3TF3A

Crystal structure of metal-free human arginase i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
314
structure length
314
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Crystal structures of complexes with cobalt-reconstituted human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3tf3A00
4MYFA 3TH7A 1T4PA 4IE1A 3PZLA 3THJA 4RHJA 1P8OA 1XFKA 3LHLA 1R1OA 2EF5A 1WVBA 3E8ZA 4IU0A 3SKKA 4IXUA 4Q3SA 4FCKA 4IE2A 1T4RA 1TA1A 3SL1A 4GSZA 1T5GA 4Q3UA 1TBHA 3M1RA 3MFWA 3KV2A 1HQFA 4HXQA 4Q40A 2A0MA 1HQXA 3SJTA 1WOIA 3NIQA 3MFVA 4Q3RA 1HQGA 1T5FA 3SL0A 4CEVA 2CEVA 1WOHA 1GQ6A 4ITYA 4RHMA 3MJLA 2RLAA 1P8RA 4FCIA 1P8SA 1CEVA 1WOGA 4IU4A 4HZEA 4RHIA 5RLAA 4RLAA 2PHOA 4IE3A 3NIOA 4Q3VA 3F80A 1HQ5A 4IXVA 1HQHA 4G3HA 2EF4A 3THEA 2ZAVA 4IU1A 5CEVA 3NIPA 1P8MA 4DZ4A 3TF3A 1P8NA 4Q3PA 1D3VA 1GQ7A 1ZPGA 4MYLA 5HJ9A 2PLLA 1T4TA 4IU5A 4Q3QA 2PHAA 1RLAA 1PQ3A 1P8PA 4Q42A 4MXRA 3E6VA 1WVAA 4RHLA 1T4SA 3GN0A 3MMRA 3CEVA 2EIVA 1TBLA 3E8QA 3GMZA 3LP7A 4RHQA 4RHKA 3RLAA 4I06A 4MYKA 1TBJA 3E9BA 2AEBA 4Q3TA 4Q41A 5HJAA 3THHA 4Q3RC 4GWDA 4HWWA 3DJ8A 1P8QA 1ZPEA 4GSMA 4GSVA 3LP4A 4MYNA 3E6KA 4GWCA
chains in the Genus database with same CATH superfamily
4MYFA 3EZTA 3TH7A 1T4PA 4LXZA 4IE1A 5EFBD 3PZLA 5LI3A 3Q9FA 3F06A 3THJA 4RHJA 4QA1A 4ZUQA 4ZUMA 1P8OA 1XFKA 5G11A 5BWZA 3LHLA 1R1OA 2VQOA 2EF5A 1WVBA 3E8ZA 5G1AA 4IU0A 3SKKA 2VQWG 4IXUA 4Q3SA 4FCKA 4IE2A 5IWGA 5G13A 1T4RA 1TA1A 4RN0A 5EENA 3RQDA 3SL1A 4GSZA 1T5GA 4Q3UA 3SFFA 5A2SA 1TBHA 1C3SA 2VQVA 3M1RA 3MFWA 3MENA 3KV2A 3Q9EA 3F07A 1HQFA 5EFHA 4HXQA 2V5XA 4Q40A 4QA5A 3EW8A 2A0MA 5G1BA 1HQXA 3MZ4A 4QA0A 3SJTA 1WOIA 3NIQA 3MZ7A 3MFVA 5D1DA 4Q3RA 1HQGA 1T5FA 3Q9CA 3SL0A 5G12A 4CEVA 2CEVA 1WOHA 4ZUPA 1GQ6A 2V5WA 4ITYA 1C3RA 1ZZ0A 4ZUOA 3MAXA 5EFNA 5EEIA 5IX0A 5DC6A 4RHMA 3MJLA 2RLAA 1P8RA 4FCIA 1C3PA 3C0ZA 3EWFA 1P8SA 1CEVA 1WOGA 4IU4A 5D1CA 5EFGA 4RN1A 4HZEA 4BZ8A 4RHIA 5RLAA 1T64A 4QA3A 4RLAA 5G1CA 2PHOA 4IE3A 3NIOA 4Q3VA 5G0GA 4BZ5A 4BZ6A 5THVA 3F80A 1HQ5A 4IXVA 5EFKB 1HQHA 4G3HA 4QA4A 4CQFA 5G0HA 5G0JA 2EF4A 5EEKA 3THEA 3C10A 2ZAVA 4IU1A 4RN2A 3NIPA 5EF8A 5CEVA 1P8MA 4DZ4A 4ZUNA 1VKGA 2VQQA 1P8NA 3TF3A 4Q3PA 1D3VA 1GQ7A 1ZPGA 3F0RA 4LY1A 3ZNSA 3EZPA 5THSA 1T69A 4QA2A 5EEFA 4MYLA 5HJ9A 2PLLA 1T4TA 5DC7A 5EF7A 4IU5A 5G0XA 5THUA 5G3WA 2GH6A 4CBYA 5G17A 4Q3QA 3MZ3A 2PHAA 5DC5A 1RLAA 3ZNRA 1ZZ3A 4A69A 1PQ3A 5ICNB 4QA6A 1P8PA 5EFJD 4Q42A 4MXRA 3E6VA 1ZZ1A 5THTA 1WVAA 4BZ7A 4BKXB 1T67A 1T4SA 3GN0A 4RHLA 3MZ6A 3MMRA 3CEVA 5FCWA 2EIVA 1TBLA 2VQJA 3E8QA 3GMZA 3LP7A 5EEMA 4ZURA 3SFHA 4QA7A 4BZ9A 4RHQA 2VCGA 3C0YA 4RHKA 3Q9BA 3RLAA 4I06A 4MYKA 1TBJA 3E9BA 2AEBA 4Q3TA 5G0IA 4Q41A 5HJAA 3THHA 4Q3RC 5DC8A 5JI5A 4GWDA 4HWWA 3DJ8A 1P8QA 1W22A 1ZPEA 5D1BA 4GSMA 4GSVA 3LP4A 5FUEA 4MYNA 3E6KA 5G0YA 4CBTA 4GWCA 5G10A 2VQMA
chains in the Genus database with same CATH topology
4MYFA 3TH7A 1T4PA 4IE1A 3PZLA 3THJA 4RHJA 1P8OA 1XFKA 3LHLA 1R1OA 2EF5A 1WVBA 3E8ZA 4IU0A 3SKKA 4IXUA 4Q3SA 4FCKA 4IE2A 1T4RA 1TA1A 3SL1A 4GSZA 1T5GA 4Q3UA 1TBHA 3M1RA 3MFWA 3KV2A 1HQFA 4HXQA 4Q40A 2A0MA 1HQXA 3SJTA 1WOIA 3NIQA 3MFVA 4Q3RA 1HQGA 1T5FA 3SL0A 4CEVA 2CEVA 1WOHA 1GQ6A 4ITYA 4RHMA 3MJLA 2RLAA 1P8RA 4FCIA 1P8SA 1CEVA 1WOGA 4IU4A 4HZEA 4RHIA 5RLAA 4RLAA 2PHOA 4IE3A 3NIOA 4Q3VA 3F80A 1HQ5A 4IXVA 1HQHA 4G3HA 2EF4A 3THEA 2ZAVA 4IU1A 5CEVA 3NIPA 1P8MA 4DZ4A 3TF3A 1P8NA 4Q3PA 1D3VA 1GQ7A 1ZPGA 4MYLA 5HJ9A 2PLLA 1T4TA 4IU5A 4Q3QA 2PHAA 1RLAA 1PQ3A 1P8PA 4Q42A 4MXRA 3E6VA 1WVAA 4RHLA 1T4SA 3GN0A 3MMRA 3CEVA 2EIVA 1TBLA 3E8QA 3GMZA 3LP7A 4RHQA 4RHKA 3RLAA 4I06A 4MYKA 1TBJA 3E9BA 2AEBA 4Q3TA 4Q41A 5HJAA 3THHA 4Q3RC 4GWDA 4HWWA 3DJ8A 1P8QA 1ZPEA 4GSMA 4GSVA 3LP4A 4MYNA 3E6KA 4GWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYF A;  3TH7 A;  1T4P A;  4IE1 A;  3PZL A;  3THJ A;  4RHJ A;  1P8O A;  1XFK A;  3LHL A;  1R1O A;  2EF5 A;  1WVB A;  3E8Z A;  4IU0 A;  3SKK A;  4IXU A;  4Q3S A;  4FCK A;  4IE2 A;  1T4R A;  1TA1 A;  3SL1 A;  4GSZ A;  1T5G A;  4Q3U A;  1TBH A;  3M1R A;  3MFW A;  3KV2 A;  1HQF A;  4HXQ A;  4Q40 A;  2A0M A;  1HQX A;  3SJT A;  1WOI A;  3NIQ A;  3MFV A;  4Q3R A;  1HQG A;  1T5F A;  3SL0 A;  4CEV A;  2CEV A;  1WOH A;  1GQ6 A;  4ITY A;  4RHM A;  3MJL A;  2RLA A;  1P8R A;  4FCI A;  1P8S A;  1CEV A;  1WOG A;  4IU4 A;  4HZE A;  4RHI A;  5RLA A;  4RLA A;  2PHO A;  4IE3 A;  3NIO A;  4Q3V A;  3F80 A;  1HQ5 A;  4IXV A;  1HQH A;  4G3H A;  2EF4 A;  3THE A;  2ZAV A;  4IU1 A;  5CEV A;  3NIP A;  1P8M A;  4DZ4 A;  3TF3 A;  1P8N A;  4Q3P A;  1D3V A;  1GQ7 A;  1ZPG A;  4MYL A;  5HJ9 A;  2PLL A;  1T4T A;  4IU5 A;  4Q3Q A;  2PHA A;  1RLA A;  1PQ3 A;  1P8P A;  4Q42 A;  4MXR A;  3E6V A;  1WVA A;  4RHL A;  1T4S A;  3GN0 A;  3MMR A;  3CEV A;  2EIV A;  1TBL A;  3E8Q A;  3GMZ A;  3LP7 A;  4RHQ A;  4RHK A;  3RLA A;  4I06 A;  4MYK A;  1TBJ A;  3E9B A;  2AEB A;  4Q3T A;  4Q41 A;  5HJA A;  3THH A;  4Q3R C;  4GWD A;  4HWW A;  3DJ8 A;  1P8Q A;  1ZPE A;  4GSM A;  4GSV A;  3LP4 A;  4MYN A;  3E6K A;  4GWC A; 
#chains in the Genus database with same CATH topology
 4MYF A;  3EZT A;  3TH7 A;  1T4P A;  4LXZ A;  4IE1 A;  5EFB D;  3PZL A;  5LI3 A;  3Q9F A;  3F06 A;  3THJ A;  4RHJ A;  4QA1 A;  4ZUQ A;  4ZUM A;  1P8O A;  1XFK A;  5G11 A;  5BWZ A;  3LHL A;  1R1O A;  2VQO A;  2EF5 A;  1WVB A;  3E8Z A;  5G1A A;  4IU0 A;  3SKK A;  2VQW G;  4IXU A;  4Q3S A;  4FCK A;  4IE2 A;  5IWG A;  5G13 A;  1T4R A;  1TA1 A;  4RN0 A;  5EEN A;  3RQD A;  3SL1 A;  4GSZ A;  1T5G A;  4Q3U A;  3SFF A;  5A2S A;  1TBH A;  1C3S A;  2VQV A;  3M1R A;  3MFW A;  3MEN A;  3KV2 A;  3Q9E A;  3F07 A;  1HQF A;  5EFH A;  4HXQ A;  2V5X A;  4Q40 A;  4QA5 A;  3EW8 A;  2A0M A;  5G1B A;  1HQX A;  3MZ4 A;  4QA0 A;  3SJT A;  1WOI A;  3NIQ A;  3MZ7 A;  3MFV A;  5D1D A;  4Q3R A;  1HQG A;  1T5F A;  3Q9C A;  3SL0 A;  5G12 A;  4CEV A;  2CEV A;  1WOH A;  4ZUP A;  1GQ6 A;  2V5W A;  4ITY A;  1C3R A;  1ZZ0 A;  4ZUO A;  3MAX A;  5EFN A;  5EEI A;  5IX0 A;  5DC6 A;  4RHM A;  3MJL A;  2RLA A;  1P8R A;  4FCI A;  1C3P A;  3C0Z A;  3EWF A;  1P8S A;  1CEV A;  1WOG A;  4IU4 A;  5D1C A;  5EFG A;  4RN1 A;  4HZE A;  4BZ8 A;  4RHI A;  5RLA A;  1T64 A;  4QA3 A;  4RLA A;  5G1C A;  2PHO A;  4IE3 A;  3NIO A;  4Q3V A;  5G0G A;  4BZ5 A;  4BZ6 A;  5THV A;  3F80 A;  1HQ5 A;  4IXV A;  5EFK B;  1HQH A;  4G3H A;  4QA4 A;  4CQF A;  5G0H A;  5G0J A;  2EF4 A;  5EEK A;  3THE A;  3C10 A;  2ZAV A;  4IU1 A;  4RN2 A;  3NIP A;  5EF8 A;  5CEV A;  1P8M A;  4DZ4 A;  4ZUN A;  1VKG A;  2VQQ A;  1P8N A;  3TF3 A;  4Q3P A;  1D3V A;  1GQ7 A;  1ZPG A;  3F0R A;  4LY1 A;  3ZNS A;  3EZP A;  5THS A;  1T69 A;  4QA2 A;  5EEF A;  4MYL A;  5HJ9 A;  2PLL A;  1T4T A;  5DC7 A;  5EF7 A;  4IU5 A;  5G0X A;  5THU A;  5G3W A;  2GH6 A;  4CBY A;  5G17 A;  4Q3Q A;  3MZ3 A;  2PHA A;  5DC5 A;  1RLA A;  3ZNR A;  1ZZ3 A;  4A69 A;  1PQ3 A;  5ICN B;  4QA6 A;  1P8P A;  5EFJ D;  4Q42 A;  4MXR A;  3E6V A;  1ZZ1 A;  5THT A;  1WVA A;  4BZ7 A;  4BKX B;  1T67 A;  1T4S A;  3GN0 A;  4RHL A;  3MZ6 A;  3MMR A;  3CEV A;  5FCW A;  2EIV A;  1TBL A;  2VQJ A;  3E8Q A;  3GMZ A;  3LP7 A;  5EEM A;  4ZUR A;  3SFH A;  4QA7 A;  4BZ9 A;  4RHQ A;  2VCG A;  3C0Y A;  4RHK A;  3Q9B A;  3RLA A;  4I06 A;  4MYK A;  1TBJ A;  3E9B A;  2AEB A;  4Q3T A;  5G0I A;  4Q41 A;  5HJA A;  3THH A;  4Q3R C;  5DC8 A;  5JI5 A;  4GWD A;  4HWW A;  3DJ8 A;  1P8Q A;  1W22 A;  1ZPE A;  5D1B A;  4GSM A;  4GSV A;  3LP4 A;  5FUE A;  4MYN A;  3E6K A;  5G0Y A;  4CBT A;  4GWC A;  5G10 A;  2VQM A; 
#chains in the Genus database with same CATH homology
 4MYF A;  3TH7 A;  1T4P A;  4IE1 A;  3PZL A;  3THJ A;  4RHJ A;  1P8O A;  1XFK A;  3LHL A;  1R1O A;  2EF5 A;  1WVB A;  3E8Z A;  4IU0 A;  3SKK A;  4IXU A;  4Q3S A;  4FCK A;  4IE2 A;  1T4R A;  1TA1 A;  3SL1 A;  4GSZ A;  1T5G A;  4Q3U A;  1TBH A;  3M1R A;  3MFW A;  3KV2 A;  1HQF A;  4HXQ A;  4Q40 A;  2A0M A;  1HQX A;  3SJT A;  1WOI A;  3NIQ A;  3MFV A;  4Q3R A;  1HQG A;  1T5F A;  3SL0 A;  4CEV A;  2CEV A;  1WOH A;  1GQ6 A;  4ITY A;  4RHM A;  3MJL A;  2RLA A;  1P8R A;  4FCI A;  1P8S A;  1CEV A;  1WOG A;  4IU4 A;  4HZE A;  4RHI A;  5RLA A;  4RLA A;  2PHO A;  4IE3 A;  3NIO A;  4Q3V A;  3F80 A;  1HQ5 A;  4IXV A;  1HQH A;  4G3H A;  2EF4 A;  3THE A;  2ZAV A;  4IU1 A;  5CEV A;  3NIP A;  1P8M A;  4DZ4 A;  3TF3 A;  1P8N A;  4Q3P A;  1D3V A;  1GQ7 A;  1ZPG A;  4MYL A;  5HJ9 A;  2PLL A;  1T4T A;  4IU5 A;  4Q3Q A;  2PHA A;  1RLA A;  1PQ3 A;  1P8P A;  4Q42 A;  4MXR A;  3E6V A;  1WVA A;  4RHL A;  1T4S A;  3GN0 A;  3MMR A;  3CEV A;  2EIV A;  1TBL A;  3E8Q A;  3GMZ A;  3LP7 A;  4RHQ A;  4RHK A;  3RLA A;  4I06 A;  4MYK A;  1TBJ A;  3E9B A;  2AEB A;  4Q3T A;  4Q41 A;  5HJA A;  3THH A;  4Q3R C;  4GWD A;  4HWW A;  3DJ8 A;  1P8Q A;  1ZPE A;  4GSM A;  4GSV A;  3LP4 A;  4MYN A;  3E6K A;  4GWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...