3T46A

Crystal structure of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
HQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
molecule keywords SCIN-D
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t46A00
1DKXA 3D2FA 4JWIA 4EZYA 3DPOA 4EZTA 5E84A 1U00A 4EZPA 4F00A 2KHOA 3OHXM 4JWCA 4R5GA 4EZOA 2QXLA 4HY9A 4PO2A 4R5LA 4EZVA 1DKYA 4JNFA 3T49A 4EZQA 4EZSA 4EZUA 4EZZA 4EZXA 4EZRA 4F01A 4R5KA 3T46A 4B9QA 4JN4A 4HYBA 5TKYA 3T47A 4JWDA 3D2EA 3T48A 4E81A 4H6HA 3DPPA 4EZNA 2WINM 3T4AG 4R5IA 4H6IA 4JNEA 4JWEA 3C7NA 3DPQA 1DKZA 3QNJA 4EZWA 2QFFA 4R5JA 3L3OM
chains in the Genus database with same CATH superfamily
3DX2A 4JWIA 3OK8A 3BUIA 1TQVA 1U00A 2ALWA 2YKTA 3HAHA 2KHOA 1X03A 3OHXM 4R5GA 3VKHA 2X3WA 3LLLA 1X04A 2WYHA 4HY9A 4E3CA 4FZPA 3EJTA 4AZCA 2FYVA 2F1BA 3SYVA 1TQUA 2Q13A 2YLLA 4EZUA 3G9GA 1OA0A 3HAIA 1O7DC 1TQTA 3DX1A 4IM0A 4NQIA 4EZRA 1PS3A 2F7OA 4JL9A 3RPMA 3I2WA 3T46A 4E81A 2GA9D 2RAJA 1WDZA 1JQKA 1QWNA 1ZYLA 2Z0VA 3B52X 4EZNA 1GNTA 3BVTA 3BVXA 2WYIA 4H8SA 4NPHA 4AZIA 4AZHA 3Q84A 4AKVA 4JWEA 3C7NA 3HAJA 1DKZA 1UPXA 4EZWA 2OZNB 3OWGA 4FZSA 1OAOA 2YIAA 1TQWA 2Z0NA 4I1QA 4R5JA 3SOGA 2F18A 3D51A 3UITA 3DPOA 3D4YA 2GF4A 4IW0A 1R5EA 2Z0OA 2NCZA 4NSWA 3RV0A 4AZBA 3DX4A 4AZ5A 4F00A 3BLBA 1SU6A 2YLAA 2OBMA 4IWPA 2OO2A 2D1LA 3DDGA 1HXKA 2OW7A 4AZ6A 1GNLA 4FM3A 4AZCB 2F1AA 4AZGA 1LQ7A 1I4TA 1Y2OA 1HTYA 1I4LA 4FZOA 2PY6A 2EFLA 3QA8A 4F01A 1E1DA 4R5KA 3F7WA 4JN4A 5TKYA 3LVTA 3T47A 3BUPA 3DPPA 4H6HA 2PMRA 4KIKB 2YL5A 1I49A 3ABHA 3BVVA 1YWMA 4IM3A 4KIKA 2F7QA 3KAWA 4UDYX 3DYTA 4UDXX 2F7PA 1GN9A 1R34A 3EJSA 3QNJA 4JLCA 5FLEX 4HR1A 1DKXA 3D2FA 2FICA 4DYLA 3EJPA 3B51X 3VEAA 5C5BA 2YL6A 2MI7A 3CVRA 1SUFA 2JNSA 4EZPA 2F7RA 4G6QA 3FD9A 1HWWA 1QWUA 3CZNA 4M0MA 3KDRA 2YI9A 2EFKA 3M3WA 4EZOA 4D8JA 3ER9B 3DX0A 2QXLA 3EJUA 3QNIA 3CV5A 3ZEDA 4R5LA 1DKYA 1SU8A 2YL9A 2N3KA 3EJQA 2QKWA 2OW6A 2OBLA 3DDFA 3QE6A 4EZZA 4EZXA 3PLTA 3D50A 4EZSA 1E2UA 2LM0A 2LXYA 4ATMA 3T48A 2V0OA 3BUQA 1OA1A 3D2EA 3CAZA 3LMFA 3O3OB 4JWDA 2RAIA 3I04A 1URUA 2X3VA 3VEBA 2EWFA 2Z8YA 1MJGA 3T4AG 4R5IA 3ERCC 4H6IA 2ND0A 3B53X 3DPQA 4HR1B 3GI7A 1R33A 1E9VA 2RT6A 2YIBA 2Q12A 2X5CA 4EZYA 3Q0KA 4EZTA 3O3NB 5E84A 1QX1A 2YI8A 4DCNC 4WPEA 4IWOA 3L3PA 3D4ZA 1I4DA 4JWCA 3CKDA 4IM2A 3KAVA 2ZXQA 2C08A 2ELBA 1SU7A 3BVUA 3BUBA 3BVWA 3CZSA 4WPCA 3D52A 5FIGA 5C5BB 4AZ7A 4EZQA 4EZVA 4PO2A 5KBPA 2D4CA 4JNFA 1W9MA 3BUDA 3T49A 2JNKA 1O7DB 3DX3A 4B9QA 4HYBA 1TQSA 3QWEA 3I39X 4AVMA 2GAFD 2YIVX 3A98A 3EJRA 2O0I1 2RAKA 2EX3B 2WINM 4IWQA 3ER8C 3ACOA 3O3MB 4BNEA 2X3XA 3I01A 4JNEA 2YL8A 2ND1A 1ZWWA 2QFFA 3RV1A 3L3OM
chains in the Genus database with same CATH topology
4JWIA 1U00A 2KHOA 3OHXM 4R5GA 3VKHA 4HY9A 4E3CA 4EZUA 1OA0A 4EZRA 4IM0A 3T46A 4JL9A 4E81A 2GA9D 1JQKA 1ZYLA 3B52X 4EZNA 1GNTA 3ER8C 4NPHA 4JWEA 3C7NA 1DKZA 1UPXA 4EZWA 3OWGA 4R5JA 2YIAA 1OAOA 3T48A 3UITA 3DPOA 4IW0A 3RV0A 2NCZA 4F00A 1SU6A 2OBMA 4IWPA 1GNLA 4FM3A 2PY6A 3QA8A 4F01A 1E1DA 4R5KA 3F7WA 4JN4A 5TKYA 3T47A 3DPPA 4H6HA 4KIKB 4IM3A 4KIKA 3KAWA 4UDYX 4UDXX 1GN9A 3QNJA 4JLCA 5FLEX 4HR1A 1DKXA 3D2FA 3B51X 3VEAA 1SUFA 2JNSA 4EZPA 4G6QA 3FD9A 4M0MA 3KDRA 2YI9A 4EZOA 4D8JA 3ER9B 2QXLA 3ZEDA 4R5LA 1DKYA 1SU8A 2N3KA 4EZQA 4EZSA 2OBLA 4EZZA 4EZXA 1E2UA 2LM0A 3LMFA 1OA1A 3D2EA 3O3OB 4JWDA 3I04A 3VEBA 2EWFA 2Z8YA 1MJGA 3T4AG 4R5IA 3ERCC 4H6IA 2ND0A 3B53X 3DPQA 4HR1B 3GI7A 2YIBA 2RT6A 1E9VA 2X5CA 4EZYA 4EZTA 3O3NB 5E84A 2YI8A 4IWOA 4JWCA 4IM2A 3KAVA 1SU7A 5FIGA 4PO2A 4EZVA 4JNFA 1W9MA 3T49A 4B9QA 4HYBA 3I39X 2GAFD 2YIVX 3A98A 2EX3B 2WINM 4IWQA 3O3MB 3I01A 4JNEA 2ND1A 2QFFA 3RV1A 3L3OM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKX A;  3D2F A;  4JWI A;  4EZY A;  3DPO A;  4EZT A;  5E84 A;  1U00 A;  4EZP A;  4F00 A;  2KHO A;  3OHX M;  4JWC A;  4R5G A;  4EZO A;  2QXL A;  4HY9 A;  4PO2 A;  4R5L A;  4EZV A;  1DKY A;  4JNF A;  3T49 A;  4EZQ A;  4EZS A;  4EZU A;  4EZZ A;  4EZX A;  4EZR A;  4F01 A;  4R5K A;  3T46 A;  4B9Q A;  4JN4 A;  4HYB A;  5TKY A;  3T47 A;  4JWD A;  3D2E A;  3T48 A;  4E81 A;  4H6H A;  3DPP A;  4EZN A;  2WIN M;  3T4A G;  4R5I A;  4H6I A;  4JNE A;  4JWE A;  3C7N A;  3DPQ A;  1DKZ A;  3QNJ A;  4EZW A;  2QFF A;  4R5J A;  3L3O M; 
#chains in the Genus database with same CATH topology
 3DX2 A;  4JWI A;  3OK8 A;  3BUI A;  1TQV A;  1U00 A;  2ALW A;  2YKT A;  3HAH A;  2KHO A;  1X03 A;  3OHX M;  4R5G A;  3VKH A;  2X3W A;  3LLL A;  1X04 A;  2WYH A;  4HY9 A;  4E3C A;  4FZP A;  3EJT A;  4AZC A;  2FYV A;  2F1B A;  3SYV A;  1TQU A;  2Q13 A;  2YLL A;  4EZU A;  3G9G A;  1OA0 A;  3HAI A;  1O7D C;  1TQT A;  3DX1 A;  4IM0 A;  4NQI A;  4EZR A;  1PS3 A;  2F7O A;  4JL9 A;  3RPM A;  3I2W A;  3T46 A;  4E81 A;  2GA9 D;  2RAJ A;  1WDZ A;  1JQK A;  1QWN A;  1ZYL A;  2Z0V A;  3B52 X;  4EZN A;  1GNT A;  3BVT A;  3BVX A;  2WYI A;  4H8S A;  4NPH A;  4AZI A;  4AZH A;  3Q84 A;  4AKV A;  4JWE A;  3C7N A;  3HAJ A;  1DKZ A;  1UPX A;  4EZW A;  2OZN B;  3OWG A;  4FZS A;  1OAO A;  2YIA A;  1TQW A;  2Z0N A;  4I1Q A;  4R5J A;  3SOG A;  2F18 A;  3D51 A;  3UIT A;  3DPO A;  3D4Y A;  2GF4 A;  4IW0 A;  1R5E A;  2Z0O A;  2NCZ A;  4NSW A;  3RV0 A;  4AZB A;  3DX4 A;  4AZ5 A;  4F00 A;  3BLB A;  1SU6 A;  2YLA A;  2OBM A;  4IWP A;  2OO2 A;  2D1L A;  3DDG A;  1HXK A;  2OW7 A;  4AZ6 A;  1GNL A;  4FM3 A;  4AZC B;  2F1A A;  4AZG A;  1LQ7 A;  1I4T A;  1Y2O A;  1HTY A;  1I4L A;  4FZO A;  2PY6 A;  2EFL A;  3QA8 A;  4F01 A;  1E1D A;  4R5K A;  3F7W A;  4JN4 A;  5TKY A;  3LVT A;  3T47 A;  3BUP A;  3DPP A;  4H6H A;  2PMR A;  4KIK B;  2YL5 A;  1I49 A;  3ABH A;  3BVV A;  1YWM A;  4IM3 A;  4KIK A;  2F7Q A;  3KAW A;  4UDY X;  3DYT A;  4UDX X;  2F7P A;  1GN9 A;  1R34 A;  3EJS A;  3QNJ A;  4JLC A;  5FLE X;  4HR1 A;  1DKX A;  3D2F A;  2FIC A;  4DYL A;  3EJP A;  3B51 X;  3VEA A;  5C5B A;  2YL6 A;  2MI7 A;  3CVR A;  1SUF A;  2JNS A;  4EZP A;  2F7R A;  4G6Q A;  3FD9 A;  1HWW A;  1QWU A;  3CZN A;  4M0M A;  3KDR A;  2YI9 A;  2EFK A;  3M3W A;  4EZO A;  4D8J A;  3ER9 B;  3DX0 A;  2QXL A;  3EJU A;  3QNI A;  3CV5 A;  3ZED A;  4R5L A;  1DKY A;  1SU8 A;  2YL9 A;  2N3K A;  3EJQ A;  2QKW A;  2OW6 A;  2OBL A;  3DDF A;  3QE6 A;  4EZZ A;  4EZX A;  3PLT A;  3D50 A;  4EZS A;  1E2U A;  2LM0 A;  2LXY A;  4ATM A;  3T48 A;  2V0O A;  3BUQ A;  1OA1 A;  3D2E A;  3CAZ A;  3LMF A;  3O3O B;  4JWD A;  2RAI A;  3I04 A;  1URU A;  2X3V A;  3VEB A;  2EWF A;  2Z8Y A;  1MJG A;  3T4A G;  4R5I A;  3ERC C;  4H6I A;  2ND0 A;  3B53 X;  3DPQ A;  4HR1 B;  3GI7 A;  1R33 A;  1E9V A;  2RT6 A;  2YIB A;  2Q12 A;  2X5C A;  4EZY A;  3Q0K A;  4EZT A;  3O3N B;  5E84 A;  1QX1 A;  2YI8 A;  4DCN C;  4WPE A;  4IWO A;  3L3P A;  3D4Z A;  1I4D A;  4JWC A;  3CKD A;  4IM2 A;  3KAV A;  2ZXQ A;  2C08 A;  2ELB A;  1SU7 A;  3BVU A;  3BUB A;  3BVW A;  3CZS A;  4WPC A;  3D52 A;  5FIG A;  5C5B B;  4AZ7 A;  4EZQ A;  4EZV A;  4PO2 A;  5KBP A;  2D4C A;  4JNF A;  1W9M A;  3BUD A;  3T49 A;  2JNK A;  1O7D B;  3DX3 A;  4B9Q A;  4HYB A;  1TQS A;  3QWE A;  3I39 X;  4AVM A;  2GAF D;  2YIV X;  3A98 A;  3EJR A;  2O0I 1;  2RAK A;  2EX3 B;  2WIN M;  4IWQ A;  3ER8 C;  3ACO A;  3O3M B;  4BNE A;  2X3X A;  3I01 A;  4JNE A;  2YL8 A;  2ND1 A;  1ZWW A;  2QFF A;  3RV1 A;  3L3O M; 
#chains in the Genus database with same CATH homology
 4JWI A;  1U00 A;  2KHO A;  3OHX M;  4R5G A;  3VKH A;  4HY9 A;  4E3C A;  4EZU A;  1OA0 A;  4EZR A;  4IM0 A;  3T46 A;  4JL9 A;  4E81 A;  2GA9 D;  1JQK A;  1ZYL A;  3B52 X;  4EZN A;  1GNT A;  3ER8 C;  4NPH A;  4JWE A;  3C7N A;  1DKZ A;  1UPX A;  4EZW A;  3OWG A;  4R5J A;  2YIA A;  1OAO A;  3T48 A;  3UIT A;  3DPO A;  4IW0 A;  3RV0 A;  2NCZ A;  4F00 A;  1SU6 A;  2OBM A;  4IWP A;  1GNL A;  4FM3 A;  2PY6 A;  3QA8 A;  4F01 A;  1E1D A;  4R5K A;  3F7W A;  4JN4 A;  5TKY A;  3T47 A;  3DPP A;  4H6H A;  4KIK B;  4IM3 A;  4KIK A;  3KAW A;  4UDY X;  4UDX X;  1GN9 A;  3QNJ A;  4JLC A;  5FLE X;  4HR1 A;  1DKX A;  3D2F A;  3B51 X;  3VEA A;  1SUF A;  2JNS A;  4EZP A;  4G6Q A;  3FD9 A;  4M0M A;  3KDR A;  2YI9 A;  4EZO A;  4D8J A;  3ER9 B;  2QXL A;  3ZED A;  4R5L A;  1DKY A;  1SU8 A;  2N3K A;  4EZQ A;  4EZS A;  2OBL A;  4EZZ A;  4EZX A;  1E2U A;  2LM0 A;  3LMF A;  1OA1 A;  3D2E A;  3O3O B;  4JWD A;  3I04 A;  3VEB A;  2EWF A;  2Z8Y A;  1MJG A;  3T4A G;  4R5I A;  3ERC C;  4H6I A;  2ND0 A;  3B53 X;  3DPQ A;  4HR1 B;  3GI7 A;  2YIB A;  2RT6 A;  1E9V A;  2X5C A;  4EZY A;  4EZT A;  3O3N B;  5E84 A;  2YI8 A;  4IWO A;  4JWC A;  4IM2 A;  3KAV A;  1SU7 A;  5FIG A;  4PO2 A;  4EZV A;  4JNF A;  1W9M A;  3T49 A;  4B9Q A;  4HYB A;  3I39 X;  2GAF D;  2YIV X;  3A98 A;  2EX3 B;  2WIN M;  4IWQ A;  3O3M B;  3I01 A;  4JNE A;  2ND1 A;  2QFF A;  3RV1 A;  3L3O M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...