3T4MA

Ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVTHDGSVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVRFYECCKEPYPDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
molecule keywords Soluble acetylcholine receptor
molecule tags Receptor
source organism Aplysia californica
total genus 49
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3t4mA00
3PEOA 3EHZA 4UY2A 3UU4A 5JMEA 2BR7A 2BYRA 4HFCA 4Z90A 1UX2A 4Z91A 4ZZCA 3JADA 3ZDGA 3JAEA 4X5TA 4HQPA 4ALXA 3SH1A 3ZDHA 5J5GA 2W8FA 3U8NA 2XQ5A 4HFBA 3WIPA 3WTIA 2XNVA 4F8HA 4ZK1A 3U8LA 4BQTA 2Y7YA 4HFHA 3UUBA 1I9BA 3LSVA 4FRRA 2ZJUA 5L4HA 4WV9A 2W8GA 4XK9A 5SYOA 3RHWA 3RQWA 4EZ1A 2C9TA 4LMLA 3WTKA 4ILAA 3WTJA 3JAFA 4A98A 2XZ5A 3WTHA 2BYPA 5TVCA 5IUXA 3GUAA 4TWFA 4ZJSA 3SIOA 3UU8A 3RIFA 5BRXA 3U8JA 2BG9A 2BG9B 5CO5A 5AFNA 2WZYA 1UW6A 2WNLA 3PMZA 3U8MA 1UV6A 2XQ4A 3C79A 3ZKRA 2XQ6A 2XQAA 2WN9A 2XQ8A 3P4WA 5FJVA 3TLVA 4AFTA 5BP0A 4UM3P 4ZR6A 4UM3S 2YMDA 4TWDA 3WTOA 2QC1B 4B5DA 4QABA 4TNVA 2YMEA 4QAAA 5AFHA 5HEOA 3RIAA 3UU6A 2XQ9A 4ILBA 4HFEA 4COFA 2Y57A 2Y58A 5AFKA 5CFBA 3P50A 4LMJA 4TWHA 3TLUA 4IREA 2XYSA 5HCMA 3TLSA 4QH4A 5AINA 5AFLA 3WTNA 4QH5A 4QACA 4ZJTA 4HFIA 2BR8A 2XNTA 2BYNA 2VL0A 3RQUA 5KZUA 4PIRA 2XNUA 3C84A 3EI0A 3T4MA 3UQ7A 4IL4A 4NZBA 4XHEA 4D01A 3U8KA 5L4EA 5HEHA 3WTMA 3SQ9A 3SQ6A 5HCJA 4BFQA 4ILCA 5J5HA 2XYTA 2Y56A 5BW2A 2BYQA 2X00A 5J0ZA 2WNJA 2UZ6A 4TNWA 2XQ7A 4AFGA 4LMKA 4QH1A 2BYSA 2BG9E 5J5IA 5L47A 5LXBA 2XQ3A 3TLWA 4UM3A 3UQ4A 5LG3A 2WNCA 5KE4A 2BG9C 3UU5A 4UXUA 4UM1A 5J5FA 2X00D 4A97A 3EAMA 5HEUA 5HEJA 2PH9A 4NPPA 4DBMA 4ZRUA 2XZ6A 5AFJA 2YKSA 4IL9A 2Y54A 3TLTA 2PGZA 4HFDA 4ZZBA 4ZK4A 2YN6A 3RI5A 3UU3A 5AFMA 5AFMB 3WTLA 5HEGA 2ZJVA 4AFHA 3IGQA 2YOEA 2BJ0A
chains in the Genus database with same CATH superfamily
3PEOA 3EHZA 4UY2A 3UU4A 5JMEA 2BR7A 2BYRA 4HFCA 4Z90A 1UX2A 4Z91A 4ZZCA 3JADA 3ZDGA 3JAEA 4X5TA 4HQPA 4ALXA 3SH1A 3ZDHA 5J5GA 2W8FA 3U8NA 2XQ5A 4HFBA 3WIPA 3WTIA 2XNVA 4F8HA 4ZK1A 3U8LA 4BQTA 2Y7YA 4HFHA 3UUBA 1I9BA 3LSVA 4FRRA 2ZJUA 5L4HA 4WV9A 2W8GA 4XK9A 5SYOA 3RHWA 3RQWA 4EZ1A 2C9TA 4LMLA 3WTKA 4ILAA 3WTJA 3JAFA 4A98A 2XZ5A 3WTHA 2BYPA 5TVCA 5IUXA 3GUAA 4TWFA 4ZJSA 3SIOA 3UU8A 3RIFA 5BRXA 3U8JA 2BG9A 2BG9B 5CO5A 5AFNA 2WZYA 1UW6A 2WNLA 3PMZA 3U8MA 1UV6A 2XQ4A 3C79A 3ZKRA 2XQ6A 2XQAA 2WN9A 2XQ8A 3P4WA 5FJVA 3TLVA 4AFTA 5BP0A 4UM3P 4ZR6A 4UM3S 2YMDA 4TWDA 3WTOA 2QC1B 4B5DA 4QABA 4TNVA 2YMEA 4QAAA 5AFHA 5HEOA 3RIAA 3UU6A 2XQ9A 4ILBA 4HFEA 4COFA 2Y57A 2Y58A 5AFKA 5CFBA 3P50A 4LMJA 4TWHA 3TLUA 4IREA 2XYSA 5HCMA 3TLSA 4QH4A 5AINA 5AFLA 3WTNA 4QH5A 4QACA 4ZJTA 4HFIA 2BR8A 2XNTA 2BYNA 2VL0A 3RQUA 5KZUA 4PIRA 2XNUA 3C84A 3EI0A 3T4MA 3UQ7A 4IL4A 4NZBA 4XHEA 4D01A 3U8KA 5L4EA 5HEHA 3WTMA 3SQ9A 3SQ6A 5HCJA 4BFQA 4ILCA 5J5HA 2XYTA 2Y56A 5BW2A 2BYQA 2X00A 5J0ZA 2WNJA 2UZ6A 4TNWA 2XQ7A 4AFGA 4LMKA 4QH1A 2BYSA 2BG9E 5J5IA 5L47A 5LXBA 2XQ3A 3TLWA 4UM3A 3UQ4A 5LG3A 2WNCA 5KE4A 2BG9C 3UU5A 4UXUA 4UM1A 5J5FA 2X00D 4A97A 3EAMA 5HEUA 5HEJA 2PH9A 4NPPA 4DBMA 4ZRUA 2XZ6A 5AFJA 2YKSA 4IL9A 2Y54A 3TLTA 2PGZA 4HFDA 4ZZBA 4ZK4A 2YN6A 3RI5A 3UU3A 5AFMA 5AFMB 3WTLA 5HEGA 2ZJVA 4AFHA 3IGQA 2YOEA 2BJ0A
chains in the Genus database with same CATH topology
3PEOA 3EHZA 4UY2A 3UU4A 5JMEA 2BR7A 2BYRA 4HFCA 4Z90A 1UX2A 4Z91A 4ZZCA 3JADA 3ZDGA 3JAEA 4X5TA 4HQPA 4ALXA 3SH1A 3ZDHA 5J5GA 2W8FA 3U8NA 2XQ5A 4HFBA 3WIPA 3WTIA 2XNVA 4F8HA 4ZK1A 3U8LA 4BQTA 2Y7YA 4HFHA 3UUBA 1I9BA 3LSVA 4FRRA 2ZJUA 5L4HA 4WV9A 2W8GA 4XK9A 5SYOA 3RHWA 3RQWA 4EZ1A 2C9TA 4LMLA 3WTKA 4ILAA 3WTJA 3JAFA 4A98A 2XZ5A 3WTHA 2BYPA 5TVCA 5IUXA 3GUAA 4TWFA 4ZJSA 3SIOA 3UU8A 3RIFA 5BRXA 3U8JA 2BG9A 2BG9B 5CO5A 5AFNA 2WZYA 1UW6A 2WNLA 3PMZA 3U8MA 1UV6A 2XQ4A 3C79A 3ZKRA 2XQ6A 2XQAA 2WN9A 2XQ8A 3P4WA 5FJVA 3TLVA 4AFTA 5BP0A 4UM3P 4ZR6A 4UM3S 2YMDA 4TWDA 3WTOA 2QC1B 4B5DA 4QABA 4TNVA 2YMEA 4QAAA 5AFHA 5HEOA 3RIAA 3UU6A 2XQ9A 4ILBA 4HFEA 4COFA 2Y57A 2Y58A 5AFKA 5CFBA 3P50A 4LMJA 4TWHA 3TLUA 4IREA 2XYSA 5HCMA 3TLSA 4QH4A 5AINA 5AFLA 3WTNA 4QH5A 4QACA 4ZJTA 4HFIA 2BR8A 2XNTA 2BYNA 2VL0A 3RQUA 5KZUA 4PIRA 2XNUA 3C84A 3EI0A 3T4MA 3UQ7A 4IL4A 4NZBA 4XHEA 4D01A 3U8KA 5L4EA 5HEHA 3WTMA 3SQ9A 3SQ6A 5HCJA 4BFQA 4ILCA 5J5HA 2XYTA 2Y56A 5BW2A 2BYQA 2X00A 5J0ZA 2WNJA 2UZ6A 4TNWA 2XQ7A 4AFGA 4LMKA 4QH1A 2BYSA 2BG9E 5J5IA 5L47A 5LXBA 2XQ3A 3TLWA 4UM3A 3UQ4A 5LG3A 2WNCA 5KE4A 2BG9C 3UU5A 4UXUA 4UM1A 5J5FA 2X00D 4A97A 3EAMA 5HEUA 5HEJA 2PH9A 4NPPA 4DBMA 4ZRUA 2XZ6A 5AFJA 2YKSA 4IL9A 2Y54A 3TLTA 2PGZA 4HFDA 4ZZBA 4ZK4A 2YN6A 3RI5A 3UU3A 5AFMA 5AFMB 3WTLA 5HEGA 2ZJVA 4AFHA 3IGQA 2YOEA 2BJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEO A;  3EHZ A;  4UY2 A;  3UU4 A;  5JME A;  2BR7 A;  2BYR A;  4HFC A;  4Z90 A;  1UX2 A;  4Z91 A;  4ZZC A;  3JAD A;  3ZDG A;  3JAE A;  4X5T A;  4HQP A;  4ALX A;  3SH1 A;  3ZDH A;  5J5G A;  2W8F A;  3U8N A;  2XQ5 A;  4HFB A;  3WIP A;  3WTI A;  2XNV A;  4F8H A;  4ZK1 A;  3U8L A;  4BQT A;  2Y7Y A;  4HFH A;  3UUB A;  1I9B A;  3LSV A;  4FRR A;  2ZJU A;  5L4H A;  4WV9 A;  2W8G A;  4XK9 A;  5SYO A;  3RHW A;  3RQW A;  4EZ1 A;  2C9T A;  4LML A;  3WTK A;  4ILA A;  3WTJ A;  3JAF A;  4A98 A;  2XZ5 A;  3WTH A;  2BYP A;  5TVC A;  5IUX A;  3GUA A;  4TWF A;  4ZJS A;  3SIO A;  3UU8 A;  3RIF A;  5BRX A;  3U8J A;  2BG9 A;  2BG9 B;  5CO5 A;  5AFN A;  2WZY A;  1UW6 A;  2WNL A;  3PMZ A;  3U8M A;  1UV6 A;  2XQ4 A;  3C79 A;  3ZKR A;  2XQ6 A;  2XQA A;  2WN9 A;  2XQ8 A;  3P4W A;  5FJV A;  3TLV A;  4AFT A;  5BP0 A;  4UM3 P;  4ZR6 A;  4UM3 S;  2YMD A;  4TWD A;  3WTO A;  2QC1 B;  4B5D A;  4QAB A;  4TNV A;  2YME A;  4QAA A;  5AFH A;  5HEO A;  3RIA A;  3UU6 A;  2XQ9 A;  4ILB A;  4HFE A;  4COF A;  2Y57 A;  2Y58 A;  5AFK A;  5CFB A;  3P50 A;  4LMJ A;  4TWH A;  3TLU A;  4IRE A;  2XYS A;  5HCM A;  3TLS A;  4QH4 A;  5AIN A;  5AFL A;  3WTN A;  4QH5 A;  4QAC A;  4ZJT A;  4HFI A;  2BR8 A;  2XNT A;  2BYN A;  2VL0 A;  3RQU A;  5KZU A;  4PIR A;  2XNU A;  3C84 A;  3EI0 A;  3T4M A;  3UQ7 A;  4IL4 A;  4NZB A;  4XHE A;  4D01 A;  3U8K A;  5L4E A;  5HEH A;  3WTM A;  3SQ9 A;  3SQ6 A;  5HCJ A;  4BFQ A;  4ILC A;  5J5H A;  2XYT A;  2Y56 A;  5BW2 A;  2BYQ A;  2X00 A;  5J0Z A;  2WNJ A;  2UZ6 A;  4TNW A;  2XQ7 A;  4AFG A;  4LMK A;  4QH1 A;  2BYS A;  2BG9 E;  5J5I A;  5L47 A;  5LXB A;  2XQ3 A;  3TLW A;  4UM3 A;  3UQ4 A;  5LG3 A;  2WNC A;  5KE4 A;  2BG9 C;  3UU5 A;  4UXU A;  4UM1 A;  5J5F A;  2X00 D;  4A97 A;  3EAM A;  5HEU A;  5HEJ A;  2PH9 A;  4NPP A;  4DBM A;  4ZRU A;  2XZ6 A;  5AFJ A;  2YKS A;  4IL9 A;  2Y54 A;  3TLT A;  2PGZ A;  4HFD A;  4ZZB A;  4ZK4 A;  2YN6 A;  3RI5 A;  3UU3 A;  5AFM A;  5AFM B;  3WTL A;  5HEG A;  2ZJV A;  4AFH A;  3IGQ A;  2YOE A;  2BJ0 A; 
#chains in the Genus database with same CATH topology
 3PEO A;  3EHZ A;  4UY2 A;  3UU4 A;  5JME A;  2BR7 A;  2BYR A;  4HFC A;  4Z90 A;  1UX2 A;  4Z91 A;  4ZZC A;  3JAD A;  3ZDG A;  3JAE A;  4X5T A;  4HQP A;  4ALX A;  3SH1 A;  3ZDH A;  5J5G A;  2W8F A;  3U8N A;  2XQ5 A;  4HFB A;  3WIP A;  3WTI A;  2XNV A;  4F8H A;  4ZK1 A;  3U8L A;  4BQT A;  2Y7Y A;  4HFH A;  3UUB A;  1I9B A;  3LSV A;  4FRR A;  2ZJU A;  5L4H A;  4WV9 A;  2W8G A;  4XK9 A;  5SYO A;  3RHW A;  3RQW A;  4EZ1 A;  2C9T A;  4LML A;  3WTK A;  4ILA A;  3WTJ A;  3JAF A;  4A98 A;  2XZ5 A;  3WTH A;  2BYP A;  5TVC A;  5IUX A;  3GUA A;  4TWF A;  4ZJS A;  3SIO A;  3UU8 A;  3RIF A;  5BRX A;  3U8J A;  2BG9 A;  2BG9 B;  5CO5 A;  5AFN A;  2WZY A;  1UW6 A;  2WNL A;  3PMZ A;  3U8M A;  1UV6 A;  2XQ4 A;  3C79 A;  3ZKR A;  2XQ6 A;  2XQA A;  2WN9 A;  2XQ8 A;  3P4W A;  5FJV A;  3TLV A;  4AFT A;  5BP0 A;  4UM3 P;  4ZR6 A;  4UM3 S;  2YMD A;  4TWD A;  3WTO A;  2QC1 B;  4B5D A;  4QAB A;  4TNV A;  2YME A;  4QAA A;  5AFH A;  5HEO A;  3RIA A;  3UU6 A;  2XQ9 A;  4ILB A;  4HFE A;  4COF A;  2Y57 A;  2Y58 A;  5AFK A;  5CFB A;  3P50 A;  4LMJ A;  4TWH A;  3TLU A;  4IRE A;  2XYS A;  5HCM A;  3TLS A;  4QH4 A;  5AIN A;  5AFL A;  3WTN A;  4QH5 A;  4QAC A;  4ZJT A;  4HFI A;  2BR8 A;  2XNT A;  2BYN A;  2VL0 A;  3RQU A;  5KZU A;  4PIR A;  2XNU A;  3C84 A;  3EI0 A;  3T4M A;  3UQ7 A;  4IL4 A;  4NZB A;  4XHE A;  4D01 A;  3U8K A;  5L4E A;  5HEH A;  3WTM A;  3SQ9 A;  3SQ6 A;  5HCJ A;  4BFQ A;  4ILC A;  5J5H A;  2XYT A;  2Y56 A;  5BW2 A;  2BYQ A;  2X00 A;  5J0Z A;  2WNJ A;  2UZ6 A;  4TNW A;  2XQ7 A;  4AFG A;  4LMK A;  4QH1 A;  2BYS A;  2BG9 E;  5J5I A;  5L47 A;  5LXB A;  2XQ3 A;  3TLW A;  4UM3 A;  3UQ4 A;  5LG3 A;  2WNC A;  5KE4 A;  2BG9 C;  3UU5 A;  4UXU A;  4UM1 A;  5J5F A;  2X00 D;  4A97 A;  3EAM A;  5HEU A;  5HEJ A;  2PH9 A;  4NPP A;  4DBM A;  4ZRU A;  2XZ6 A;  5AFJ A;  2YKS A;  4IL9 A;  2Y54 A;  3TLT A;  2PGZ A;  4HFD A;  4ZZB A;  4ZK4 A;  2YN6 A;  3RI5 A;  3UU3 A;  5AFM A;  5AFM B;  3WTL A;  5HEG A;  2ZJV A;  4AFH A;  3IGQ A;  2YOE A;  2BJ0 A; 
#chains in the Genus database with same CATH homology
 3PEO A;  3EHZ A;  4UY2 A;  3UU4 A;  5JME A;  2BR7 A;  2BYR A;  4HFC A;  4Z90 A;  1UX2 A;  4Z91 A;  4ZZC A;  3JAD A;  3ZDG A;  3JAE A;  4X5T A;  4HQP A;  4ALX A;  3SH1 A;  3ZDH A;  5J5G A;  2W8F A;  3U8N A;  2XQ5 A;  4HFB A;  3WIP A;  3WTI A;  2XNV A;  4F8H A;  4ZK1 A;  3U8L A;  4BQT A;  2Y7Y A;  4HFH A;  3UUB A;  1I9B A;  3LSV A;  4FRR A;  2ZJU A;  5L4H A;  4WV9 A;  2W8G A;  4XK9 A;  5SYO A;  3RHW A;  3RQW A;  4EZ1 A;  2C9T A;  4LML A;  3WTK A;  4ILA A;  3WTJ A;  3JAF A;  4A98 A;  2XZ5 A;  3WTH A;  2BYP A;  5TVC A;  5IUX A;  3GUA A;  4TWF A;  4ZJS A;  3SIO A;  3UU8 A;  3RIF A;  5BRX A;  3U8J A;  2BG9 A;  2BG9 B;  5CO5 A;  5AFN A;  2WZY A;  1UW6 A;  2WNL A;  3PMZ A;  3U8M A;  1UV6 A;  2XQ4 A;  3C79 A;  3ZKR A;  2XQ6 A;  2XQA A;  2WN9 A;  2XQ8 A;  3P4W A;  5FJV A;  3TLV A;  4AFT A;  5BP0 A;  4UM3 P;  4ZR6 A;  4UM3 S;  2YMD A;  4TWD A;  3WTO A;  2QC1 B;  4B5D A;  4QAB A;  4TNV A;  2YME A;  4QAA A;  5AFH A;  5HEO A;  3RIA A;  3UU6 A;  2XQ9 A;  4ILB A;  4HFE A;  4COF A;  2Y57 A;  2Y58 A;  5AFK A;  5CFB A;  3P50 A;  4LMJ A;  4TWH A;  3TLU A;  4IRE A;  2XYS A;  5HCM A;  3TLS A;  4QH4 A;  5AIN A;  5AFL A;  3WTN A;  4QH5 A;  4QAC A;  4ZJT A;  4HFI A;  2BR8 A;  2XNT A;  2BYN A;  2VL0 A;  3RQU A;  5KZU A;  4PIR A;  2XNU A;  3C84 A;  3EI0 A;  3T4M A;  3UQ7 A;  4IL4 A;  4NZB A;  4XHE A;  4D01 A;  3U8K A;  5L4E A;  5HEH A;  3WTM A;  3SQ9 A;  3SQ6 A;  5HCJ A;  4BFQ A;  4ILC A;  5J5H A;  2XYT A;  2Y56 A;  5BW2 A;  2BYQ A;  2X00 A;  5J0Z A;  2WNJ A;  2UZ6 A;  4TNW A;  2XQ7 A;  4AFG A;  4LMK A;  4QH1 A;  2BYS A;  2BG9 E;  5J5I A;  5L47 A;  5LXB A;  2XQ3 A;  3TLW A;  4UM3 A;  3UQ4 A;  5LG3 A;  2WNC A;  5KE4 A;  2BG9 C;  3UU5 A;  4UXU A;  4UM1 A;  5J5F A;  2X00 D;  4A97 A;  3EAM A;  5HEU A;  5HEJ A;  2PH9 A;  4NPP A;  4DBM A;  4ZRU A;  2XZ6 A;  5AFJ A;  2YKS A;  4IL9 A;  2Y54 A;  3TLT A;  2PGZ A;  4HFD A;  4ZZB A;  4ZK4 A;  2YN6 A;  3RI5 A;  3UU3 A;  5AFM A;  5AFM B;  3WTL A;  5HEG A;  2ZJV A;  4AFH A;  3IGQ A;  2YOE A;  2BJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...