 A;  5C4J C;  3UN2 A;  4C3H C;  3S1Q K;  2E2I C;  3HXA A;  4C3J K;  4YFN A;  1V5V A;  4A3B C;  1ELZ A;  2ZKT A;  1Y1V K;  4LR8 A;  3K7A C;  4KJD A;  1WOP A;  1SFO K;  2NVY A;  3M4O K;  1I6H K;  1WSR A;  4KAV A;  2D6F C;  1J6V A;  1RU0 A;  5EGH A;  2JA8 C;  1R9T K;  4OIQ A;  1F7V A;  1XZP B;  3HOU C;  1B4A A;  1YX2 A;  2GSN A;  3H0G C;  4BBS K;  2ZFZ A;  5C3E K;  1TWF K;  1TWG A;  5C44 K;  1TWA K;  2PA8 L;  3M8Z A;  2GLQ A;  3GDZ A;  1Y1W C;  3RZD K;  5L0K A;  1J6W A;  4KAS A;  1JOE A;  5IP9 K;  3NKN A;  4LR2 A;  3BDH A;  4GTE A;  1O2A A;  1ALJ A;  2WB1 L;  1URB A;  3A8K A;  2JA5 K;  1WCM K;  4Y7N C;  1XXA A;  4AYB D;  3GIR A;  4A3I K;  1TWC A;  2V6T A;  1EK8 A;  1HQM A;  3BP8 C;  4ZG7 A;  3N3Y A;  3GTG K;  4BY7 K;  1EH1 A;  3S14 K;  4C2M K;  3GTQ K;  4QAX A;  4UPI A;  2Y3P A;  2E2H K;  3G4A A;  3I4M K;  3S16 C;  2NVX K;  1XXB A;  3BP3 A;  4A93 C;  1J98 A;  2YU9 K;  4A3E K;  2R7Z A;  3A8I A;  1EQR A;  2IUC B;  1KH4 A;  3S1R K;  5IYB K;  2E2I A;  2VUM K;  1F7U A;  3S0X A;  1IQ0 A;  1YCL A;  2P5M A;  3TFI A;  1ELY A;  3KD8 A;  4J3N A;  4LRD A;  3N0C A;  1AJD A;  1ALH A;  2O5J A;  1O28 A;  3DYC A;  1WSV A;  2JA6 K;  3TFJ A;  4G7O A;  1AJB A;  3GTJ K;  4GTF A;  2JA7 K;  3M7V A;  1K83 A;  1USO A;  1VGX A;  3I4N C;  1ZYR A;  2Y0S D;  1ZEF A;  4UOR A;  3WOD A;  1WOR A;  1VLO A;  3ADA C;  4UOO A;  4PAA A;  3H0G A;  4XLN A;  4A3D C;  1BJT A;  3NVL A;  4AYB L;  3LPX A;  3E2D A;  4LRB A;  4YFX A;  3AD9 C;  1Y1W A;  5EGE A;  3S2H K;  5TMF A;  3HOW K;  1VH2 A;  3WAV A;  4LRA A;  4KJG A;  4A3K C;  4GTY A;  4CYR A;  1O24 A;  3IDD A;  4LRF A;  5DLV A;  5LIA A;  3S2D K;  2WAQ D;  4MY4 A;  1TWG C;  3FKI A;  4Y52 K;  2KWA A;  3ERE D;  3HOV K;  1ELX A;  1I3Q A;  4BBR C;  4YFK A;  3TWZ A;  3SZY A;  1HJK A;  3GTP K;  3CQZ C;  3TG0 A;  4CXS A;  4UPK A;  3PO2 C;  4YG2 A;  2EBB A; 
#chains in the Genus database with same CATH homology
 1Y6V A;  3T01 A;  4KAV A;  3UNY A;  3MK2 A;  1ANJ A;  2IUC A;  5EGH A;  5INH A;  1P49 A;  2W5S A;  3M8W A;  4UOP A;  1K7H A;  5L0E A;  4LR9 A;  1HDH A;  5IJS A;  1E1Z P;  2GSN A;  3Q3Q A;  3BDG B;  3M8Z A;  2GLQ A;  3WAX A;  3UN3 A;  5L0K A;  3NKN A;  3T00 A;  5DLW A;  2W5T A;  3BDH A;  3CMR A;  4LR2 A;  3WAY A;  5HRT A;  1ALJ A;  1URB A;  3MK1 A;  4GTW A;  5C66 A;  3A52 A;  2D1G A;  1EJJ A;  1EI6 A;  1N2K A;  1KHN A;  4GTZ A;  3DPC A;  2X98 A;  4ZG6 A;  3NKO A;  4ZG7 A;  4ZG9 A;  1Y7A A;  5L0B A;  3IGZ B;  2XRG A;  2GSO A;  3NKP A;  1E33 P;  1ED8 A;  5LRM A;  4QAX A;  5GOV A;  1EW9 A;  2W5X A;  1KH7 A;  1N2L A;  4LQY A;  1ED9 A;  1URA A;  1E3C P;  4UPI A;  4LRE A;  4B56 A;  1AJA A;  1KHJ A;  2RH6 A;  1SHN A;  2W5W A;  2XR9 A;  4FDI A;  2QZU A;  5IJQ A;  5K4P A;  1SHQ A;  4CYS A;  5LRN A;  1ALK A;  3OT9 A;  3NKR A;  3MK0 A;  2IUC B;  1KH4 A;  2W5Q A;  4FDJ A;  2W5V A;  3M8Y A;  4KAY A;  1ELY A;  3KD8 A;  3UN5 A;  4LRD A;  2VQR A;  1AJD A;  1ALH A;  2W8S A;  3B5Q A;  4KM4 A;  4MHX A;  5KXA A;  4GTX A;  3DYC A;  1B8J A;  1ALI A;  2GSU A;  4TN0 A;  1AJB A;  3TX0 A;  1AJC A;  2GA3 A;  1ANI A;  3M7V A;  4UPL A;  1FSU A;  2ANH A;  2W5R A;  1ZEB A;  1KH5 A;  4CXK A;  1ZEF A;  1O98 A;  4UOR A;  1AUK A;  2W8D A;  4UOO A;  4N7T A;  1KHK A;  4CXU A;  5GRR A;  3NVL A;  3E2D A;  4LRB A;  3BDG A;  1EW8 A;  4NWX A;  5EGE A;  4ZGA A;  3NKQ A;  3WBH A;  3SZZ A;  1KH9 A;  3WAV A;  4LRA A;  1KHL A;  3T02 A;  3IGY B;  4MIV A;  3NKM A;  3BDF A;  4KJG A;  4CYR A;  4GTY A;  5DLV A;  3IDD A;  4LRF A;  2IFY A;  4LR7 A;  5LIA A;  1O99 A;  4MY4 A;  3WAW A;  1EW2 A;  1HQA A;  5DLT A;  2G9Y A;  1ELX A;  4LRC A;  1E2S P;  1ZED A;  5AJ9 A;  1EQJ A;  3TWZ A;  3UN2 A;  3SZY A;  3UO0 A;  3ED4 A;  5TJ3 A;  5LQQ A;  1HJK A;  3TG0 A;  4YR1 A;  4CXS A;  4UPK A;  1ELZ A;  2ZKT A;  4UPH A;  4NWJ A;  3LXQ A;  4LR8 A;  4KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...