3T4AG

Structure of a truncated form of staphylococcal complement inhibitor b bound to human c3c at 3.4 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
AEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
molecule keywords Complement C3 beta chain
total genus 27
structure length 68
sequence length 68
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t4aG00
4R5GA 2WINM 4H6IA 4R5KA 4E81A 1DKYA 1U00A 3D2EA 4JWCA 3D2FA 4JWDA 4EZOA 4F00A 4EZRA 4JWIA 1DKZA 3T47A 4EZQA 4EZWA 4EZUA 4EZSA 4JNEA 3T48A 3OHXM 4R5LA 3DPQA 4JN4A 4EZVA 4PO2A 3QNJA 4H6HA 4HY9A 4JNFA 4R5IA 3T46A 4EZPA 4F01A 3DPOA 4JWEA 4EZNA 4EZZA 4HYBA 4R5JA 3C7NA 5E84A 5TKYA 1DKXA 4EZTA 4EZYA 3L3OM 2QXLA 4B9QA 2QFFA 3DPPA 3T4AG 4EZXA 2KHOA 3T49A
chains in the Genus database with same CATH superfamily
2PMRA 3O3OB 4R5GA 2WINM 3PLTA 4H6IA 4R5KA 3RPMA 4AZCA 2LM0A 4AZ5A 3BUDA 1R34A 4G6QA 1DKYA 4BNEA 2LXYA 3D2FA 3KAWA 4JLCA 3DDGA 2X3XA 1X03A 3F7WA 2F18A 1QWUA 4AKVA 1DKZA 1OA1A 3O3NB 3HAIA 2D4CA 4WPCA 1I4DA 4UDYX 4AZIA 4EZWA 3LVTA 3T48A 5FLEX 1UPXA 2D1LA 3BVTA 2F1BA 2EFKA 2YL5A 5FIGA 2GAFD 3HAHA 4IWPA 2EWFA 2OW6A 2F7QA 3ACOA 3QNIA 1R33A 1SU8A 2YL8A 4IM3A 4UDXX 3BVVA 4ATMA 4EZNA 2OO2A 2JNKA 3FD9A 5TKYA 3BUQA 2YIAA 3M3WA 1URUA 4FZSA 4FZPA 2QFFA 3EJTA 2PY6A 4EZXA 3I2WA 2OZNB 2WYHA 2F7PA 1SU7A 1GNTA 2ZXQA 3D51A 4IW0A 3T49A 3CAZA 3CV5A 4E81A 3B52X 3LLLA 1HWWA 4JWCA 2QKWA 4JWDA 3DX2A 4IM0A 2EFLA 2RT6A 1PS3A 4F00A 3BVUA 5KBPA 2Z0NA 3OK8A 4I1QA 1I49A 1O7DC 4AVMA 3SYVA 4FM3A 4DYLA 4R5LA 3ER9B 2X3VA 3CZNA 2RAIA 4EZVA 1HTYA 2V0OA 3ZEDA 4HR1A 4HY9A 2X5CA 4NPHA 3HAJA 1GNLA 2OBMA 4D8JA 3D50A 3BUPA 3Q84A 3T46A 4EZPA 3DX4A 2GF4A 4JWEA 1E1DA 3ABHA 1MJGA 2YIBA 3O3MB 4HYBA 3RV0A 1SU6A 4EZTA 1DKXA 2RAJA 3CKDA 4EZYA 3VEAA 2N3KA 3CVRA 3KDRA 2OBLA 4DCNC 4B9QA 3ERCC 1R5EA 2F7OA 1TQSA 3B51X 2FYVA 3I01A 3BUIA 3SOGA 3D2EA 5C5BA 4EZOA 1JQKA 2YLLA 3L3PA 3LMFA 5C5BB 4EZRA 4JWIA 3ER8C 1I4LA 2YL6A 3EJQA 1I4TA 4EZQA 2YIVX 1OA0A 4IM2A 4KIKB 4EZUA 4EZSA 3OHXM 2Z8YA 4H8SA 3DPQA 2NCZA 4FZOA 3DX3A 3QNJA 4H6HA 4JN4A 3DDFA 4AZCB 1TQUA 3G9GA 4AZHA 2X3WA 3BUBA 2Q12A 4WPEA 1TQTA 4M0MA 2FICA 2RAKA 1E2UA 2Q13A 3RV1A 3DPOA 4F01A 1WDZA 4IWOA 2C08A 4R5JA 3EJUA 2F7RA 3L3OM 2WYIA 1OAOA 3DPPA 3EJRA 3VEBA 2YI8A 2YL9A 3BLBA 1ZWWA 1YWMA 2GA9D 1ZYLA 3CZSA 3Q0KA 4HR1B 1QX1A 1TQVA 1U00A 1X04A 2OW7A 3EJSA 1SUFA 1HXKA 3EJPA 2ND0A 3VKHA 2YKTA 3BVWA 4IWQA 3I04A 4JL9A 4AZ7A 3GI7A 3T47A 3KAVA 3UITA 4AZ6A 2ELBA 4JNEA 2Z0OA 3DX1A 3DX0A 4NQIA 3B53X 4PO2A 2YLAA 3DYTA 1GN9A 1Y2OA 3BVXA 3I39X 2MI7A 2ND1A 3D4ZA 4JNFA 4AZGA 4E3CA 4R5IA 3D52A 2ALWA 2Z0VA 1LQ7A 2O0I1 4EZZA 1W9MA 2F1AA 3C7NA 1TQWA 3QE6A 1QWNA 3A98A 5E84A 1E9VA 1O7DB 3QWEA 4KIKA 2QXLA 4NSWA 2YI9A 3D4YA 3T4AG 2JNSA 4AZBA 2EX3B 2KHOA 3OWGA 3QA8A
chains in the Genus database with same CATH topology
3O3OB 4R5GA 2WINM 4H6IA 4R5KA 3VEBA 2LM0A 4G6QA 1DKYA 3D2FA 3KAWA 4JLCA 3F7WA 1DKZA 1OA1A 3O3NB 4EZWA 4UDYX 3T48A 5FLEX 1UPXA 5FIGA 2GAFD 4IWPA 2EWFA 1SU8A 4IM3A 4UDXX 4EZNA 5TKYA 3FD9A 2YIAA 2QFFA 2PY6A 4EZXA 1GNTA 1SU7A 3T49A 4IW0A 4E81A 3B52X 4JWCA 4JWDA 4IM0A 4F00A 2RT6A 3ER9B 4FM3A 4R5LA 4EZVA 3ZEDA 4HR1A 4HY9A 2X5CA 4NPHA 1GNLA 2OBMA 4D8JA 3T46A 4EZPA 4JWEA 1E1DA 1MJGA 2YIBA 3O3MB 4HYBA 3RV0A 1SU6A 4EZTA 1DKXA 4EZYA 3VEAA 2N3KA 3ERCC 3KDRA 2OBLA 4B9QA 3B51X 3I01A 3D2EA 4EZOA 1JQKA 4EZRA 3LMFA 4JWIA 3ER8C 4EZQA 2YIVX 1OA0A 4IM2A 4KIKB 4EZUA 4EZSA 3OHXM 2Z8YA 3DPQA 2NCZA 4JN4A 3QNJA 4H6HA 3RV1A 4M0MA 1E2UA 4F01A 3DPOA 4IWOA 4R5JA 3L3OM 3DPPA 1OAOA 2YI8A 2GA9D 1ZYLA 4HR1B 1U00A 1SUFA 3VKHA 2ND0A 4IWQA 3I04A 4JL9A 3GI7A 3T47A 3KAVA 3UITA 4JNEA 3B53X 4PO2A 3I39X 1GN9A 4JNFA 2ND1A 4E3CA 4R5IA 4EZZA 1W9MA 3C7NA 5E84A 3A98A 1E9VA 4KIKA 2QXLA 2YI9A 3T4AG 2JNSA 2EX3B 2KHOA 3OWGA 3QA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5G A;  2WIN M;  4H6I A;  4R5K A;  4E81 A;  1DKY A;  1U00 A;  3D2E A;  4JWC A;  3D2F A;  4JWD A;  4EZO A;  4F00 A;  4EZR A;  4JWI A;  1DKZ A;  3T47 A;  4EZQ A;  4EZW A;  4EZU A;  4EZS A;  4JNE A;  3T48 A;  3OHX M;  4R5L A;  3DPQ A;  4JN4 A;  4EZV A;  4PO2 A;  3QNJ A;  4H6H A;  4HY9 A;  4JNF A;  4R5I A;  3T46 A;  4EZP A;  4F01 A;  3DPO A;  4JWE A;  4EZN A;  4EZZ A;  4HYB A;  4R5J A;  3C7N A;  5E84 A;  5TKY A;  1DKX A;  4EZT A;  4EZY A;  3L3O M;  2QXL A;  4B9Q A;  2QFF A;  3DPP A;  3T4A G;  4EZX A;  2KHO A;  3T49 A; 
#chains in the Genus database with same CATH topology
 2PMR A;  3O3O B;  4R5G A;  2WIN M;  3PLT A;  4H6I A;  4R5K A;  3RPM A;  4AZC A;  2LM0 A;  4AZ5 A;  3BUD A;  1R34 A;  4G6Q A;  1DKY A;  4BNE A;  2LXY A;  3D2F A;  3KAW A;  4JLC A;  3DDG A;  2X3X A;  1X03 A;  3F7W A;  2F18 A;  1QWU A;  4AKV A;  1DKZ A;  1OA1 A;  3O3N B;  3HAI A;  2D4C A;  4WPC A;  1I4D A;  4UDY X;  4AZI A;  4EZW A;  3LVT A;  3T48 A;  5FLE X;  1UPX A;  2D1L A;  3BVT A;  2F1B A;  2EFK A;  2YL5 A;  5FIG A;  2GAF D;  3HAH A;  4IWP A;  2EWF A;  2OW6 A;  2F7Q A;  3ACO A;  3QNI A;  1R33 A;  1SU8 A;  2YL8 A;  4IM3 A;  4UDX X;  3BVV A;  4ATM A;  4EZN A;  2OO2 A;  2JNK A;  3FD9 A;  5TKY A;  3BUQ A;  2YIA A;  3M3W A;  1URU A;  4FZS A;  4FZP A;  2QFF A;  3EJT A;  2PY6 A;  4EZX A;  3I2W A;  2OZN B;  2WYH A;  2F7P A;  1SU7 A;  1GNT A;  2ZXQ A;  3D51 A;  4IW0 A;  3T49 A;  3CAZ A;  3CV5 A;  4E81 A;  3B52 X;  3LLL A;  1HWW A;  4JWC A;  2QKW A;  4JWD A;  3DX2 A;  4IM0 A;  2EFL A;  2RT6 A;  1PS3 A;  4F00 A;  3BVU A;  5KBP A;  2Z0N A;  3OK8 A;  4I1Q A;  1I49 A;  1O7D C;  4AVM A;  3SYV A;  4FM3 A;  4DYL A;  4R5L A;  3ER9 B;  2X3V A;  3CZN A;  2RAI A;  4EZV A;  1HTY A;  2V0O A;  3ZED A;  4HR1 A;  4HY9 A;  2X5C A;  4NPH A;  3HAJ A;  1GNL A;  2OBM A;  4D8J A;  3D50 A;  3BUP A;  3Q84 A;  3T46 A;  4EZP A;  3DX4 A;  2GF4 A;  4JWE A;  1E1D A;  3ABH A;  1MJG A;  2YIB A;  3O3M B;  4HYB A;  3RV0 A;  1SU6 A;  4EZT A;  1DKX A;  2RAJ A;  3CKD A;  4EZY A;  3VEA A;  2N3K A;  3CVR A;  3KDR A;  2OBL A;  4DCN C;  4B9Q A;  3ERC C;  1R5E A;  2F7O A;  1TQS A;  3B51 X;  2FYV A;  3I01 A;  3BUI A;  3SOG A;  3D2E A;  5C5B A;  4EZO A;  1JQK A;  2YLL A;  3L3P A;  3LMF A;  5C5B B;  4EZR A;  4JWI A;  3ER8 C;  1I4L A;  2YL6 A;  3EJQ A;  1I4T A;  4EZQ A;  2YIV X;  1OA0 A;  4IM2 A;  4KIK B;  4EZU A;  4EZS A;  3OHX M;  2Z8Y A;  4H8S A;  3DPQ A;  2NCZ A;  4FZO A;  3DX3 A;  3QNJ A;  4H6H A;  4JN4 A;  3DDF A;  4AZC B;  1TQU A;  3G9G A;  4AZH A;  2X3W A;  3BUB A;  2Q12 A;  4WPE A;  1TQT A;  4M0M A;  2FIC A;  2RAK A;  1E2U A;  2Q13 A;  3RV1 A;  3DPO A;  4F01 A;  1WDZ A;  4IWO A;  2C08 A;  4R5J A;  3EJU A;  2F7R A;  3L3O M;  2WYI A;  1OAO A;  3DPP A;  3EJR A;  3VEB A;  2YI8 A;  2YL9 A;  3BLB A;  1ZWW A;  1YWM A;  2GA9 D;  1ZYL A;  3CZS A;  3Q0K A;  4HR1 B;  1QX1 A;  1TQV A;  1U00 A;  1X04 A;  2OW7 A;  3EJS A;  1SUF A;  1HXK A;  3EJP A;  2ND0 A;  3VKH A;  2YKT A;  3BVW A;  4IWQ A;  3I04 A;  4JL9 A;  4AZ7 A;  3GI7 A;  3T47 A;  3KAV A;  3UIT A;  4AZ6 A;  2ELB A;  4JNE A;  2Z0O A;  3DX1 A;  3DX0 A;  4NQI A;  3B53 X;  4PO2 A;  2YLA A;  3DYT A;  1GN9 A;  1Y2O A;  3BVX A;  3I39 X;  2MI7 A;  2ND1 A;  3D4Z A;  4JNF A;  4AZG A;  4E3C A;  4R5I A;  3D52 A;  2ALW A;  2Z0V A;  1LQ7 A;  2O0I 1;  4EZZ A;  1W9M A;  2F1A A;  3C7N A;  1TQW A;  3QE6 A;  1QWN A;  3A98 A;  5E84 A;  1E9V A;  1O7D B;  3QWE A;  4KIK A;  2QXL A;  4NSW A;  2YI9 A;  3D4Y A;  3T4A G;  2JNS A;  4AZB A;  2EX3 B;  2KHO A;  3OWG A;  3QA8 A; 
#chains in the Genus database with same CATH homology
 3O3O B;  4R5G A;  2WIN M;  4H6I A;  4R5K A;  3VEB A;  2LM0 A;  4G6Q A;  1DKY A;  3D2F A;  3KAW A;  4JLC A;  3F7W A;  1DKZ A;  1OA1 A;  3O3N B;  4EZW A;  4UDY X;  3T48 A;  5FLE X;  1UPX A;  5FIG A;  2GAF D;  4IWP A;  2EWF A;  1SU8 A;  4IM3 A;  4UDX X;  4EZN A;  5TKY A;  3FD9 A;  2YIA A;  2QFF A;  2PY6 A;  4EZX A;  1GNT A;  1SU7 A;  3T49 A;  4IW0 A;  4E81 A;  3B52 X;  4JWC A;  4JWD A;  4IM0 A;  4F00 A;  2RT6 A;  3ER9 B;  4FM3 A;  4R5L A;  4EZV A;  3ZED A;  4HR1 A;  4HY9 A;  2X5C A;  4NPH A;  1GNL A;  2OBM A;  4D8J A;  3T46 A;  4EZP A;  4JWE A;  1E1D A;  1MJG A;  2YIB A;  3O3M B;  4HYB A;  3RV0 A;  1SU6 A;  4EZT A;  1DKX A;  4EZY A;  3VEA A;  2N3K A;  3ERC C;  3KDR A;  2OBL A;  4B9Q A;  3B51 X;  3I01 A;  3D2E A;  4EZO A;  1JQK A;  4EZR A;  3LMF A;  4JWI A;  3ER8 C;  4EZQ A;  2YIV X;  1OA0 A;  4IM2 A;  4KIK B;  4EZU A;  4EZS A;  3OHX M;  2Z8Y A;  3DPQ A;  2NCZ A;  4JN4 A;  3QNJ A;  4H6H A;  3RV1 A;  4M0M A;  1E2U A;  4F01 A;  3DPO A;  4IWO A;  4R5J A;  3L3O M;  3DPP A;  1OAO A;  2YI8 A;  2GA9 D;  1ZYL A;  4HR1 B;  1U00 A;  1SUF A;  3VKH A;  2ND0 A;  4IWQ A;  3I04 A;  4JL9 A;  3GI7 A;  3T47 A;  3KAV A;  3UIT A;  4JNE A;  3B53 X;  4PO2 A;  3I39 X;  1GN9 A;  4JNF A;  2ND1 A;  4E3C A;  4R5I A;  4EZZ A;  1W9M A;  3C7N A;  5E84 A;  3A98 A;  1E9V A;  4KIK A;  2QXL A;  2YI9 A;  3T4A G;  2JNS A;  2EX3 B;  2KHO A;  3OWG A;  3QA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...