3TGJI

S195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Comparison of Anionic and Cationic Trypsinogens: The Anionic Activation Domain is More Flexible in Solution and Differs in its Mode of Bpti Binding in the Crystal Structure
pubmed rcsb
source organism Rattus norvegicus
molecule tags Complex (serine protease/inhibitor)
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 3tgjI00
1T8NB 1JV9A 1EJMB 1UUAA 2FTLI 1MTND 3AUHA 3D65I 3U1JE 1BZXI 1BTHP 3P95E 4Y0YI 1DTXA 3P92E 1IRHA 3OTJI 1P2NB 3FP6I 3FP8I 1KIGI 4PTIA 1FAKI 2JOTA 4DTGK 5JB4A 4NTXB 3AUIA 1BZ5A 2FI3I 3TPII 1EAWB 1TAPA 4NTYB 1KTHA 1JV8A 1P2MB 2ODYE 2DDIA 3LDJA 8PTIA 2R9PE 1BIKA 1LD6A 7PTIA 1ZJDB 4BNRI 2FI4I 2W8XA 4TPII 5JB5A 3UOUB 1SHPA 1QLQA 1KNTA 2FI5I 3FP7J 1AAPA 2UUXA 3BTMI 4WWYC 6PTIA 1ADZA 1D0DB 1FANA 2TGPI 3BTHI 3BTKI 2LFLA 4U32X 1BPIA 1P2II 1F7ZI 2IJOI 1FY8I 1PITA 1TPAI 4NTWB 3LDIA 3BTGI 3BTDI 1TCPA 2RA3C 1DEMA 2KCRA 1F5RI 1K6UA 2M99A 3CI7A 2DDJA 2ZVXA 1TFXC 3TGII 3AUGA 1TAWB 2M01A 3LDMA 1P2JI 1T7CB 3BYBA 1BF0A 1P2KI 2TPII 3AUBA 1CO7I 2ZJXA 5C67C 4Y10I 1YKTB 1OA65 1CBWD 9PTIA 3L3TE 2HEXA 1P2QB 3BTQI 1T8LB 1YC0I 1TOCR 5JB7A 1NAGA 3L33E 1Y62A 4WXVC 2KNTA 3BTEI 5PTIA 1ZR0B 3TGJI 1P2OB 4BD9B 4Y11I 1UUBA 1KUNA 3AUDA 3AUCA 1AALA 4BQDA 1BHCA 3UIRC 2CA7A 3GYMI 1JC6A 3BTWI 4ISLB 1BTIA 2PTCI 3TGKI 3OFWA 4DG4C 1YLDB 1LD5A 3M7QB 1BUNB 3BTFI 1OA55 3T62D 2UUYB 2KAII 1T8OB 1T8MB 1G6XA 1BRBI 4ISOB 1D0DA 3WNYA 3AUEA 1DTKA 1BPTA 1B0CA 3BTTI 5JB6A 4Y0ZI 2FTMB 4ISNB 2LFKA 2J6DA 1YLCB 1BRCI 1CA0D 4U30W 1DENA
chains in the Genus database with same CATH superfamily
1T8NB 1JV9A 1EJMB 1UUAA 2FTLI 1MTND 3AUHA 3D65I 3U1JE 1BZXI 1BTHP 3P95E 4Y0YI 1DTXA 3P92E 1IRHA 3OTJI 1P2NB 3FP6I 3FP8I 1KIGI 4PTIA 1FAKI 2JOTA 4DTGK 5JB4A 4NTXB 3AUIA 1BZ5A 2FI3I 3TPII 1EAWB 1TAPA 4NTYB 1KTHA 1JV8A 1P2MB 2ODYE 2DDIA 3LDJA 8PTIA 2R9PE 1BIKA 1LD6A 7PTIA 1ZJDB 4BNRI 2FI4I 2W8XA 4TPII 5JB5A 3UOUB 1SHPA 1QLQA 1KNTA 2FI5I 3FP7J 1AAPA 2UUXA 3BTMI 4WWYC 6PTIA 1ADZA 1D0DB 1FANA 2TGPI 3BTHI 3BTKI 2LFLA 4U32X 1BPIA 1P2II 1F7ZI 2IJOI 1FY8I 1PITA 1TPAI 4NTWB 3LDIA 3BTGI 3BTDI 1TCPA 2RA3C 1DEMA 2KCRA 1F5RI 1K6UA 2M99A 3CI7A 2DDJA 2ZVXA 1TFXC 3TGII 3AUGA 1TAWB 2M01A 3LDMA 1P2JI 1T7CB 3BYBA 1BF0A 1P2KI 2TPII 3AUBA 1CO7I 2ZJXA 5C67C 4Y10I 1YKTB 1OA65 1CBWD 9PTIA 3L3TE 2HEXA 1P2QB 3BTQI 1T8LB 1YC0I 1TOCR 5JB7A 1NAGA 3L33E 1Y62A 4WXVC 2KNTA 3BTEI 5PTIA 1ZR0B 3TGJI 1P2OB 4BD9B 4Y11I 1UUBA 1KUNA 3AUDA 3AUCA 1AALA 4BQDA 1BHCA 3UIRC 2CA7A 3GYMI 1JC6A 3BTWI 4ISLB 1BTIA 2PTCI 3TGKI 3OFWA 4DG4C 1YLDB 1LD5A 3M7QB 1BUNB 3BTFI 1OA55 3T62D 2UUYB 2KAII 1T8OB 1T8MB 1G6XA 1BRBI 4ISOB 1D0DA 3WNYA 3AUEA 1DTKA 1BPTA 1B0CA 3BTTI 5JB6A 4Y0ZI 2FTMB 4ISNB 2LFKA 2J6DA 1YLCB 1BRCI 1CA0D 4U30W 1DENA
chains in the Genus database with same CATH topology
1T8NB 1JV9A 1EJMB 1UUAA 2FTLI 1MTND 3AUHA 3D65I 3U1JE 1BZXI 1BTHP 3P95E 4Y0YI 1DTXA 3P92E 1IRHA 3OTJI 1P2NB 3FP6I 3FP8I 1KIGI 4PTIA 1FAKI 2JOTA 4DTGK 5JB4A 4NTXB 3AUIA 1BZ5A 2FI3I 3TPII 1EAWB 1TAPA 4NTYB 1KTHA 1JV8A 1P2MB 2ODYE 2DDIA 3LDJA 8PTIA 2R9PE 1BIKA 1LD6A 7PTIA 1ZJDB 4BNRI 2FI4I 2W8XA 4TPII 5JB5A 3UOUB 1SHPA 1QLQA 1KNTA 2FI5I 3FP7J 1AAPA 2UUXA 3BTMI 4WWYC 6PTIA 1ADZA 1D0DB 1FANA 2TGPI 3BTHI 3BTKI 2LFLA 4U32X 1BPIA 1P2II 1F7ZI 2IJOI 1FY8I 1PITA 1TPAI 4NTWB 3LDIA 3BTGI 3BTDI 1TCPA 2RA3C 1DEMA 2KCRA 1F5RI 1K6UA 2M99A 3CI7A 2DDJA 2ZVXA 1TFXC 3TGII 3AUGA 1TAWB 2M01A 3LDMA 1P2JI 1T7CB 3BYBA 1BF0A 1P2KI 2TPII 3AUBA 1CO7I 2ZJXA 5C67C 4Y10I 1YKTB 1OA65 1CBWD 9PTIA 3L3TE 2HEXA 1P2QB 3BTQI 1T8LB 1YC0I 1TOCR 5JB7A 1NAGA 3L33E 1Y62A 4WXVC 2KNTA 3BTEI 5PTIA 1ZR0B 3TGJI 1P2OB 4BD9B 4Y11I 1UUBA 1KUNA 3AUDA 3AUCA 1AALA 4BQDA 1BHCA 3UIRC 2CA7A 3GYMI 1JC6A 3BTWI 4ISLB 1BTIA 2PTCI 3TGKI 3OFWA 4DG4C 1YLDB 1LD5A 3M7QB 1BUNB 3BTFI 1OA55 3T62D 2UUYB 2KAII 1T8OB 1T8MB 1G6XA 1BRBI 4ISOB 1D0DA 3WNYA 3AUEA 1DTKA 1BPTA 1B0CA 3BTTI 5JB6A 4Y0ZI 2FTMB 4ISNB 2LFKA 2J6DA 1YLCB 1BRCI 1CA0D 4U30W 1DENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8N B;  1JV9 A;  1EJM B;  1UUA A;  2FTL I;  1MTN D;  3AUH A;  3D65 I;  3U1J E;  1BZX I;  1BTH P;  3P95 E;  4Y0Y I;  1DTX A;  3P92 E;  1IRH A;  3OTJ I;  1P2N B;  3FP6 I;  3FP8 I;  1KIG I;  4PTI A;  1FAK I;  2JOT A;  4DTG K;  5JB4 A;  4NTX B;  3AUI A;  1BZ5 A;  2FI3 I;  3TPI I;  1EAW B;  1TAP A;  4NTY B;  1KTH A;  1JV8 A;  1P2M B;  2ODY E;  2DDI A;  3LDJ A;  8PTI A;  2R9P E;  1BIK A;  1LD6 A;  7PTI A;  1ZJD B;  4BNR I;  2FI4 I;  2W8X A;  4TPI I;  5JB5 A;  3UOU B;  1SHP A;  1QLQ A;  1KNT A;  2FI5 I;  3FP7 J;  1AAP A;  2UUX A;  3BTM I;  4WWY C;  6PTI A;  1ADZ A;  1D0D B;  1FAN A;  2TGP I;  3BTH I;  3BTK I;  2LFL A;  4U32 X;  1BPI A;  1P2I I;  1F7Z I;  2IJO I;  1FY8 I;  1PIT A;  1TPA I;  4NTW B;  3LDI A;  3BTG I;  3BTD I;  1TCP A;  2RA3 C;  1DEM A;  2KCR A;  1F5R I;  1K6U A;  2M99 A;  3CI7 A;  2DDJ A;  2ZVX A;  1TFX C;  3TGI I;  3AUG A;  1TAW B;  2M01 A;  3LDM A;  1P2J I;  1T7C B;  3BYB A;  1BF0 A;  1P2K I;  2TPI I;  3AUB A;  1CO7 I;  2ZJX A;  5C67 C;  4Y10 I;  1YKT B;  1OA6 5;  1CBW D;  9PTI A;  3L3T E;  2HEX A;  1P2Q B;  3BTQ I;  1T8L B;  1YC0 I;  1TOC R;  5JB7 A;  1NAG A;  3L33 E;  1Y62 A;  4WXV C;  2KNT A;  3BTE I;  5PTI A;  1ZR0 B;  3TGJ I;  1P2O B;  4BD9 B;  4Y11 I;  1UUB A;  1KUN A;  3AUD A;  3AUC A;  1AAL A;  4BQD A;  1BHC A;  3UIR C;  2CA7 A;  3GYM I;  1JC6 A;  3BTW I;  4ISL B;  1BTI A;  2PTC I;  3TGK I;  3OFW A;  4DG4 C;  1YLD B;  1LD5 A;  3M7Q B;  1BUN B;  3BTF I;  1OA5 5;  3T62 D;  2UUY B;  2KAI I;  1T8O B;  1T8M B;  1G6X A;  1BRB I;  4ISO B;  1D0D A;  3WNY A;  3AUE A;  1DTK A;  1BPT A;  1B0C A;  3BTT I;  5JB6 A;  4Y0Z I;  2FTM B;  4ISN B;  2LFK A;  2J6D A;  1YLC B;  1BRC I;  1CA0 D;  4U30 W;  1DEN A; 
#chains in the Genus database with same CATH topology
 1T8N B;  1JV9 A;  1EJM B;  1UUA A;  2FTL I;  1MTN D;  3AUH A;  3D65 I;  3U1J E;  1BZX I;  1BTH P;  3P95 E;  4Y0Y I;  1DTX A;  3P92 E;  1IRH A;  3OTJ I;  1P2N B;  3FP6 I;  3FP8 I;  1KIG I;  4PTI A;  1FAK I;  2JOT A;  4DTG K;  5JB4 A;  4NTX B;  3AUI A;  1BZ5 A;  2FI3 I;  3TPI I;  1EAW B;  1TAP A;  4NTY B;  1KTH A;  1JV8 A;  1P2M B;  2ODY E;  2DDI A;  3LDJ A;  8PTI A;  2R9P E;  1BIK A;  1LD6 A;  7PTI A;  1ZJD B;  4BNR I;  2FI4 I;  2W8X A;  4TPI I;  5JB5 A;  3UOU B;  1SHP A;  1QLQ A;  1KNT A;  2FI5 I;  3FP7 J;  1AAP A;  2UUX A;  3BTM I;  4WWY C;  6PTI A;  1ADZ A;  1D0D B;  1FAN A;  2TGP I;  3BTH I;  3BTK I;  2LFL A;  4U32 X;  1BPI A;  1P2I I;  1F7Z I;  2IJO I;  1FY8 I;  1PIT A;  1TPA I;  4NTW B;  3LDI A;  3BTG I;  3BTD I;  1TCP A;  2RA3 C;  1DEM A;  2KCR A;  1F5R I;  1K6U A;  2M99 A;  3CI7 A;  2DDJ A;  2ZVX A;  1TFX C;  3TGI I;  3AUG A;  1TAW B;  2M01 A;  3LDM A;  1P2J I;  1T7C B;  3BYB A;  1BF0 A;  1P2K I;  2TPI I;  3AUB A;  1CO7 I;  2ZJX A;  5C67 C;  4Y10 I;  1YKT B;  1OA6 5;  1CBW D;  9PTI A;  3L3T E;  2HEX A;  1P2Q B;  3BTQ I;  1T8L B;  1YC0 I;  1TOC R;  5JB7 A;  1NAG A;  3L33 E;  1Y62 A;  4WXV C;  2KNT A;  3BTE I;  5PTI A;  1ZR0 B;  3TGJ I;  1P2O B;  4BD9 B;  4Y11 I;  1UUB A;  1KUN A;  3AUD A;  3AUC A;  1AAL A;  4BQD A;  1BHC A;  3UIR C;  2CA7 A;  3GYM I;  1JC6 A;  3BTW I;  4ISL B;  1BTI A;  2PTC I;  3TGK I;  3OFW A;  4DG4 C;  1YLD B;  1LD5 A;  3M7Q B;  1BUN B;  3BTF I;  1OA5 5;  3T62 D;  2UUY B;  2KAI I;  1T8O B;  1T8M B;  1G6X A;  1BRB I;  4ISO B;  1D0D A;  3WNY A;  3AUE A;  1DTK A;  1BPT A;  1B0C A;  3BTT I;  5JB6 A;  4Y0Z I;  2FTM B;  4ISN B;  2LFK A;  2J6D A;  1YLC B;  1BRC I;  1CA0 D;  4U30 W;  1DEN A; 
#chains in the Genus database with same CATH homology
 1T8N B;  1JV9 A;  1EJM B;  1UUA A;  2FTL I;  1MTN D;  3AUH A;  3D65 I;  3U1J E;  1BZX I;  1BTH P;  3P95 E;  4Y0Y I;  1DTX A;  3P92 E;  1IRH A;  3OTJ I;  1P2N B;  3FP6 I;  3FP8 I;  1KIG I;  4PTI A;  1FAK I;  2JOT A;  4DTG K;  5JB4 A;  4NTX B;  3AUI A;  1BZ5 A;  2FI3 I;  3TPI I;  1EAW B;  1TAP A;  4NTY B;  1KTH A;  1JV8 A;  1P2M B;  2ODY E;  2DDI A;  3LDJ A;  8PTI A;  2R9P E;  1BIK A;  1LD6 A;  7PTI A;  1ZJD B;  4BNR I;  2FI4 I;  2W8X A;  4TPI I;  5JB5 A;  3UOU B;  1SHP A;  1QLQ A;  1KNT A;  2FI5 I;  3FP7 J;  1AAP A;  2UUX A;  3BTM I;  4WWY C;  6PTI A;  1ADZ A;  1D0D B;  1FAN A;  2TGP I;  3BTH I;  3BTK I;  2LFL A;  4U32 X;  1BPI A;  1P2I I;  1F7Z I;  2IJO I;  1FY8 I;  1PIT A;  1TPA I;  4NTW B;  3LDI A;  3BTG I;  3BTD I;  1TCP A;  2RA3 C;  1DEM A;  2KCR A;  1F5R I;  1K6U A;  2M99 A;  3CI7 A;  2DDJ A;  2ZVX A;  1TFX C;  3TGI I;  3AUG A;  1TAW B;  2M01 A;  3LDM A;  1P2J I;  1T7C B;  3BYB A;  1BF0 A;  1P2K I;  2TPI I;  3AUB A;  1CO7 I;  2ZJX A;  5C67 C;  4Y10 I;  1YKT B;  1OA6 5;  1CBW D;  9PTI A;  3L3T E;  2HEX A;  1P2Q B;  3BTQ I;  1T8L B;  1YC0 I;  1TOC R;  5JB7 A;  1NAG A;  3L33 E;  1Y62 A;  4WXV C;  2KNT A;  3BTE I;  5PTI A;  1ZR0 B;  3TGJ I;  1P2O B;  4BD9 B;  4Y11 I;  1UUB A;  1KUN A;  3AUD A;  3AUC A;  1AAL A;  4BQD A;  1BHC A;  3UIR C;  2CA7 A;  3GYM I;  1JC6 A;  3BTW I;  4ISL B;  1BTI A;  2PTC I;  3TGK I;  3OFW A;  4DG4 C;  1YLD B;  1LD5 A;  3M7Q B;  1BUN B;  3BTF I;  1OA5 5;  3T62 D;  2UUY B;  2KAI I;  1T8O B;  1T8M B;  1G6X A;  1BRB I;  4ISO B;  1D0D A;  3WNY A;  3AUE A;  1DTK A;  1BPT A;  1B0C A;  3BTT I;  5JB6 A;  4Y0Z I;  2FTM B;  4ISN B;  2LFK A;  2J6D A;  1YLC B;  1BRC I;  1CA0 D;  4U30 W;  1DEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...