3T57A

Activity and crystal structure of arabidopsis udp-n-acetylglucosamine acyltransferase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
288
structure length
288
Chain Sequence
LIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELYSVPAVSAMLQSIRDSFTESRRGICK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity and Crystal Structure of Arabidopsis thalianaUDP-N-Acetylglucosamine Acyltransferase.
pubmed doi rcsb
molecule keywords UDP-N-acetylglucosamine O-acyltransferase domain-containing
molecule tags Transferase
source organism Arabidopsis thaliana
total genus 114
structure length 288
sequence length 288
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 3t57A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3t57A01
3R5AA 3BSWA 1J2ZA 2WLDA 4EA7A 3V4EA 3BSYA 3NZ2A 3I3AA 4E79A 1KRVA 4E75A 2QKXA 3VNPA 4E6UA 2GGQA 3GVDA 3P47A 3CJ8A 2ICYA 3FSBA 3FTTA 1T3DA 4HZDA 1QRGA 5ADXV 2V0IA 5E3PA 3R5CA 3R5DA 3BRKX 1YP4A 2GGOA 2FKOA 3DK5A 1SSTA 3R3RA 4FCEA 2WLFA 3SRTA 3IGJA 3TIOA 3TWDA 4KNXA 2WLCA 5E3RA 3VBPA 5DEMA 2IU8A 2AQ9A 1KK6A 1THJA 3FSCA 4G3PA 3EG4A 3MQGA 1V67A 3EH0A 1FWYA 2TDTA 2OEFA 3FS8A 3JQYA 2VHEA 3R8YA 3VBJA 3OW5A 3MQHA 4EQYA 4ISXA 1G95A 2WLEA 1YP3A 1FXJA 3TDTA 2RIJA 1OCXA 3OTZA 1KRRA 2IU9A 2VD4A 3OU9A 3OUPA 4HZCA 2W0VA 4MZUA 1MRLA 2V0JA 3R2WA 4IHGA 1LXAA 3VBLA 3PMOA 4M2AA 1KHRA 4IHFA 2OI5A 4AA7A 3KWDA 4HURA 4IHHA 4N69A 4M99A 2QIAA 5AFUU 2JF3A 2XATA 3GOSA 4MFGA 5E3QA 1KRUA 3MC4A 4M2BA 3GUEA 1QRMA 4EA9A 1G97A 4R36A 3FOQA 3FWWA 4M28A 3Q1XA 1HV9A 2OEGA 3DHOA 1SSMA 2V0LA 4KPXA 1HM0A 1HM9A 4HUSA 1YP2A 2Q4JA 2W0WA 3BFPA 3OTMA 1KK5A 4DCLA 3C8VA 2V0KA 3KWCA 3TK8A 1MR9A 2I5KA 4EGGA 3EEVA 3R5BA 2P2OA 2WLGA 4G3QA 4EABA 3VBMA 3BSSA 3I3XA 3KWEA 2JF2A 4AAWA 3TISA 5ADXU 5DEPA 1KK4A 3DJ4A 4AC3A 4N6BA 3TV0A 3HSQA 3ECTA 4EAAA 2ICXA 3SPTA 4H7OA 2IC7A 1MR7A 1KQAA 1SSQA 1Z90A 1HM8A 2IUAA 2OI7A 4E6TA 1KGTA 5DG3A 4R37A 3R3IA 1QRFA 3VBIA 1KGQA 4R7PA 4E1KA 1QREA 1S80A 1XATA 5L6SA 3R1WA 4G3SA 2OI6A 3FSYA 3VBNA 3VBKA 3F1XA 4J18A 4EA8A 3HJJA 4KNRA 4N27A 4KQLA 5F42A 4G87A 3P1BA 4KPZA 1QQ0A 4M9CA 5U2KA 1XHDA 3IXCA 5AFUV 2QIVX 3D8VA 4HCQA 3R0SA 4MYOA 3T57A 1TDTA 4N6AA 3BXYA 1QRLA 3FSXA 4M98A 4K6RA 3ST8A 4J09A 2NPOA 1V3WA 2V0HA 3D98A 5L6VA
chains in the Genus database with same CATH superfamily
3R5AA 3BSWA 1J2ZA 2WLDA 4EA7A 3V4EA 3BSYA 3NZ2A 3I3AA 4E79A 1KRVA 3GQ7A 4E75A 2QKXA 3VNPA 4E6UA 2GGQA 3GVDA 3GQ8A 3P47A 3CJ8A 2ICYA 3FSBA 3FTTA 1T3DA 4HZDA 1QRGA 5ADXV 2V0IA 5E3PA 3R5CA 3R5DA 3BRKX 1YP4A 2GGOA 2FKOA 3DK5A 3OH0A 1SSTA 3R3RA 4FCEA 2WLFA 3SRTA 3IGJA 3TIOA 3TWDA 4KNXA 2WLCA 5E3RA 1M8NA 3VBPA 5DEMA 2AQ9A 1KK6A 1THJA 2IU8A 3FSCA 4G3PA 3EG4A 3MQGA 1L0SA 1V67A 3EH0A 1FWYA 2TDTA 2OEFA 3FS8A 3JQYA 2VHEA 3R8YA 3VBJA 3OW5A 3MQHA 4EQYA 4ISXA 1G95A 2WLEA 1YP3A 1FXJA 3TDTA 2RIJA 1OCXA 3OTZA 1KRRA 2IU9A 2VD4A 3OU9A 3OUPA 4HZCA 2W0VA 4MZUA 1MRLA 2V0JA 3R2WA 4IHGA 1LXAA 3VBLA 3PMOA 3OH1A 4M2AA 1KHRA 4IHFA 2OI5A 4AA7A 3KWDA 4HURA 4IHHA 3OH3A 4N69A 4M99A 2QIAA 5AFUU 2JF3A 2XATA 3GOSA 4MFGA 3OH2A 1KRUA 5E3QA 3MC4A 4M2BA 1EWWA 3GUEA 1QRMA 4EA9A 1G97A 4R36A 3FOQA 3FWWA 4M28A 3Q1XA 1HV9A 2OEGA 3DHOA 1SSMA 2V0LA 4KPXA 1HM0A 1HM9A 4HUSA 1YP2A 2Q4JA 2W0WA 3BFPA 3OTMA 1KK5A 4DCLA 3SUCA 3C8VA 2V0KA 1N4IA 3KWCA 3TK8A 1MR9A 2I5KA 4EGGA 3EEVA 3R5BA 2P2OA 2WLGA 4G3QA 4EABA 3VBMA 3BSSA 3I3XA 3KWEA 2JF2A 4AAWA 3TISA 5ADXU 5DEPA 1KK4A 3DJ4A 4AC3A 4N6BA 3TV0A 3HSQA 3GQAA 3ECTA 3OH4A 2ICXA 4EAAA 3SPTA 4H7OA 2IC7A 1MR7A 1KQAA 1SSQA 1Z90A 1HM8A 2IUAA 2OI7A 4E6TA 1KGTA 5DG3A 4R37A 3R3IA 1QRFA 3VBIA 3GQ9A 1KGQA 4R7PA 4E1KA 1QREA 1S80A 1XATA 5L6SA 3R1WA 4G3SA 2OI6A 3FSYA 3VBNA 3VBKA 3F1XA 4J18A 4EA8A 3HJJA 4KNRA 4N27A 4KQLA 5F42A 4G87A 3P1BA 4KPZA 1QQ0A 4M9CA 5U2KA 1XHDA 3IXCA 5AFUV 2QIVX 3D8VA 4HCQA 3R0SA 4MYOA 3T57A 1TDTA 1Z2FA 4N6AA 3BXYA 1QRLA 3FSXA 3OGZA 4M98A 4K6RA 3ST8A 4J09A 2NPOA 1V3WA 2V0HA 3D98A 5L6VA
chains in the Genus database with same CATH topology
3R5AA 3BSWA 1J2ZA 2WLDA 4EA7A 3V4EA 3BSYA 3NZ2A 3I3AA 4E79A 1KRVA 4E75A 2QKXA 3VNPA 4E6UA 2GGQA 3GVDA 3P47A 3CJ8A 2ICYA 3FSBA 3FTTA 1T3DA 4HZDA 1QRGA 5ADXV 2V0IA 5E3PA 3R5CA 3R5DA 3BRKX 1YP4A 2GGOA 2FKOA 3DK5A 1SSTA 3R3RA 4FCEA 2WLFA 3SRTA 3IGJA 3TIOA 3TWDA 4KNXA 2WLCA 5E3RA 3VBPA 5DEMA 2IU8A 2AQ9A 1KK6A 1THJA 3FSCA 4G3PA 3EG4A 3MQGA 1V67A 3EH0A 1FWYA 2TDTA 2OEFA 3FS8A 3JQYA 2VHEA 3R8YA 3VBJA 3OW5A 3MQHA 4EQYA 4ISXA 1G95A 2WLEA 1YP3A 1FXJA 3TDTA 2RIJA 1OCXA 3OTZA 1KRRA 2IU9A 2VD4A 3OU9A 3OUPA 4HZCA 2W0VA 4MZUA 1MRLA 2V0JA 3R2WA 4IHGA 1LXAA 3VBLA 3PMOA 4M2AA 1KHRA 4IHFA 2OI5A 4AA7A 3KWDA 4HURA 4IHHA 4N69A 4M99A 2QIAA 5AFUU 2JF3A 2XATA 3GOSA 4MFGA 5E3QA 1KRUA 3MC4A 4M2BA 3GUEA 1QRMA 4EA9A 1G97A 4R36A 3FOQA 3FWWA 4M28A 3Q1XA 1HV9A 2OEGA 3DHOA 1SSMA 2V0LA 4KPXA 1HM0A 1HM9A 4HUSA 1YP2A 2Q4JA 2W0WA 3BFPA 3OTMA 1KK5A 4DCLA 3C8VA 2V0KA 3KWCA 3TK8A 1MR9A 2I5KA 4EGGA 3EEVA 3R5BA 2P2OA 2WLGA 4G3QA 4EABA 3VBMA 3BSSA 3I3XA 3KWEA 2JF2A 4AAWA 3TISA 5ADXU 5DEPA 1KK4A 3DJ4A 4AC3A 4N6BA 3TV0A 3HSQA 3ECTA 4EAAA 2ICXA 3SPTA 4H7OA 2IC7A 1MR7A 1KQAA 1SSQA 1Z90A 1HM8A 2IUAA 2OI7A 4E6TA 1KGTA 5DG3A 4R37A 3R3IA 1QRFA 3VBIA 1KGQA 4R7PA 4E1KA 1QREA 1S80A 1XATA 5L6SA 3R1WA 4G3SA 2OI6A 3FSYA 3VBNA 3VBKA 3F1XA 4J18A 4EA8A 3HJJA 4KNRA 4N27A 4KQLA 5F42A 4G87A 3P1BA 4KPZA 1QQ0A 4M9CA 5U2KA 1XHDA 3IXCA 5AFUV 2QIVX 3D8VA 4HCQA 3R0SA 4MYOA 3T57A 1TDTA 4N6AA 3BXYA 1QRLA 3FSXA 4M98A 4K6RA 3ST8A 4J09A 2NPOA 1V3WA 2V0HA 3D98A 5L6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5A A;  3BSW A;  1J2Z A;  2WLD A;  4EA7 A;  3V4E A;  3BSY A;  3NZ2 A;  3I3A A;  4E79 A;  1KRV A;  4E75 A;  2QKX A;  3VNP A;  4E6U A;  2GGQ A;  3GVD A;  3P47 A;  3CJ8 A;  2ICY A;  3FSB A;  3FTT A;  1T3D A;  4HZD A;  1QRG A;  5ADX V;  2V0I A;  5E3P A;  3R5C A;  3R5D A;  3BRK X;  1YP4 A;  2GGO A;  2FKO A;  3DK5 A;  1SST A;  3R3R A;  4FCE A;  2WLF A;  3SRT A;  3IGJ A;  3TIO A;  3TWD A;  4KNX A;  2WLC A;  5E3R A;  3VBP A;  5DEM A;  2IU8 A;  2AQ9 A;  1KK6 A;  1THJ A;  3FSC A;  4G3P A;  3EG4 A;  3MQG A;  1V67 A;  3EH0 A;  1FWY A;  2TDT A;  2OEF A;  3FS8 A;  3JQY A;  2VHE A;  3R8Y A;  3VBJ A;  3OW5 A;  3MQH A;  4EQY A;  4ISX A;  1G95 A;  2WLE A;  1YP3 A;  1FXJ A;  3TDT A;  2RIJ A;  1OCX A;  3OTZ A;  1KRR A;  2IU9 A;  2VD4 A;  3OU9 A;  3OUP A;  4HZC A;  2W0V A;  4MZU A;  1MRL A;  2V0J A;  3R2W A;  4IHG A;  1LXA A;  3VBL A;  3PMO A;  4M2A A;  1KHR A;  4IHF A;  2OI5 A;  4AA7 A;  3KWD A;  4HUR A;  4IHH A;  4N69 A;  4M99 A;  2QIA A;  5AFU U;  2JF3 A;  2XAT A;  3GOS A;  4MFG A;  5E3Q A;  1KRU A;  3MC4 A;  4M2B A;  3GUE A;  1QRM A;  4EA9 A;  1G97 A;  4R36 A;  3FOQ A;  3FWW A;  4M28 A;  3Q1X A;  1HV9 A;  2OEG A;  3DHO A;  1SSM A;  2V0L A;  4KPX A;  1HM0 A;  1HM9 A;  4HUS A;  1YP2 A;  2Q4J A;  2W0W A;  3BFP A;  3OTM A;  1KK5 A;  4DCL A;  3C8V A;  2V0K A;  3KWC A;  3TK8 A;  1MR9 A;  2I5K A;  4EGG A;  3EEV A;  3R5B A;  2P2O A;  2WLG A;  4G3Q A;  4EAB A;  3VBM A;  3BSS A;  3I3X A;  3KWE A;  2JF2 A;  4AAW A;  3TIS A;  5ADX U;  5DEP A;  1KK4 A;  3DJ4 A;  4AC3 A;  4N6B A;  3TV0 A;  3HSQ A;  3ECT A;  4EAA A;  2ICX A;  3SPT A;  4H7O A;  2IC7 A;  1MR7 A;  1KQA A;  1SSQ A;  1Z90 A;  1HM8 A;  2IUA A;  2OI7 A;  4E6T A;  1KGT A;  5DG3 A;  4R37 A;  3R3I A;  1QRF A;  3VBI A;  1KGQ A;  4R7P A;  4E1K A;  1QRE A;  1S80 A;  1XAT A;  5L6S A;  3R1W A;  4G3S A;  2OI6 A;  3FSY A;  3VBN A;  3VBK A;  3F1X A;  4J18 A;  4EA8 A;  3HJJ A;  4KNR A;  4N27 A;  4KQL A;  5F42 A;  4G87 A;  3P1B A;  4KPZ A;  1QQ0 A;  4M9C A;  5U2K A;  1XHD A;  3IXC A;  5AFU V;  2QIV X;  3D8V A;  4HCQ A;  3R0S A;  4MYO A;  3T57 A;  1TDT A;  4N6A A;  3BXY A;  1QRL A;  3FSX A;  4M98 A;  4K6R A;  3ST8 A;  4J09 A;  2NPO A;  1V3W A;  2V0H A;  3D98 A;  5L6V A; 
#chains in the Genus database with same CATH topology
 3R5A A;  3BSW A;  1J2Z A;  2WLD A;  4EA7 A;  3V4E A;  3BSY A;  3NZ2 A;  3I3A A;  4E79 A;  1KRV A;  3GQ7 A;  4E75 A;  2QKX A;  3VNP A;  4E6U A;  2GGQ A;  3GVD A;  3GQ8 A;  3P47 A;  3CJ8 A;  2ICY A;  3FSB A;  3FTT A;  1T3D A;  4HZD A;  1QRG A;  5ADX V;  2V0I A;  5E3P A;  3R5C A;  3R5D A;  3BRK X;  1YP4 A;  2GGO A;  2FKO A;  3DK5 A;  3OH0 A;  1SST A;  3R3R A;  4FCE A;  2WLF A;  3SRT A;  3IGJ A;  3TIO A;  3TWD A;  4KNX A;  2WLC A;  5E3R A;  1M8N A;  3VBP A;  5DEM A;  2AQ9 A;  1KK6 A;  1THJ A;  2IU8 A;  3FSC A;  4G3P A;  3EG4 A;  3MQG A;  1L0S A;  1V67 A;  3EH0 A;  1FWY A;  2TDT A;  2OEF A;  3FS8 A;  3JQY A;  2VHE A;  3R8Y A;  3VBJ A;  3OW5 A;  3MQH A;  4EQY A;  4ISX A;  1G95 A;  2WLE A;  1YP3 A;  1FXJ A;  3TDT A;  2RIJ A;  1OCX A;  3OTZ A;  1KRR A;  2IU9 A;  2VD4 A;  3OU9 A;  3OUP A;  4HZC A;  2W0V A;  4MZU A;  1MRL A;  2V0J A;  3R2W A;  4IHG A;  1LXA A;  3VBL A;  3PMO A;  3OH1 A;  4M2A A;  1KHR A;  4IHF A;  2OI5 A;  4AA7 A;  3KWD A;  4HUR A;  4IHH A;  3OH3 A;  4N69 A;  4M99 A;  2QIA A;  5AFU U;  2JF3 A;  2XAT A;  3GOS A;  4MFG A;  3OH2 A;  1KRU A;  5E3Q A;  3MC4 A;  4M2B A;  1EWW A;  3GUE A;  1QRM A;  4EA9 A;  1G97 A;  4R36 A;  3FOQ A;  3FWW A;  4M28 A;  3Q1X A;  1HV9 A;  2OEG A;  3DHO A;  1SSM A;  2V0L A;  4KPX A;  1HM0 A;  1HM9 A;  4HUS A;  1YP2 A;  2Q4J A;  2W0W A;  3BFP A;  3OTM A;  1KK5 A;  4DCL A;  3SUC A;  3C8V A;  2V0K A;  1N4I A;  3KWC A;  3TK8 A;  1MR9 A;  2I5K A;  4EGG A;  3EEV A;  3R5B A;  2P2O A;  2WLG A;  4G3Q A;  4EAB A;  3VBM A;  3BSS A;  3I3X A;  3KWE A;  2JF2 A;  4AAW A;  3TIS A;  5ADX U;  5DEP A;  1KK4 A;  3DJ4 A;  4AC3 A;  4N6B A;  3TV0 A;  3HSQ A;  3GQA A;  3ECT A;  3OH4 A;  2ICX A;  4EAA A;  3SPT A;  4H7O A;  2IC7 A;  1MR7 A;  1KQA A;  1SSQ A;  1Z90 A;  1HM8 A;  2IUA A;  2OI7 A;  4E6T A;  1KGT A;  5DG3 A;  4R37 A;  3R3I A;  1QRF A;  3VBI A;  3GQ9 A;  1KGQ A;  4R7P A;  4E1K A;  1QRE A;  1S80 A;  1XAT A;  5L6S A;  3R1W A;  4G3S A;  2OI6 A;  3FSY A;  3VBN A;  3VBK A;  3F1X A;  4J18 A;  4EA8 A;  3HJJ A;  4KNR A;  4N27 A;  4KQL A;  5F42 A;  4G87 A;  3P1B A;  4KPZ A;  1QQ0 A;  4M9C A;  5U2K A;  1XHD A;  3IXC A;  5AFU V;  2QIV X;  3D8V A;  4HCQ A;  3R0S A;  4MYO A;  3T57 A;  1TDT A;  1Z2F A;  4N6A A;  3BXY A;  1QRL A;  3FSX A;  3OGZ A;  4M98 A;  4K6R A;  3ST8 A;  4J09 A;  2NPO A;  1V3W A;  2V0H A;  3D98 A;  5L6V A; 
#chains in the Genus database with same CATH homology
 3R5A A;  3BSW A;  1J2Z A;  2WLD A;  4EA7 A;  3V4E A;  3BSY A;  3NZ2 A;  3I3A A;  4E79 A;  1KRV A;  4E75 A;  2QKX A;  3VNP A;  4E6U A;  2GGQ A;  3GVD A;  3P47 A;  3CJ8 A;  2ICY A;  3FSB A;  3FTT A;  1T3D A;  4HZD A;  1QRG A;  5ADX V;  2V0I A;  5E3P A;  3R5C A;  3R5D A;  3BRK X;  1YP4 A;  2GGO A;  2FKO A;  3DK5 A;  1SST A;  3R3R A;  4FCE A;  2WLF A;  3SRT A;  3IGJ A;  3TIO A;  3TWD A;  4KNX A;  2WLC A;  5E3R A;  3VBP A;  5DEM A;  2IU8 A;  2AQ9 A;  1KK6 A;  1THJ A;  3FSC A;  4G3P A;  3EG4 A;  3MQG A;  1V67 A;  3EH0 A;  1FWY A;  2TDT A;  2OEF A;  3FS8 A;  3JQY A;  2VHE A;  3R8Y A;  3VBJ A;  3OW5 A;  3MQH A;  4EQY A;  4ISX A;  1G95 A;  2WLE A;  1YP3 A;  1FXJ A;  3TDT A;  2RIJ A;  1OCX A;  3OTZ A;  1KRR A;  2IU9 A;  2VD4 A;  3OU9 A;  3OUP A;  4HZC A;  2W0V A;  4MZU A;  1MRL A;  2V0J A;  3R2W A;  4IHG A;  1LXA A;  3VBL A;  3PMO A;  4M2A A;  1KHR A;  4IHF A;  2OI5 A;  4AA7 A;  3KWD A;  4HUR A;  4IHH A;  4N69 A;  4M99 A;  2QIA A;  5AFU U;  2JF3 A;  2XAT A;  3GOS A;  4MFG A;  5E3Q A;  1KRU A;  3MC4 A;  4M2B A;  3GUE A;  1QRM A;  4EA9 A;  1G97 A;  4R36 A;  3FOQ A;  3FWW A;  4M28 A;  3Q1X A;  1HV9 A;  2OEG A;  3DHO A;  1SSM A;  2V0L A;  4KPX A;  1HM0 A;  1HM9 A;  4HUS A;  1YP2 A;  2Q4J A;  2W0W A;  3BFP A;  3OTM A;  1KK5 A;  4DCL A;  3C8V A;  2V0K A;  3KWC A;  3TK8 A;  1MR9 A;  2I5K A;  4EGG A;  3EEV A;  3R5B A;  2P2O A;  2WLG A;  4G3Q A;  4EAB A;  3VBM A;  3BSS A;  3I3X A;  3KWE A;  2JF2 A;  4AAW A;  3TIS A;  5ADX U;  5DEP A;  1KK4 A;  3DJ4 A;  4AC3 A;  4N6B A;  3TV0 A;  3HSQ A;  3ECT A;  4EAA A;  2ICX A;  3SPT A;  4H7O A;  2IC7 A;  1MR7 A;  1KQA A;  1SSQ A;  1Z90 A;  1HM8 A;  2IUA A;  2OI7 A;  4E6T A;  1KGT A;  5DG3 A;  4R37 A;  3R3I A;  1QRF A;  3VBI A;  1KGQ A;  4R7P A;  4E1K A;  1QRE A;  1S80 A;  1XAT A;  5L6S A;  3R1W A;  4G3S A;  2OI6 A;  3FSY A;  3VBN A;  3VBK A;  3F1X A;  4J18 A;  4EA8 A;  3HJJ A;  4KNR A;  4N27 A;  4KQL A;  5F42 A;  4G87 A;  3P1B A;  4KPZ A;  1QQ0 A;  4M9C A;  5U2K A;  1XHD A;  3IXC A;  5AFU V;  2QIV X;  3D8V A;  4HCQ A;  3R0S A;  4MYO A;  3T57 A;  1TDT A;  4N6A A;  3BXY A;  1QRL A;  3FSX A;  4M98 A;  4K6R A;  3ST8 A;  4J09 A;  2NPO A;  1V3W A;  2V0H A;  3D98 A;  5L6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...