3T48A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords SCIN-D
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t48A00
4JN4A 4JNEA 1U00A 3D2FA 4H6IA 4JWEA 4EZQA 4EZXA 2QFFA 2KHOA 4R5JA 4F00A 4EZRA 4JWDA 4EZOA 4PO2A 3OHXM 3DPOA 4R5LA 4EZTA 1DKYA 4EZYA 2QXLA 4JNFA 2WINM 5TKYA 3T47A 4EZSA 4EZUA 3D2EA 4R5IA 4EZVA 3T49A 4H6HA 3C7NA 4JWCA 3T46A 4E81A 3L3OM 3T48A 1DKXA 4EZWA 5E84A 3T4AG 3DPQA 3QNJA 4R5GA 4EZPA 4HY9A 4B9QA 4EZNA 4JWIA 4EZZA 4F01A 4R5KA 3DPPA 1DKZA 4HYBA
chains in the Genus database with same CATH superfamily
4JL9A 2X3XA 3SYVA 1SU8A 4I1QA 3O3NB 1E9VA 2OBMA 3OWGA 4HR1B 3BVWA 1W9MA 2YIBA 3DX2A 3FD9A 3EJSA 2ZXQA 4AZHA 1SU7A 4EZOA 2OBLA 4AZ6A 2MI7A 4NSWA 2YLAA 2X5CA 2PY6A 3BLBA 2F1AA 2F7QA 2Z0NA 4AZ7A 4IM2A 2YL9A 2RAIA 3VEBA 3VKHA 2GA9D 1TQVA 2RAKA 2YLLA 3CZNA 2YIAA 4AZ5A 4KIKB 4JWCA 3B53X 1OA0A 4E81A 4E3CA 2C08A 3KAVA 4EZWA 3HAHA 2RAJA 3I04A 2X3WA 3KAWA 2PMRA 4JWIA 1I4DA 4EZZA 1GNLA 3L3PA 1DKZA 4IW0A 5C5BB 3EJQA 4HYBA 4B9QA 3BUIA 4JNEA 1U00A 1SUFA 1GNTA 2N3KA 3EJPA 4EZQA 2F18A 2RT6A 2WYIA 3O3OB 5FLEX 3BVVA 1TQTA 3I39X 2EFLA 3ACOA 3QA8A 4F00A 4G6QA 1TQUA 3EJUA 4FZSA 4EZRA 3B52X 2FYVA 3HAIA 3ER8C 2YL5A 3CAZA 4R5LA 1HTYA 3RV0A 3UITA 3O3MB 3D50A 4IWOA 1O7DC 2QXLA 2QKWA 3A98A 3ABHA 3CV5A 3Q84A 2JNSA 3T47A 4DCNC 2OW6A 4FM3A 4EZUA 4WPEA 2ELBA 3D52A 3DX1A 3VEAA 3DDGA 2WYHA 3LVTA 4IM3A 4M0MA 3LLLA 4H6HA 3M3WA 3T46A 3CKDA 1QX1A 2JNKA 3CZSA 3L3OM 3PLTA 4NPHA 3T48A 3G9GA 4AZGA 1OA1A 1I4TA 3T4AG 2F7RA 3DPQA 3HAJA 3B51X 4EZPA 2EWFA 2EX3B 3ER9B 2Z8YA 4EZNA 1R33A 3BUBA 3LMFA 4R5KA 3OK8A 5FIGA 4JN4A 1URUA 3BVTA 2ALWA 3GI7A 2GAFD 4IM0A 4JWEA 4BNEA 2F7OA 3DX4A 3I01A 4EZXA 4AZCA 2YL6A 3BVUA 4R5JA 4H8SA 2OZNB 3BUDA 2ND1A 2LM0A 1X03A 3F7WA 4EZTA 4HR1A 3KDRA 4FZOA 3DDFA 2NCZA 3SOGA 5TKYA 2V0OA 2YKTA 4UDYX 2D1LA 3RPMA 2FICA 1OAOA 1TQWA 3QE6A 4R5IA 3C7NA 3EJRA 4EZYA 1MJGA 4UDXX 3EJTA 2F7PA 4AZCB 1HWWA 4FZPA 4KIKA 2X3VA 5E84A 1E2UA 3QNJA 4NQIA 4AVMA 2Q13A 3ZEDA 4ATMA 4F01A 3CVRA 4AZIA 3ERCC 3BUQA 3DYTA 2Z0VA 3RV1A 1R34A 3D2FA 4H6IA 1R5EA 1E1DA 3DX0A 2Z0OA 2Q12A 1PS3A 1TQSA 2LXYA 1GN9A 3DX3A 2QFFA 4WPCA 2O0I1 3D4ZA 2GF4A 1JQKA 3QWEA 4D8JA 2EFKA 1HXKA 1ZWWA 4JWDA 2YI8A 2D4CA 4JLCA 1YWMA 2YL8A 3OHXM 3DPOA 1I4LA 4PO2A 2F1BA 1DKYA 5C5BA 1I49A 2ND0A 1X04A 4JNFA 1Y2OA 2WINM 3QNIA 4EZSA 4AZBA 2OO2A 3D2EA 4IWPA 1QWUA 4EZVA 3T49A 1LQ7A 1UPXA 2OW7A 1O7DB 2YI9A 3D51A 1DKXA 1QWNA 3I2WA 1WDZA 1ZYLA 3BVXA 4R5GA 4IWQA 4HY9A 3Q0KA 1SU6A 2YIVX 3D4YA 4AKVA 3DPPA 3BUPA 4DYLA 5KBPA 2KHOA
chains in the Genus database with same CATH topology
4JL9A 1SU8A 3O3NB 1E9VA 2OBMA 3OWGA 4HR1B 1W9MA 2YIBA 3FD9A 4EZOA 1SU7A 2OBLA 2X5CA 2PY6A 4IM2A 3VEBA 3VKHA 2GA9D 2YIAA 4KIKB 4JWCA 3B53X 1OA0A 4E81A 4E3CA 3KAVA 4EZWA 3I04A 3KAWA 4JWIA 4EZZA 1GNLA 1DKZA 4IW0A 4B9QA 4HYBA 4JNEA 1U00A 1SUFA 1GNTA 2N3KA 4EZQA 2RT6A 3O3OB 5FLEX 3I39X 3QA8A 4F00A 4EZRA 4G6QA 3B52X 3ER8C 4R5LA 3RV0A 3UITA 3O3MB 4IWOA 4EZYA 2QXLA 3A98A 3T47A 3ERCC 2JNSA 4FM3A 4EZUA 3VEAA 4IM3A 4M0MA 4H6HA 3T46A 4NPHA 3L3OM 3T48A 1OA1A 3T4AG 3DPQA 4EZPA 3B51X 3ER9B 2EWFA 2EX3B 2Z8YA 4EZNA 3LMFA 4R5KA 5FIGA 4JN4A 3GI7A 4IM0A 2GAFD 4JWEA 3I01A 4EZXA 4R5JA 2ND1A 2LM0A 3F7WA 4EZTA 4HR1A 3KDRA 2NCZA 5TKYA 4UDYX 1OAOA 4R5IA 3C7NA 1MJGA 4UDXX 4KIKA 5E84A 1E2UA 3QNJA 3ZEDA 4F01A 3RV1A 3D2FA 4H6IA 1E1DA 1GN9A 2QFFA 1JQKA 4D8JA 4JWDA 2YI8A 4JLCA 4PO2A 3OHXM 3DPOA 1DKYA 2ND0A 4JNFA 2WINM 4EZSA 4IWPA 3D2EA 4EZVA 3T49A 1UPXA 2YI9A 1DKXA 1ZYLA 4R5GA 4IWQA 4HY9A 1SU6A 2YIVX 3DPPA 2KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN4 A;  4JNE A;  1U00 A;  3D2F A;  4H6I A;  4JWE A;  4EZQ A;  4EZX A;  2QFF A;  2KHO A;  4R5J A;  4F00 A;  4EZR A;  4JWD A;  4EZO A;  4PO2 A;  3OHX M;  3DPO A;  4R5L A;  4EZT A;  1DKY A;  4EZY A;  2QXL A;  4JNF A;  2WIN M;  5TKY A;  3T47 A;  4EZS A;  4EZU A;  3D2E A;  4R5I A;  4EZV A;  3T49 A;  4H6H A;  3C7N A;  4JWC A;  3T46 A;  4E81 A;  3L3O M;  3T48 A;  1DKX A;  4EZW A;  5E84 A;  3T4A G;  3DPQ A;  3QNJ A;  4R5G A;  4EZP A;  4HY9 A;  4B9Q A;  4EZN A;  4JWI A;  4EZZ A;  4F01 A;  4R5K A;  3DPP A;  1DKZ A;  4HYB A; 
#chains in the Genus database with same CATH topology
 4JL9 A;  2X3X A;  3SYV A;  1SU8 A;  4I1Q A;  3O3N B;  1E9V A;  2OBM A;  3OWG A;  4HR1 B;  3BVW A;  1W9M A;  2YIB A;  3DX2 A;  3FD9 A;  3EJS A;  2ZXQ A;  4AZH A;  1SU7 A;  4EZO A;  2OBL A;  4AZ6 A;  2MI7 A;  4NSW A;  2YLA A;  2X5C A;  2PY6 A;  3BLB A;  2F1A A;  2F7Q A;  2Z0N A;  4AZ7 A;  4IM2 A;  2YL9 A;  2RAI A;  3VEB A;  3VKH A;  2GA9 D;  1TQV A;  2RAK A;  2YLL A;  3CZN A;  2YIA A;  4AZ5 A;  4KIK B;  4JWC A;  3B53 X;  1OA0 A;  4E81 A;  4E3C A;  2C08 A;  3KAV A;  4EZW A;  3HAH A;  2RAJ A;  3I04 A;  2X3W A;  3KAW A;  2PMR A;  4JWI A;  1I4D A;  4EZZ A;  1GNL A;  3L3P A;  1DKZ A;  4IW0 A;  5C5B B;  3EJQ A;  4HYB A;  4B9Q A;  3BUI A;  4JNE A;  1U00 A;  1SUF A;  1GNT A;  2N3K A;  3EJP A;  4EZQ A;  2F18 A;  2RT6 A;  2WYI A;  3O3O B;  5FLE X;  3BVV A;  1TQT A;  3I39 X;  2EFL A;  3ACO A;  3QA8 A;  4F00 A;  4G6Q A;  1TQU A;  3EJU A;  4FZS A;  4EZR A;  3B52 X;  2FYV A;  3HAI A;  3ER8 C;  2YL5 A;  3CAZ A;  4R5L A;  1HTY A;  3RV0 A;  3UIT A;  3O3M B;  3D50 A;  4IWO A;  1O7D C;  2QXL A;  2QKW A;  3A98 A;  3ABH A;  3CV5 A;  3Q84 A;  2JNS A;  3T47 A;  4DCN C;  2OW6 A;  4FM3 A;  4EZU A;  4WPE A;  2ELB A;  3D52 A;  3DX1 A;  3VEA A;  3DDG A;  2WYH A;  3LVT A;  4IM3 A;  4M0M A;  3LLL A;  4H6H A;  3M3W A;  3T46 A;  3CKD A;  1QX1 A;  2JNK A;  3CZS A;  3L3O M;  3PLT A;  4NPH A;  3T48 A;  3G9G A;  4AZG A;  1OA1 A;  1I4T A;  3T4A G;  2F7R A;  3DPQ A;  3HAJ A;  3B51 X;  4EZP A;  2EWF A;  2EX3 B;  3ER9 B;  2Z8Y A;  4EZN A;  1R33 A;  3BUB A;  3LMF A;  4R5K A;  3OK8 A;  5FIG A;  4JN4 A;  1URU A;  3BVT A;  2ALW A;  3GI7 A;  2GAF D;  4IM0 A;  4JWE A;  4BNE A;  2F7O A;  3DX4 A;  3I01 A;  4EZX A;  4AZC A;  2YL6 A;  3BVU A;  4R5J A;  4H8S A;  2OZN B;  3BUD A;  2ND1 A;  2LM0 A;  1X03 A;  3F7W A;  4EZT A;  4HR1 A;  3KDR A;  4FZO A;  3DDF A;  2NCZ A;  3SOG A;  5TKY A;  2V0O A;  2YKT A;  4UDY X;  2D1L A;  3RPM A;  2FIC A;  1OAO A;  1TQW A;  3QE6 A;  4R5I A;  3C7N A;  3EJR A;  4EZY A;  1MJG A;  4UDX X;  3EJT A;  2F7P A;  4AZC B;  1HWW A;  4FZP A;  4KIK A;  2X3V A;  5E84 A;  1E2U A;  3QNJ A;  4NQI A;  4AVM A;  2Q13 A;  3ZED A;  4ATM A;  4F01 A;  3CVR A;  4AZI A;  3ERC C;  3BUQ A;  3DYT A;  2Z0V A;  3RV1 A;  1R34 A;  3D2F A;  4H6I A;  1R5E A;  1E1D A;  3DX0 A;  2Z0O A;  2Q12 A;  1PS3 A;  1TQS A;  2LXY A;  1GN9 A;  3DX3 A;  2QFF A;  4WPC A;  2O0I 1;  3D4Z A;  2GF4 A;  1JQK A;  3QWE A;  4D8J A;  2EFK A;  1HXK A;  1ZWW A;  4JWD A;  2YI8 A;  2D4C A;  4JLC A;  1YWM A;  2YL8 A;  3OHX M;  3DPO A;  1I4L A;  4PO2 A;  2F1B A;  1DKY A;  5C5B A;  1I49 A;  2ND0 A;  1X04 A;  4JNF A;  1Y2O A;  2WIN M;  3QNI A;  4EZS A;  4AZB A;  2OO2 A;  3D2E A;  4IWP A;  1QWU A;  4EZV A;  3T49 A;  1LQ7 A;  1UPX A;  2OW7 A;  1O7D B;  2YI9 A;  3D51 A;  1DKX A;  1QWN A;  3I2W A;  1WDZ A;  1ZYL A;  3BVX A;  4R5G A;  4IWQ A;  4HY9 A;  3Q0K A;  1SU6 A;  2YIV X;  3D4Y A;  4AKV A;  3DPP A;  3BUP A;  4DYL A;  5KBP A;  2KHO A; 
#chains in the Genus database with same CATH homology
 4JL9 A;  1SU8 A;  3O3N B;  1E9V A;  2OBM A;  3OWG A;  4HR1 B;  1W9M A;  2YIB A;  3FD9 A;  4EZO A;  1SU7 A;  2OBL A;  2X5C A;  2PY6 A;  4IM2 A;  3VEB A;  3VKH A;  2GA9 D;  2YIA A;  4KIK B;  4JWC A;  3B53 X;  1OA0 A;  4E81 A;  4E3C A;  3KAV A;  4EZW A;  3I04 A;  3KAW A;  4JWI A;  4EZZ A;  1GNL A;  1DKZ A;  4IW0 A;  4B9Q A;  4HYB A;  4JNE A;  1U00 A;  1SUF A;  1GNT A;  2N3K A;  4EZQ A;  2RT6 A;  3O3O B;  5FLE X;  3I39 X;  3QA8 A;  4F00 A;  4EZR A;  4G6Q A;  3B52 X;  3ER8 C;  4R5L A;  3RV0 A;  3UIT A;  3O3M B;  4IWO A;  4EZY A;  2QXL A;  3A98 A;  3T47 A;  3ERC C;  2JNS A;  4FM3 A;  4EZU A;  3VEA A;  4IM3 A;  4M0M A;  4H6H A;  3T46 A;  4NPH A;  3L3O M;  3T48 A;  1OA1 A;  3T4A G;  3DPQ A;  4EZP A;  3B51 X;  3ER9 B;  2EWF A;  2EX3 B;  2Z8Y A;  4EZN A;  3LMF A;  4R5K A;  5FIG A;  4JN4 A;  3GI7 A;  4IM0 A;  2GAF D;  4JWE A;  3I01 A;  4EZX A;  4R5J A;  2ND1 A;  2LM0 A;  3F7W A;  4EZT A;  4HR1 A;  3KDR A;  2NCZ A;  5TKY A;  4UDY X;  1OAO A;  4R5I A;  3C7N A;  1MJG A;  4UDX X;  4KIK A;  5E84 A;  1E2U A;  3QNJ A;  3ZED A;  4F01 A;  3RV1 A;  3D2F A;  4H6I A;  1E1D A;  1GN9 A;  2QFF A;  1JQK A;  4D8J A;  4JWD A;  2YI8 A;  4JLC A;  4PO2 A;  3OHX M;  3DPO A;  1DKY A;  2ND0 A;  4JNF A;  2WIN M;  4EZS A;  4IWP A;  3D2E A;  4EZV A;  3T49 A;  1UPX A;  2YI9 A;  1DKX A;  1ZYL A;  4R5G A;  4IWQ A;  4HY9 A;  1SU6 A;  2YIV X;  3DPP A;  2KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...