3TGII

Wild-type rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Comparison of Anionic and Cationic Trypsinogens: The Anionic Activation Domain is More Flexible in Solution and Differs in its Mode of Bpti Binding in the Crystal Structure
pubmed rcsb
molecule tags Complex (serine protease/inhibitor)
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1998-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 3tgiI00
2FI5I 1BIKA 2UUYB 1TCPA 1FAKI 3OTJI 3P92E 2KNTA 1CBWD 1TFXC 2KAII 1AALA 2J6DA 3BTMI 4ISLB 1BTHP 1YLDB 2DDIA 2FTLI 1FANA 1BRBI 4Y0ZI 1T8NB 1T8LB 3P95E 1D0DB 1JV9A 3TGII 1F7ZI 3FP7J 3LDMA 3LDIA 3AUCA 3GYMI 4DTGK 4BNRI 1DTXA 2PTCI 4DG4C 1ZR0B 1P2JI 3AUIA 3BTFI 1CO7I 2ZJXA 1BPIA 2FI4I 1BZ5A 1UUBA 1FY8I 3AUHA 8PTIA 3BTQI 1BTIA 1JC6A 4Y10I 2ODYE 1JV8A 3L33E 2M01A 2ZVXA 1P2KI 1ADZA 1K6UA 1TOCR 2LFKA 3AUEA 3BTTI 9PTIA 1F5RI 1KTHA 3FP6I 3TGJI 3AUGA 1P2MB 3BTEI 5JB5A 2UUXA 2IJOI 2JOTA 1EJMB 2FI3I 1OA65 1T8OB 7PTIA 3AUDA 1EAWB 4ISNB 1DENA 4PTIA 4ISOB 1P2II 3BTHI 4NTWB 1KNTA 1B0CA 5PTIA 2LFLA 1YKTB 1TAWB 1PITA 1LD5A 1NAGA 1T8MB 1Y62A 2DDJA 3UOUB 6PTIA 2HEXA 3BYBA 4U32X 5JB4A 2W8XA 1BRCI 4BD9B 1YLCB 1IRHA 2TGPI 3OFWA 2R9PE 3BTKI 3U1JE 3UIRC 3D65I 1CA0D 3BTGI 3TPII 4WWYC 5JB7A 1UUAA 5C67C 1P2OB 2M99A 3T62D 4NTXB 1DTKA 4Y0YI 3FP8I 1P2QB 2KCRA 1AAPA 1MTND 4WXVC 4NTYB 1KIGI 3BTDI 3AUBA 2FTMB 1QLQA 1YC0I 1LD6A 3M7QB 4BQDA 3CI7A 3BTWI 1BZXI 1ZJDB 1BHCA 1TAPA 1DEMA 3TGKI 1T7CB 3WNYA 1D0DA 1P2NB 2RA3C 1BPTA 3L3TE 3LDJA 4TPII 4Y11I 1SHPA 1KUNA 1OA55 1BF0A 1G6XA 1BUNB 2CA7A 4U30W 5JB6A 1TPAI 2TPII
chains in the Genus database with same CATH superfamily
2FI5I 1BIKA 2UUYB 1TCPA 1FAKI 3OTJI 3P92E 2KNTA 1CBWD 1TFXC 2KAII 1AALA 2J6DA 3BTMI 4ISLB 1BTHP 1YLDB 2DDIA 2FTLI 1FANA 1BRBI 4Y0ZI 1T8NB 1T8LB 3P95E 1D0DB 1JV9A 3TGII 1F7ZI 3FP7J 3LDMA 3LDIA 3AUCA 3GYMI 4DTGK 4BNRI 1DTXA 2PTCI 4DG4C 1ZR0B 1P2JI 3AUIA 3BTFI 1CO7I 2ZJXA 1BPIA 2FI4I 1BZ5A 1UUBA 1FY8I 3AUHA 8PTIA 3BTQI 1BTIA 1JC6A 4Y10I 2ODYE 1JV8A 3L33E 2M01A 2ZVXA 1P2KI 1ADZA 1K6UA 1TOCR 2LFKA 3AUEA 3BTTI 9PTIA 1F5RI 1KTHA 3FP6I 3TGJI 3AUGA 1P2MB 3BTEI 5JB5A 2UUXA 2IJOI 2JOTA 1EJMB 2FI3I 1OA65 1T8OB 7PTIA 3AUDA 1EAWB 4ISNB 1DENA 4PTIA 4ISOB 1P2II 3BTHI 4NTWB 1KNTA 1B0CA 5PTIA 2LFLA 1YKTB 1TAWB 1PITA 1LD5A 1NAGA 1T8MB 1Y62A 2DDJA 3UOUB 6PTIA 2HEXA 3BYBA 4U32X 5JB4A 2W8XA 1BRCI 4BD9B 1YLCB 1IRHA 2TGPI 3OFWA 2R9PE 3BTKI 3U1JE 3UIRC 3D65I 1CA0D 3BTGI 3TPII 4WWYC 5JB7A 1UUAA 5C67C 1P2OB 2M99A 3T62D 4NTXB 1DTKA 4Y0YI 3FP8I 1P2QB 2KCRA 1AAPA 1MTND 4WXVC 4NTYB 1KIGI 3BTDI 3AUBA 2FTMB 1QLQA 1YC0I 1LD6A 3M7QB 4BQDA 3CI7A 3BTWI 1BZXI 1ZJDB 1BHCA 1TAPA 1DEMA 3TGKI 1T7CB 3WNYA 1D0DA 1P2NB 2RA3C 1BPTA 3L3TE 3LDJA 4TPII 4Y11I 1SHPA 1KUNA 1OA55 1BF0A 1G6XA 1BUNB 2CA7A 4U30W 5JB6A 1TPAI 2TPII
chains in the Genus database with same CATH topology
2FI5I 1BIKA 2UUYB 1TCPA 1FAKI 3OTJI 3P92E 2KNTA 1CBWD 1TFXC 2KAII 1AALA 2J6DA 3BTMI 4ISLB 1BTHP 1YLDB 2DDIA 2FTLI 1FANA 1BRBI 4Y0ZI 1T8NB 1T8LB 3P95E 1D0DB 1JV9A 3TGII 1F7ZI 3FP7J 3LDMA 3LDIA 3AUCA 3GYMI 4DTGK 4BNRI 1DTXA 2PTCI 4DG4C 1ZR0B 1P2JI 3AUIA 3BTFI 1CO7I 2ZJXA 1BPIA 2FI4I 1BZ5A 1UUBA 1FY8I 3AUHA 8PTIA 3BTQI 1BTIA 1JC6A 4Y10I 2ODYE 1JV8A 3L33E 2M01A 2ZVXA 1P2KI 1ADZA 1K6UA 1TOCR 2LFKA 3AUEA 3BTTI 9PTIA 1F5RI 1KTHA 3FP6I 3TGJI 3AUGA 1P2MB 3BTEI 5JB5A 2UUXA 2IJOI 2JOTA 1EJMB 2FI3I 1OA65 1T8OB 7PTIA 3AUDA 1EAWB 4ISNB 1DENA 4PTIA 4ISOB 1P2II 3BTHI 4NTWB 1KNTA 1B0CA 5PTIA 2LFLA 1YKTB 1TAWB 1PITA 1LD5A 1NAGA 1T8MB 1Y62A 2DDJA 3UOUB 6PTIA 2HEXA 3BYBA 4U32X 5JB4A 2W8XA 1BRCI 4BD9B 1YLCB 1IRHA 2TGPI 3OFWA 2R9PE 3BTKI 3U1JE 3UIRC 3D65I 1CA0D 3BTGI 3TPII 4WWYC 5JB7A 1UUAA 5C67C 1P2OB 2M99A 3T62D 4NTXB 1DTKA 4Y0YI 3FP8I 1P2QB 2KCRA 1AAPA 1MTND 4WXVC 4NTYB 1KIGI 3BTDI 3AUBA 2FTMB 1QLQA 1YC0I 1LD6A 3M7QB 4BQDA 3CI7A 3BTWI 1BZXI 1ZJDB 1BHCA 1TAPA 1DEMA 3TGKI 1T7CB 3WNYA 1D0DA 1P2NB 2RA3C 1BPTA 3L3TE 3LDJA 4TPII 4Y11I 1SHPA 1KUNA 1OA55 1BF0A 1G6XA 1BUNB 2CA7A 4U30W 5JB6A 1TPAI 2TPII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FI5 I;  1BIK A;  2UUY B;  1TCP A;  1FAK I;  3OTJ I;  3P92 E;  2KNT A;  1CBW D;  1TFX C;  2KAI I;  1AAL A;  2J6D A;  3BTM I;  4ISL B;  1BTH P;  1YLD B;  2DDI A;  2FTL I;  1FAN A;  1BRB I;  4Y0Z I;  1T8N B;  1T8L B;  3P95 E;  1D0D B;  1JV9 A;  3TGI I;  1F7Z I;  3FP7 J;  3LDM A;  3LDI A;  3AUC A;  3GYM I;  4DTG K;  4BNR I;  1DTX A;  2PTC I;  4DG4 C;  1ZR0 B;  1P2J I;  3AUI A;  3BTF I;  1CO7 I;  2ZJX A;  1BPI A;  2FI4 I;  1BZ5 A;  1UUB A;  1FY8 I;  3AUH A;  8PTI A;  3BTQ I;  1BTI A;  1JC6 A;  4Y10 I;  2ODY E;  1JV8 A;  3L33 E;  2M01 A;  2ZVX A;  1P2K I;  1ADZ A;  1K6U A;  1TOC R;  2LFK A;  3AUE A;  3BTT I;  9PTI A;  1F5R I;  1KTH A;  3FP6 I;  3TGJ I;  3AUG A;  1P2M B;  3BTE I;  5JB5 A;  2UUX A;  2IJO I;  2JOT A;  1EJM B;  2FI3 I;  1OA6 5;  1T8O B;  7PTI A;  3AUD A;  1EAW B;  4ISN B;  1DEN A;  4PTI A;  4ISO B;  1P2I I;  3BTH I;  4NTW B;  1KNT A;  1B0C A;  5PTI A;  2LFL A;  1YKT B;  1TAW B;  1PIT A;  1LD5 A;  1NAG A;  1T8M B;  1Y62 A;  2DDJ A;  3UOU B;  6PTI A;  2HEX A;  3BYB A;  4U32 X;  5JB4 A;  2W8X A;  1BRC I;  4BD9 B;  1YLC B;  1IRH A;  2TGP I;  3OFW A;  2R9P E;  3BTK I;  3U1J E;  3UIR C;  3D65 I;  1CA0 D;  3BTG I;  3TPI I;  4WWY C;  5JB7 A;  1UUA A;  5C67 C;  1P2O B;  2M99 A;  3T62 D;  4NTX B;  1DTK A;  4Y0Y I;  3FP8 I;  1P2Q B;  2KCR A;  1AAP A;  1MTN D;  4WXV C;  4NTY B;  1KIG I;  3BTD I;  3AUB A;  2FTM B;  1QLQ A;  1YC0 I;  1LD6 A;  3M7Q B;  4BQD A;  3CI7 A;  3BTW I;  1BZX I;  1ZJD B;  1BHC A;  1TAP A;  1DEM A;  3TGK I;  1T7C B;  3WNY A;  1D0D A;  1P2N B;  2RA3 C;  1BPT A;  3L3T E;  3LDJ A;  4TPI I;  4Y11 I;  1SHP A;  1KUN A;  1OA5 5;  1BF0 A;  1G6X A;  1BUN B;  2CA7 A;  4U30 W;  5JB6 A;  1TPA I;  2TPI I; 
#chains in the Genus database with same CATH topology
 2FI5 I;  1BIK A;  2UUY B;  1TCP A;  1FAK I;  3OTJ I;  3P92 E;  2KNT A;  1CBW D;  1TFX C;  2KAI I;  1AAL A;  2J6D A;  3BTM I;  4ISL B;  1BTH P;  1YLD B;  2DDI A;  2FTL I;  1FAN A;  1BRB I;  4Y0Z I;  1T8N B;  1T8L B;  3P95 E;  1D0D B;  1JV9 A;  3TGI I;  1F7Z I;  3FP7 J;  3LDM A;  3LDI A;  3AUC A;  3GYM I;  4DTG K;  4BNR I;  1DTX A;  2PTC I;  4DG4 C;  1ZR0 B;  1P2J I;  3AUI A;  3BTF I;  1CO7 I;  2ZJX A;  1BPI A;  2FI4 I;  1BZ5 A;  1UUB A;  1FY8 I;  3AUH A;  8PTI A;  3BTQ I;  1BTI A;  1JC6 A;  4Y10 I;  2ODY E;  1JV8 A;  3L33 E;  2M01 A;  2ZVX A;  1P2K I;  1ADZ A;  1K6U A;  1TOC R;  2LFK A;  3AUE A;  3BTT I;  9PTI A;  1F5R I;  1KTH A;  3FP6 I;  3TGJ I;  3AUG A;  1P2M B;  3BTE I;  5JB5 A;  2UUX A;  2IJO I;  2JOT A;  1EJM B;  2FI3 I;  1OA6 5;  1T8O B;  7PTI A;  3AUD A;  1EAW B;  4ISN B;  1DEN A;  4PTI A;  4ISO B;  1P2I I;  3BTH I;  4NTW B;  1KNT A;  1B0C A;  5PTI A;  2LFL A;  1YKT B;  1TAW B;  1PIT A;  1LD5 A;  1NAG A;  1T8M B;  1Y62 A;  2DDJ A;  3UOU B;  6PTI A;  2HEX A;  3BYB A;  4U32 X;  5JB4 A;  2W8X A;  1BRC I;  4BD9 B;  1YLC B;  1IRH A;  2TGP I;  3OFW A;  2R9P E;  3BTK I;  3U1J E;  3UIR C;  3D65 I;  1CA0 D;  3BTG I;  3TPI I;  4WWY C;  5JB7 A;  1UUA A;  5C67 C;  1P2O B;  2M99 A;  3T62 D;  4NTX B;  1DTK A;  4Y0Y I;  3FP8 I;  1P2Q B;  2KCR A;  1AAP A;  1MTN D;  4WXV C;  4NTY B;  1KIG I;  3BTD I;  3AUB A;  2FTM B;  1QLQ A;  1YC0 I;  1LD6 A;  3M7Q B;  4BQD A;  3CI7 A;  3BTW I;  1BZX I;  1ZJD B;  1BHC A;  1TAP A;  1DEM A;  3TGK I;  1T7C B;  3WNY A;  1D0D A;  1P2N B;  2RA3 C;  1BPT A;  3L3T E;  3LDJ A;  4TPI I;  4Y11 I;  1SHP A;  1KUN A;  1OA5 5;  1BF0 A;  1G6X A;  1BUN B;  2CA7 A;  4U30 W;  5JB6 A;  1TPA I;  2TPI I; 
#chains in the Genus database with same CATH homology
 2FI5 I;  1BIK A;  2UUY B;  1TCP A;  1FAK I;  3OTJ I;  3P92 E;  2KNT A;  1CBW D;  1TFX C;  2KAI I;  1AAL A;  2J6D A;  3BTM I;  4ISL B;  1BTH P;  1YLD B;  2DDI A;  2FTL I;  1FAN A;  1BRB I;  4Y0Z I;  1T8N B;  1T8L B;  3P95 E;  1D0D B;  1JV9 A;  3TGI I;  1F7Z I;  3FP7 J;  3LDM A;  3LDI A;  3AUC A;  3GYM I;  4DTG K;  4BNR I;  1DTX A;  2PTC I;  4DG4 C;  1ZR0 B;  1P2J I;  3AUI A;  3BTF I;  1CO7 I;  2ZJX A;  1BPI A;  2FI4 I;  1BZ5 A;  1UUB A;  1FY8 I;  3AUH A;  8PTI A;  3BTQ I;  1BTI A;  1JC6 A;  4Y10 I;  2ODY E;  1JV8 A;  3L33 E;  2M01 A;  2ZVX A;  1P2K I;  1ADZ A;  1K6U A;  1TOC R;  2LFK A;  3AUE A;  3BTT I;  9PTI A;  1F5R I;  1KTH A;  3FP6 I;  3TGJ I;  3AUG A;  1P2M B;  3BTE I;  5JB5 A;  2UUX A;  2IJO I;  2JOT A;  1EJM B;  2FI3 I;  1OA6 5;  1T8O B;  7PTI A;  3AUD A;  1EAW B;  4ISN B;  1DEN A;  4PTI A;  4ISO B;  1P2I I;  3BTH I;  4NTW B;  1KNT A;  1B0C A;  5PTI A;  2LFL A;  1YKT B;  1TAW B;  1PIT A;  1LD5 A;  1NAG A;  1T8M B;  1Y62 A;  2DDJ A;  3UOU B;  6PTI A;  2HEX A;  3BYB A;  4U32 X;  5JB4 A;  2W8X A;  1BRC I;  4BD9 B;  1YLC B;  1IRH A;  2TGP I;  3OFW A;  2R9P E;  3BTK I;  3U1J E;  3UIR C;  3D65 I;  1CA0 D;  3BTG I;  3TPI I;  4WWY C;  5JB7 A;  1UUA A;  5C67 C;  1P2O B;  2M99 A;  3T62 D;  4NTX B;  1DTK A;  4Y0Y I;  3FP8 I;  1P2Q B;  2KCR A;  1AAP A;  1MTN D;  4WXV C;  4NTY B;  1KIG I;  3BTD I;  3AUB A;  2FTM B;  1QLQ A;  1YC0 I;  1LD6 A;  3M7Q B;  4BQD A;  3CI7 A;  3BTW I;  1BZX I;  1ZJD B;  1BHC A;  1TAP A;  1DEM A;  3TGK I;  1T7C B;  3WNY A;  1D0D A;  1P2N B;  2RA3 C;  1BPT A;  3L3T E;  3LDJ A;  4TPI I;  4Y11 I;  1SHP A;  1KUN A;  1OA5 5;  1BF0 A;  1G6X A;  1BUN B;  2CA7 A;  4U30 W;  5JB6 A;  1TPA I;  2TPI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...