3TJQA

N-domain of htra1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
106
Chain Sequence
GCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of HtrA1 and Its Subdomains.
pubmed doi rcsb
molecule keywords Serine protease HTRA1
molecule tags Hydrolase
source organism Homo sapiens
total genus 23
structure length 106
sequence length 119
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00219 IGFBP Insulin-like growth factor binding protein
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3tjqA00
5DAEA 1Z7KB 2LEOA 2KCXA 1YU6C 1HPTA 1IY5A 1SGPI 2NU1I 1OMUA 2JXDA 1PPFI 2N52A 2XRCA 2SGQI 1SGQI 1M8BA 1SGNI 2F3CI 4SGBI 2GKVA 1OYVI 1CHOI 2QQCA 2OVOA 1CSOI 3QTLD 1CT0I 2N71A 2JYYA 1BMOA 1KMAA 2NU4I 1IY6A 5JHWC 1UVGA 2GKTI 1CGJI 3SGQI 1SGRI 2SGDI 2NU0I 1DS2I 2NU3I 1TBRR 1UVFA 2B0UC 1Y1BA 3OVOA 2JZMA 4GI3C 2ARPF 2QQDA 2KMRA 1HDLA 2P6AC 2M5XA 1TIHA 1TUSA 1SGDI 1N13A 2KMPA 1HJAI 1MT1A 2SGPI 3B4VC 4HGUA 1AN1I 1IW4A 2KMOA 3SGBI 1LR7A 2NU2I 2SGFI 1FYBA 3TJQA 4OVOA 1PJUA 1OVOA 2BUSA 3HH2C 2ERWA 1CT2I 1SGEI 1CT4I 1H0ZA 2KMQA 1R0RI 1M8CA 1NUBA 1BUSA 1PCEA 1LR9A 1UUCA 2WCYA 2N17A 1CE3A 1CGII 1TBQR 2SGEI 2GKRI 2V53A 3SEKC 1LR8A 1Y1CA 1TURA 1OMTA 1SGYI 1TGSI 1DS3I 1YTPA
chains in the Genus database with same CATH superfamily
5DAEA 1Z7KB 4UXJA 3TO6A 5E3QA 2LEOA 2KCXA 1YU6C 3OL0A 1HPTA 2Y0MA 3TO7A 1SGPI 1IY5A 2J9RA 2NU1I 5EX0A 2CJSC 2ODDA 1OMUA 1P9ZA 2JXDA 1XBTA 1PPFI 3VDUA 1W3SA 2N52A 2XRCA 2SGQI 1SGQI 3UGDA 2DKVA 2X52A 5J8CA 1M8BA 3R5CA 1SGNI 2F3CI 4SGBI 2GKVA 1OYVI 1XA6A 1CHOI 1K7VA 2QQCA 3QWPA 5FUWA 1KBFA 1W4RA 2OVOA 3GOXA 3R5BA 1CSOI 5EX3A 3VE5A 3QTLD 1CT0I 1FAQA 2N71A 3OXFA 1X74A 1UHAA 2E5RA 2JYYA 2V1CA 1V1HA 1BMOA 3PDNA 3E2IA 1PTRA 3UGLA 2NU4I 1IY6A 3OXLA 1KMAA 5JHWC 1V1IA 1UVGA 3R5DA 3UEYA 1R79A 2GKTI 1CGJI 2J87A 2RC4A 3SGQI 1SGRI 2SGDI 2NU0I 1DS2I 1MJAA 2NU3I 2L8EA 2ORVA 1TBRR 1XX6A 3FSYA 2CWGA 1UVFA 1Z2IA 2B0UC 2OD1A 1S20A 4UXHA 4WP4A 1Y1BA 3OVOA 1Y8FA 2JZMA 4GI3C 4B6DA 1P9GA 2YUUA 3E59A 4MPIA 3UOEA 2ARPF 2QQEA 2DIPA 2GIVA 2QQDA 2KMRA 5FUYA 3VDPA 1HDLA 2FNFX 2V1CC 2VRWB 3RU0A 3MEKA 1NXUA 3QAHA 2K9HA 2W0TA 3R5AA 2LB7A 2P6AC 2M5XA 3TO9A 1TBNA 2YQPA 1ULKA 2A20A 2QQ0A 4L9MA 1TIHA 2UZ3A 5CCLA 1KBEA 2OU2A 5HI7A 5J8FA 1K7TA 4AMLA 2N1AB 1TUSA 1WTJA 4FKDA 1ULNA 1SGDI 1N13A 2KMPA 2QPOA 1HJAI 1MT1A 2SGPI 3B4VC 2WGCA 1FY7A 3TJQA 1TOTA 1AN1I 3FSXA 1VDDA 4HGUA 1IW4A 4E1PA 3TOBA 5FUXA 1U5KA 2KMOA 2OZUA 2E73A 2L7XA 2B8TA 3KY9A 3SGBI 1LR7A 2NU2I 2SGFI 1FYBA 1MJBA 1TBOA 1Q9BA 1WKXA 1PJUA 1OVOA 2BUSA 2JW6A 4OVOA 5FUVA 1MJ9A 1WGTA 3HH2C 5HQ8A 2ERWA 1CT2I 2ROWA 1SGEI 3FC3A 1CT4I 1H0ZA 2X3TA 2KMQA 1R0RI 2LUYA 2ORWA 3CXLA 1M8CA 2JA1A 1WGCA 1NUBA 1BUSA 2WVJA 1PCEA 5E3PA 3BJIA 2PQ8A 1RFHA 1LR9A 1UUCA 2UVOA 2WCYA 2N17A 1CE3A 1CGII 2CWHA 1FARA 2CWFA 3D00A 2GVIA 9WGAA 1TBQR 2SGEI 3UEJA 2GKRI 4DNCA 2V53A 3SEKC 1LR8A 4UXIA 1ULMA 2RIJA 7WGAA 2ENNA 5CCMA 2ENZA 4JCVE 1Y1CA 1TURA 1OMTA 2ELIA 4E1RA 1HEVA 3UFFA 3UGIA 1SGYI 3TOAA 1PTQA 1TGSI 1DS3I 3OXGA 2DB6A 1K7UA 5E3RA 4A24A 1X4SA 1YTPA
chains in the Genus database with same CATH topology
5DAEA 1Z7KB 4UXJA 2LEOA 2KCXA 1YU6C 3OL0A 1HPTA 1IY5A 1SGPI 2J9RA 2NU1I 5EX0A 2CJSC 2ODDA 1OMUA 2JXDA 1XBTA 1PPFI 3VDUA 1W3SA 2N52A 2XRCA 2SGQI 1SGQI 3UGDA 1M8BA 1SGNI 2F3CI 4SGBI 2GKVA 1OYVI 1XA6A 1CHOI 2QQCA 3QWPA 5FUWA 1KBFA 1W4RA 2OVOA 3GOXA 5EX3A 1CSOI 3VE5A 3QTLD 1CT0I 1FAQA 2N71A 3OXFA 1X74A 2E5RA 2JYYA 2V1CA 1V1HA 1BMOA 3PDNA 3E2IA 1PTRA 3UGLA 2NU4I 1IY6A 3OXLA 1KMAA 5JHWC 1V1IA 1UVGA 3UEYA 1R79A 2GKTI 1CGJI 2J87A 3SGQI 1SGRI 2SGDI 2NU0I 1DS2I 2NU3I 2L8EA 2ORVA 1TBRR 1XX6A 1UVFA 2B0UC 2OD1A 4UXHA 1Y1BA 3OVOA 1Y8FA 2JZMA 4GI3C 4B6DA 2YUUA 3E59A 2ARPF 2QQEA 2DIPA 2QQDA 2KMRA 5FUYA 3VDPA 1HDLA 2FNFX 2V1CC 2VRWB 3RU0A 3MEKA 2K9HA 2W0TA 2P6AC 2M5XA 1TBNA 2YQPA 2A20A 2QQ0A 4L9MA 1TIHA 2UZ3A 5CCLA 1KBEA 5HI7A 2N1AB 1TUSA 4FKDA 1SGDI 1N13A 2KMPA 2QPOA 1HJAI 1MT1A 2SGPI 3B4VC 1TOTA 1AN1I 4HGUA 1VDDA 1IW4A 4E1PA 5FUXA 1U5KA 2KMOA 2E73A 2L7XA 2B8TA 3KY9A 3SGBI 1LR7A 2NU2I 2SGFI 1FYBA 1TBOA 5FUVA 2JW6A 4OVOA 1PJUA 1OVOA 2BUSA 3TJQA 3HH2C 5HQ8A 2ERWA 1CT2I 2ROWA 1SGEI 3FC3A 1CT4I 1H0ZA 2KMQA 1R0RI 2LUYA 2ORWA 3CXLA 1M8CA 2JA1A 1NUBA 1BUSA 2WVJA 1PCEA 3BJIA 1RFHA 1LR9A 1UUCA 2WCYA 2N17A 1CE3A 1CGII 3D00A 1FARA 2GVIA 1TBQR 2SGEI 3UEJA 2GKRI 2V53A 3SEKC 1LR8A 4UXIA 2ENNA 5CCMA 2ENZA 4JCVE 1Y1CA 1TURA 1OMTA 2ELIA 4E1RA 3UFFA 3UGIA 1SGYI 1PTQA 1TGSI 1DS3I 3OXGA 2DB6A 4A24A 1X4SA 1YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAE A;  1Z7K B;  2LEO A;  2KCX A;  1YU6 C;  1HPT A;  1IY5 A;  1SGP I;  2NU1 I;  1OMU A;  2JXD A;  1PPF I;  2N52 A;  2XRC A;  2SGQ I;  1SGQ I;  1M8B A;  1SGN I;  2F3C I;  4SGB I;  2GKV A;  1OYV I;  1CHO I;  2QQC A;  2OVO A;  1CSO I;  3QTL D;  1CT0 I;  2N71 A;  2JYY A;  1BMO A;  1KMA A;  2NU4 I;  1IY6 A;  5JHW C;  1UVG A;  2GKT I;  1CGJ I;  3SGQ I;  1SGR I;  2SGD I;  2NU0 I;  1DS2 I;  2NU3 I;  1TBR R;  1UVF A;  2B0U C;  1Y1B A;  3OVO A;  2JZM A;  4GI3 C;  2ARP F;  2QQD A;  2KMR A;  1HDL A;  2P6A C;  2M5X A;  1TIH A;  1TUS A;  1SGD I;  1N13 A;  2KMP A;  1HJA I;  1MT1 A;  2SGP I;  3B4V C;  4HGU A;  1AN1 I;  1IW4 A;  2KMO A;  3SGB I;  1LR7 A;  2NU2 I;  2SGF I;  1FYB A;  3TJQ A;  4OVO A;  1PJU A;  1OVO A;  2BUS A;  3HH2 C;  2ERW A;  1CT2 I;  1SGE I;  1CT4 I;  1H0Z A;  2KMQ A;  1R0R I;  1M8C A;  1NUB A;  1BUS A;  1PCE A;  1LR9 A;  1UUC A;  2WCY A;  2N17 A;  1CE3 A;  1CGI I;  1TBQ R;  2SGE I;  2GKR I;  2V53 A;  3SEK C;  1LR8 A;  1Y1C A;  1TUR A;  1OMT A;  1SGY I;  1TGS I;  1DS3 I;  1YTP A; 
#chains in the Genus database with same CATH topology
 5DAE A;  1Z7K B;  4UXJ A;  3TO6 A;  5E3Q A;  2LEO A;  2KCX A;  1YU6 C;  3OL0 A;  1HPT A;  2Y0M A;  3TO7 A;  1SGP I;  1IY5 A;  2J9R A;  2NU1 I;  5EX0 A;  2CJS C;  2ODD A;  1OMU A;  1P9Z A;  2JXD A;  1XBT A;  1PPF I;  3VDU A;  1W3S A;  2N52 A;  2XRC A;  2SGQ I;  1SGQ I;  3UGD A;  2DKV A;  2X52 A;  5J8C A;  1M8B A;  3R5C A;  1SGN I;  2F3C I;  4SGB I;  2GKV A;  1OYV I;  1XA6 A;  1CHO I;  1K7V A;  2QQC A;  3QWP A;  5FUW A;  1KBF A;  1W4R A;  2OVO A;  3GOX A;  3R5B A;  1CSO I;  5EX3 A;  3VE5 A;  3QTL D;  1CT0 I;  1FAQ A;  2N71 A;  3OXF A;  1X74 A;  1UHA A;  2E5R A;  2JYY A;  2V1C A;  1V1H A;  1BMO A;  3PDN A;  3E2I A;  1PTR A;  3UGL A;  2NU4 I;  1IY6 A;  3OXL A;  1KMA A;  5JHW C;  1V1I A;  1UVG A;  3R5D A;  3UEY A;  1R79 A;  2GKT I;  1CGJ I;  2J87 A;  2RC4 A;  3SGQ I;  1SGR I;  2SGD I;  2NU0 I;  1DS2 I;  1MJA A;  2NU3 I;  2L8E A;  2ORV A;  1TBR R;  1XX6 A;  3FSY A;  2CWG A;  1UVF A;  1Z2I A;  2B0U C;  2OD1 A;  1S20 A;  4UXH A;  4WP4 A;  1Y1B A;  3OVO A;  1Y8F A;  2JZM A;  4GI3 C;  4B6D A;  1P9G A;  2YUU A;  3E59 A;  4MPI A;  3UOE A;  2ARP F;  2QQE A;  2DIP A;  2GIV A;  2QQD A;  2KMR A;  5FUY A;  3VDP A;  1HDL A;  2FNF X;  2V1C C;  2VRW B;  3RU0 A;  3MEK A;  1NXU A;  3QAH A;  2K9H A;  2W0T A;  3R5A A;  2LB7 A;  2P6A C;  2M5X A;  3TO9 A;  1TBN A;  2YQP A;  1ULK A;  2A20 A;  2QQ0 A;  4L9M A;  1TIH A;  2UZ3 A;  5CCL A;  1KBE A;  2OU2 A;  5HI7 A;  5J8F A;  1K7T A;  4AML A;  2N1A B;  1TUS A;  1WTJ A;  4FKD A;  1ULN A;  1SGD I;  1N13 A;  2KMP A;  2QPO A;  1HJA I;  1MT1 A;  2SGP I;  3B4V C;  2WGC A;  1FY7 A;  3TJQ A;  1TOT A;  1AN1 I;  3FSX A;  1VDD A;  4HGU A;  1IW4 A;  4E1P A;  3TOB A;  5FUX A;  1U5K A;  2KMO A;  2OZU A;  2E73 A;  2L7X A;  2B8T A;  3KY9 A;  3SGB I;  1LR7 A;  2NU2 I;  2SGF I;  1FYB A;  1MJB A;  1TBO A;  1Q9B A;  1WKX A;  1PJU A;  1OVO A;  2BUS A;  2JW6 A;  4OVO A;  5FUV A;  1MJ9 A;  1WGT A;  3HH2 C;  5HQ8 A;  2ERW A;  1CT2 I;  2ROW A;  1SGE I;  3FC3 A;  1CT4 I;  1H0Z A;  2X3T A;  2KMQ A;  1R0R I;  2LUY A;  2ORW A;  3CXL A;  1M8C A;  2JA1 A;  1WGC A;  1NUB A;  1BUS A;  2WVJ A;  1PCE A;  5E3P A;  3BJI A;  2PQ8 A;  1RFH A;  1LR9 A;  1UUC A;  2UVO A;  2WCY A;  2N17 A;  1CE3 A;  1CGI I;  2CWH A;  1FAR A;  2CWF A;  3D00 A;  2GVI A;  9WGA A;  1TBQ R;  2SGE I;  3UEJ A;  2GKR I;  4DNC A;  2V53 A;  3SEK C;  1LR8 A;  4UXI A;  1ULM A;  2RIJ A;  7WGA A;  2ENN A;  5CCM A;  2ENZ A;  4JCV E;  1Y1C A;  1TUR A;  1OMT A;  2ELI A;  4E1R A;  1HEV A;  3UFF A;  3UGI A;  1SGY I;  3TOA A;  1PTQ A;  1TGS I;  1DS3 I;  3OXG A;  2DB6 A;  1K7U A;  5E3R A;  4A24 A;  1X4S A;  1YTP A; 
#chains in the Genus database with same CATH homology
 5DAE A;  1Z7K B;  4UXJ A;  2LEO A;  2KCX A;  1YU6 C;  3OL0 A;  1HPT A;  1IY5 A;  1SGP I;  2J9R A;  2NU1 I;  5EX0 A;  2CJS C;  2ODD A;  1OMU A;  2JXD A;  1XBT A;  1PPF I;  3VDU A;  1W3S A;  2N52 A;  2XRC A;  2SGQ I;  1SGQ I;  3UGD A;  1M8B A;  1SGN I;  2F3C I;  4SGB I;  2GKV A;  1OYV I;  1XA6 A;  1CHO I;  2QQC A;  3QWP A;  5FUW A;  1KBF A;  1W4R A;  2OVO A;  3GOX A;  5EX3 A;  1CSO I;  3VE5 A;  3QTL D;  1CT0 I;  1FAQ A;  2N71 A;  3OXF A;  1X74 A;  2E5R A;  2JYY A;  2V1C A;  1V1H A;  1BMO A;  3PDN A;  3E2I A;  1PTR A;  3UGL A;  2NU4 I;  1IY6 A;  3OXL A;  1KMA A;  5JHW C;  1V1I A;  1UVG A;  3UEY A;  1R79 A;  2GKT I;  1CGJ I;  2J87 A;  3SGQ I;  1SGR I;  2SGD I;  2NU0 I;  1DS2 I;  2NU3 I;  2L8E A;  2ORV A;  1TBR R;  1XX6 A;  1UVF A;  2B0U C;  2OD1 A;  4UXH A;  1Y1B A;  3OVO A;  1Y8F A;  2JZM A;  4GI3 C;  4B6D A;  2YUU A;  3E59 A;  2ARP F;  2QQE A;  2DIP A;  2QQD A;  2KMR A;  5FUY A;  3VDP A;  1HDL A;  2FNF X;  2V1C C;  2VRW B;  3RU0 A;  3MEK A;  2K9H A;  2W0T A;  2P6A C;  2M5X A;  1TBN A;  2YQP A;  2A20 A;  2QQ0 A;  4L9M A;  1TIH A;  2UZ3 A;  5CCL A;  1KBE A;  5HI7 A;  2N1A B;  1TUS A;  4FKD A;  1SGD I;  1N13 A;  2KMP A;  2QPO A;  1HJA I;  1MT1 A;  2SGP I;  3B4V C;  1TOT A;  1AN1 I;  4HGU A;  1VDD A;  1IW4 A;  4E1P A;  5FUX A;  1U5K A;  2KMO A;  2E73 A;  2L7X A;  2B8T A;  3KY9 A;  3SGB I;  1LR7 A;  2NU2 I;  2SGF I;  1FYB A;  1TBO A;  5FUV A;  2JW6 A;  4OVO A;  1PJU A;  1OVO A;  2BUS A;  3TJQ A;  3HH2 C;  5HQ8 A;  2ERW A;  1CT2 I;  2ROW A;  1SGE I;  3FC3 A;  1CT4 I;  1H0Z A;  2KMQ A;  1R0R I;  2LUY A;  2ORW A;  3CXL A;  1M8C A;  2JA1 A;  1NUB A;  1BUS A;  2WVJ A;  1PCE A;  3BJI A;  1RFH A;  1LR9 A;  1UUC A;  2WCY A;  2N17 A;  1CE3 A;  1CGI I;  3D00 A;  1FAR A;  2GVI A;  1TBQ R;  2SGE I;  3UEJ A;  2GKR I;  2V53 A;  3SEK C;  1LR8 A;  4UXI A;  2ENN A;  5CCM A;  2ENZ A;  4JCV E;  1Y1C A;  1TUR A;  1OMT A;  2ELI A;  4E1R A;  3UFF A;  3UGI A;  1SGY I;  1PTQ A;  1TGS I;  1DS3 I;  3OXG A;  2DB6 A;  4A24 A;  1X4S A;  1YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...