3T47A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.3 angstrom
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
molecule keywords SCIN-D
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t47A00
4H6HA 2QFFA 3DPOA 4HYBA 5E84A 3OHXM 1DKZA 4H6IA 4E81A 2QXLA 3T47A 3D2EA 4JN4A 4F00A 4EZTA 2WINM 3L3OM 4JWIA 4EZUA 4JNFA 4EZYA 4R5KA 2KHOA 4PO2A 3T46A 1U00A 5TKYA 4R5GA 3T49A 4EZNA 4EZRA 4EZVA 4EZZA 3DPPA 3DPQA 4JNEA 4EZPA 3T4AG 1DKXA 3C7NA 1DKYA 4EZOA 4R5JA 3D2FA 4EZQA 4EZSA 4EZXA 4HY9A 4F01A 3QNJA 4R5LA 4JWDA 4R5IA 4EZWA 4B9QA 4JWEA 3T48A 4JWCA
chains in the Genus database with same CATH superfamily
2YL8A 2OW7A 1O7DB 1OA0A 2OW6A 3KDRA 3ER8C 3PLTA 1DKZA 1I4DA 2V0OA 4H6IA 1UPXA 4E81A 4HR1A 3EJPA 4IWOA 4ATMA 4JN4A 2RT6A 2ZXQA 2Q12A 3DX1A 4AZBA 4JWIA 2PMRA 1ZWWA 2EX3B 2RAKA 3Q0KA 1HXKA 4IWQA 2KHOA 3O3MB 3B53X 3I39X 4R5KA 4EZRA 4AZGA 3VEBA 5FLEX 4EZPA 3ER9B 3T4AG 1HWWA 2Z0OA 4R5JA 2YLAA 1ZYLA 4HY9A 1MJGA 2F1BA 1HTYA 4AVMA 2X5CA 4IWPA 1Y2OA 2OZNB 3DX0A 4JWEA 4AKVA 4AZCB 3KAWA 2OO2A 2FYVA 2RAJA 4KIKB 1OAOA 1YWMA 4H6HA 3BUPA 3BVWA 1X03A 3B51X 4HYBA 2YI8A 4NQIA 5E84A 5C5BB 5FIGA 3ABHA 4JLCA 4FM3A 1E1DA 2X3XA 4AZ7A 3QA8A 1GN9A 3KAVA 4F00A 1I49A 1W9MA 2WYIA 3BVXA 4EZYA 2NCZA 3EJRA 1R5EA 4EZUA 1I4TA 1SU8A 3EJTA 1LQ7A 4JNFA 4PO2A 3BLBA 1U00A 3I01A 3BUDA 3T46A 4BNEA 3DX2A 4IM2A 3DX3A 3EJQA 3DPQA 3LLLA 1TQVA 4IW0A 5KBPA 1TQTA 3D52A 2X3VA 2EFKA 3F7WA 2QKWA 1QWUA 3A98A 3I2WA 2N3KA 3BUBA 4AZIA 2GAFD 3DYTA 4EZXA 1QWNA 2D1LA 1QX1A 2Z0NA 1SU7A 2LXYA 2YL9A 3BVTA 3QNJA 4JWDA 3SYVA 4F01A 4EZWA 2O0I1 2YI9A 4AZ5A 3B52X 3UITA 4B9QA 2YIVX 1TQSA 4DCNC 1X04A 3T48A 3HAJA 3ACOA 2Q13A 2MI7A 3D4YA 3DPOA 3CAZA 3D4ZA 3BUIA 3EJSA 3L3PA 3LMFA 3OHXM 1GNTA 3ERCC 3DDGA 2YLLA 4H8SA 3M3WA 3T47A 3EJUA 5C5BA 4EZTA 3QE6A 3RV1A 3LVTA 4KIKA 3L3OM 4IM0A 4NPHA 2F7QA 1O7DC 3RV0A 3VEAA 2C08A 2X3WA 3BVUA 4R5GA 1R34A 1URUA 2Z8YA 5TKYA 4EZNA 3DX4A 4EZVA 4JL9A 4EZZA 1OA1A 1WDZA 4D8JA 4JNEA 3CKDA 3C7NA 1DKYA 2YKTA 2F7PA 2Z0VA 3RPMA 4WPEA 1PS3A 2ND1A 3BUQA 4EZQA 4EZSA 3OWGA 2F1AA 1I4LA 3HAHA 4R5IA 4FZSA 3CVRA 3DDFA 3Q84A 4UDXX 4IM3A 3QNIA 2JNKA 3O3OB 2OBLA 3CZSA 4AZCA 3G9GA 2PY6A 2FICA 2QFFA 1R33A 2YIBA 3D51A 4E3CA 2OBMA 1JQKA 2EFLA 4NSWA 3CZNA 1E2UA 3BVVA 2ELBA 1TQWA 2WYHA 2QXLA 4DYLA 3D2EA 4FZOA 1SU6A 3QWEA 3I04A 2JNSA 2WINM 2YL6A 2D4CA 4AZHA 3HAIA 4I1QA 4UDYX 3T49A 2F7OA 2YL5A 3VKHA 2LM0A 1SUFA 2F18A 3DPPA 1TQUA 3GI7A 3ZEDA 1DKXA 3O3NB 3SOGA 4G6QA 2YIAA 3FD9A 4EZOA 4WPCA 3D2FA 3D50A 4M0MA 2RAIA 2EWFA 2ALWA 2GF4A 4HR1B 4R5LA 2ND0A 4FZPA 1E9VA 2F7RA 2GA9D 3OK8A 1GNLA 3CV5A 4AZ6A 4JWCA
chains in the Genus database with same CATH topology
1OA0A 3KDRA 1DKZA 4H6IA 1UPXA 4E81A 4HR1A 4IWOA 4JN4A 2RT6A 4JWIA 4EZYA 2EX3B 4IWQA 4R5KA 2KHOA 3O3MB 3B53X 3I39X 3VEBA 5FLEX 4EZPA 3ER9B 3T4AG 4R5JA 1ZYLA 4HY9A 1MJGA 2X5CA 4IWPA 4JWEA 3KAWA 4KIKB 1OAOA 4H6HA 3B51X 4HYBA 2YI8A 5E84A 5FIGA 4JLCA 4FM3A 1E1DA 3QA8A 1GN9A 3KAVA 4F00A 1W9MA 2NCZA 4EZUA 1SU8A 4JNFA 4PO2A 3T46A 1U00A 3I01A 4IM2A 4IW0A 3DPQA 3F7WA 3A98A 2N3KA 2GAFD 4EZXA 4F01A 1SU7A 3QNJA 4JWDA 4EZWA 2YI9A 3B52X 3UITA 2YIVX 3T48A 3DPOA 3LMFA 3OHXM 1GNTA 3ERCC 3T47A 4EZTA 3RV1A 4KIKA 3L3OM 4IM0A 4NPHA 3RV0A 3VEAA 5TKYA 4R5GA 4EZNA 2Z8YA 4EZRA 4EZVA 4EZZA 4D8JA 3ER8C 4JL9A 1OA1A 4JNEA 3C7NA 1DKYA 2ND1A 4EZQA 4EZSA 3OWGA 4R5IA 4UDXX 4IM3A 3O3OB 2OBLA 4E3CA 2PY6A 2QFFA 2YIBA 2OBMA 1JQKA 1E2UA 2QXLA 3D2EA 1SU6A 3I04A 2JNSA 2WINM 4UDYX 3T49A 3VKHA 2LM0A 1SUFA 3DPPA 3GI7A 3ZEDA 1DKXA 3O3NB 4G6QA 2YIAA 3FD9A 4EZOA 3D2FA 4M0MA 2EWFA 4HR1B 4R5LA 2ND0A 1E9VA 2GA9D 1GNLA 4B9QA 4JWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6H A;  2QFF A;  3DPO A;  4HYB A;  5E84 A;  3OHX M;  1DKZ A;  4H6I A;  4E81 A;  2QXL A;  3T47 A;  3D2E A;  4JN4 A;  4F00 A;  4EZT A;  2WIN M;  3L3O M;  4JWI A;  4EZU A;  4JNF A;  4EZY A;  4R5K A;  2KHO A;  4PO2 A;  3T46 A;  1U00 A;  5TKY A;  4R5G A;  3T49 A;  4EZN A;  4EZR A;  4EZV A;  4EZZ A;  3DPP A;  3DPQ A;  4JNE A;  4EZP A;  3T4A G;  1DKX A;  3C7N A;  1DKY A;  4EZO A;  4R5J A;  3D2F A;  4EZQ A;  4EZS A;  4EZX A;  4HY9 A;  4F01 A;  3QNJ A;  4R5L A;  4JWD A;  4R5I A;  4EZW A;  4B9Q A;  4JWE A;  3T48 A;  4JWC A; 
#chains in the Genus database with same CATH topology
 2YL8 A;  2OW7 A;  1O7D B;  1OA0 A;  2OW6 A;  3KDR A;  3ER8 C;  3PLT A;  1DKZ A;  1I4D A;  2V0O A;  4H6I A;  1UPX A;  4E81 A;  4HR1 A;  3EJP A;  4IWO A;  4ATM A;  4JN4 A;  2RT6 A;  2ZXQ A;  2Q12 A;  3DX1 A;  4AZB A;  4JWI A;  2PMR A;  1ZWW A;  2EX3 B;  2RAK A;  3Q0K A;  1HXK A;  4IWQ A;  2KHO A;  3O3M B;  3B53 X;  3I39 X;  4R5K A;  4EZR A;  4AZG A;  3VEB A;  5FLE X;  4EZP A;  3ER9 B;  3T4A G;  1HWW A;  2Z0O A;  4R5J A;  2YLA A;  1ZYL A;  4HY9 A;  1MJG A;  2F1B A;  1HTY A;  4AVM A;  2X5C A;  4IWP A;  1Y2O A;  2OZN B;  3DX0 A;  4JWE A;  4AKV A;  4AZC B;  3KAW A;  2OO2 A;  2FYV A;  2RAJ A;  4KIK B;  1OAO A;  1YWM A;  4H6H A;  3BUP A;  3BVW A;  1X03 A;  3B51 X;  4HYB A;  2YI8 A;  4NQI A;  5E84 A;  5C5B B;  5FIG A;  3ABH A;  4JLC A;  4FM3 A;  1E1D A;  2X3X A;  4AZ7 A;  3QA8 A;  1GN9 A;  3KAV A;  4F00 A;  1I49 A;  1W9M A;  2WYI A;  3BVX A;  4EZY A;  2NCZ A;  3EJR A;  1R5E A;  4EZU A;  1I4T A;  1SU8 A;  3EJT A;  1LQ7 A;  4JNF A;  4PO2 A;  3BLB A;  1U00 A;  3I01 A;  3BUD A;  3T46 A;  4BNE A;  3DX2 A;  4IM2 A;  3DX3 A;  3EJQ A;  3DPQ A;  3LLL A;  1TQV A;  4IW0 A;  5KBP A;  1TQT A;  3D52 A;  2X3V A;  2EFK A;  3F7W A;  2QKW A;  1QWU A;  3A98 A;  3I2W A;  2N3K A;  3BUB A;  4AZI A;  2GAF D;  3DYT A;  4EZX A;  1QWN A;  2D1L A;  1QX1 A;  2Z0N A;  1SU7 A;  2LXY A;  2YL9 A;  3BVT A;  3QNJ A;  4JWD A;  3SYV A;  4F01 A;  4EZW A;  2O0I 1;  2YI9 A;  4AZ5 A;  3B52 X;  3UIT A;  4B9Q A;  2YIV X;  1TQS A;  4DCN C;  1X04 A;  3T48 A;  3HAJ A;  3ACO A;  2Q13 A;  2MI7 A;  3D4Y A;  3DPO A;  3CAZ A;  3D4Z A;  3BUI A;  3EJS A;  3L3P A;  3LMF A;  3OHX M;  1GNT A;  3ERC C;  3DDG A;  2YLL A;  4H8S A;  3M3W A;  3T47 A;  3EJU A;  5C5B A;  4EZT A;  3QE6 A;  3RV1 A;  3LVT A;  4KIK A;  3L3O M;  4IM0 A;  4NPH A;  2F7Q A;  1O7D C;  3RV0 A;  3VEA A;  2C08 A;  2X3W A;  3BVU A;  4R5G A;  1R34 A;  1URU A;  2Z8Y A;  5TKY A;  4EZN A;  3DX4 A;  4EZV A;  4JL9 A;  4EZZ A;  1OA1 A;  1WDZ A;  4D8J A;  4JNE A;  3CKD A;  3C7N A;  1DKY A;  2YKT A;  2F7P A;  2Z0V A;  3RPM A;  4WPE A;  1PS3 A;  2ND1 A;  3BUQ A;  4EZQ A;  4EZS A;  3OWG A;  2F1A A;  1I4L A;  3HAH A;  4R5I A;  4FZS A;  3CVR A;  3DDF A;  3Q84 A;  4UDX X;  4IM3 A;  3QNI A;  2JNK A;  3O3O B;  2OBL A;  3CZS A;  4AZC A;  3G9G A;  2PY6 A;  2FIC A;  2QFF A;  1R33 A;  2YIB A;  3D51 A;  4E3C A;  2OBM A;  1JQK A;  2EFL A;  4NSW A;  3CZN A;  1E2U A;  3BVV A;  2ELB A;  1TQW A;  2WYH A;  2QXL A;  4DYL A;  3D2E A;  4FZO A;  1SU6 A;  3QWE A;  3I04 A;  2JNS A;  2WIN M;  2YL6 A;  2D4C A;  4AZH A;  3HAI A;  4I1Q A;  4UDY X;  3T49 A;  2F7O A;  2YL5 A;  3VKH A;  2LM0 A;  1SUF A;  2F18 A;  3DPP A;  1TQU A;  3GI7 A;  3ZED A;  1DKX A;  3O3N B;  3SOG A;  4G6Q A;  2YIA A;  3FD9 A;  4EZO A;  4WPC A;  3D2F A;  3D50 A;  4M0M A;  2RAI A;  2EWF A;  2ALW A;  2GF4 A;  4HR1 B;  4R5L A;  2ND0 A;  4FZP A;  1E9V A;  2F7R A;  2GA9 D;  3OK8 A;  1GNL A;  3CV5 A;  4AZ6 A;  4JWC A; 
#chains in the Genus database with same CATH homology
 1OA0 A;  3KDR A;  1DKZ A;  4H6I A;  1UPX A;  4E81 A;  4HR1 A;  4IWO A;  4JN4 A;  2RT6 A;  4JWI A;  4EZY A;  2EX3 B;  4IWQ A;  4R5K A;  2KHO A;  3O3M B;  3B53 X;  3I39 X;  3VEB A;  5FLE X;  4EZP A;  3ER9 B;  3T4A G;  4R5J A;  1ZYL A;  4HY9 A;  1MJG A;  2X5C A;  4IWP A;  4JWE A;  3KAW A;  4KIK B;  1OAO A;  4H6H A;  3B51 X;  4HYB A;  2YI8 A;  5E84 A;  5FIG A;  4JLC A;  4FM3 A;  1E1D A;  3QA8 A;  1GN9 A;  3KAV A;  4F00 A;  1W9M A;  2NCZ A;  4EZU A;  1SU8 A;  4JNF A;  4PO2 A;  3T46 A;  1U00 A;  3I01 A;  4IM2 A;  4IW0 A;  3DPQ A;  3F7W A;  3A98 A;  2N3K A;  2GAF D;  4EZX A;  4F01 A;  1SU7 A;  3QNJ A;  4JWD A;  4EZW A;  2YI9 A;  3B52 X;  3UIT A;  2YIV X;  3T48 A;  3DPO A;  3LMF A;  3OHX M;  1GNT A;  3ERC C;  3T47 A;  4EZT A;  3RV1 A;  4KIK A;  3L3O M;  4IM0 A;  4NPH A;  3RV0 A;  3VEA A;  5TKY A;  4R5G A;  4EZN A;  2Z8Y A;  4EZR A;  4EZV A;  4EZZ A;  4D8J A;  3ER8 C;  4JL9 A;  1OA1 A;  4JNE A;  3C7N A;  1DKY A;  2ND1 A;  4EZQ A;  4EZS A;  3OWG A;  4R5I A;  4UDX X;  4IM3 A;  3O3O B;  2OBL A;  4E3C A;  2PY6 A;  2QFF A;  2YIB A;  2OBM A;  1JQK A;  1E2U A;  2QXL A;  3D2E A;  1SU6 A;  3I04 A;  2JNS A;  2WIN M;  4UDY X;  3T49 A;  3VKH A;  2LM0 A;  1SUF A;  3DPP A;  3GI7 A;  3ZED A;  1DKX A;  3O3N B;  4G6Q A;  2YIA A;  3FD9 A;  4EZO A;  3D2F A;  4M0M A;  2EWF A;  4HR1 B;  4R5L A;  2ND0 A;  1E9V A;  2GA9 D;  1GNL A;  4B9Q A;  4JWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...