3TQXA

Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
396
structure length
396
Chain Sequence
b'MQEILSQLNKEIEGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-ketobutyrate coenzyme A ligase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
total genus 121
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.3.1.29: Glycine C-acetyltransferase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3tqxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3tqxA01
1GBNA 4U2HA 3A9YA 1MGVA 3LVJA 3NUIA 1M7YA 4UQVA 2AY4A 1DGEA 3E2ZB 1MAPA 1BT4A 1YIZA 4ZM3A 2VMOA 1CQ8A 2XBNA 1KMKA 5AX8A 2W8JA 3MADA 3CAIA 3RUYA 1BQDA 3PIUA 3IHJA 2PB2A 2VLHA 3ACZA 2JJFA 4AZKA 5HDMA 5EIGB 5J8QA 4XJMA 1G7XA 1TARA 2R2NA 3MKJA 2DGLA 4Y0DA 3VP6A 1SZKA 2DKBA 3G0TA 3NRAA 1C0NA 2RFVA 5M49A 2VMYA 4NOGA 5EAAA 4IX8A 4OC9A 3W1IA 1CJ0A 1AJSB 1S08A 1N31A 4ADBA 1I43A 5DB5A 4ITGA 3BS8A 1EQBA 5EFSA 5EUNA 3RQ1A 2CJGA 1AICA 4WXFA 2DGMA 2VIBA 1C7NA 1IAXA 2JGTA 4GEBA 1TOJA 4XAUA 1S06A 2W8VA 3QPGA 4JEZA 5G2PA 4WLHA 4CXQA 1O69A 1D7VA 7AATA 2CY8A 1S07A 1MAQA 5LH9A 3FQAA 3MAFB 1AJRA 4IY7A 1WKGA 2O1BA 4AZJA 3LVKA 2AEVA 1ASNA 5C6UA 1ARSA 2EZ1A 4F5KA 4EB5A 1BJ4A 1TOGA 4HVKA 4FFCA 5BJ3A 4GSAA 2CINA 3DXVA 3L44A 1ZODA 4RITA 2QLRA 4GE9A 2VI8A 2CH2A 3E2ZA 2BI2A 3LVMA 4K2IA 4WYCA 4WYFA 3WY7A 1RVYA 1MDXA 1AMSA 1ARHA 2VGUA 3HDOA 4ISYA 1ASDA 2OKKA 2PO3A 1MDZA 4H51A 1XI9A 2Z1ZA 2D65A 4W1VA 1B9IA 2GQNA 4LNLA 1AMRA 2VMPA 4EFFA 1V2DA 3LY1A 2HP1A 3GBXA 1ASGA 1QJ3A 2YRRA 1IX7A 3B1EA 1SPAA 1Y4IA 1WYTB 2YHKA 3GWPA 4JEVA 2AEUA 4PIWA 2W8UA 1TOIA 4OT8A 1KMJA 2E7IA 4Q31A 1MLZA 3AENB 2EH6A 4JE5A 3I16A 2YRIA 1G4VA 1I41A 1VEFA 4LNJA 3VK3A 4AOAA 5DJ1A 3EZSA 2VMZA 5JAYA 4XJPA 3ZZKA 5LHAA 1DKAA 1BKGA 2GMUA 3FZ8A 2ZSLA 4RKDA 3AEOA 2YKVA 4R5ZA 2AY1A 1C9CA 3BCAA 2BI9A 2PB0A 4ZSWA 1D7RA 3M5UA 1LC7A 3JWBA 3F9TA 4CXRA 1O61A 2VMUA 3EZ1A 1C4KA 3QBOA 2Z1YA 5G2QA 3DZZA 1IVRA 3EIBA 3KGXA 4W5KA 4WP0A 3BCXA 3P1TA 1E5EA 1V72A 1ASCA 1ASEA 1WYVB 4P7YA 4I8AA 3VK4A 4N0BA 4GRXA 4A00A 1LKCA 1RV3A 1W3UA 4RLGA 3MC6A 2OQXA 3LV2A 4IYOA 3JZLA 2YKUA 2W8TA 1LC5A 4AH3A 2VYCA 3AEJC 2YKXA 4IXSA 4QGRA 2Z61A 2VMSA 2BWPA 1LK9A 3PA9A 2O7CA 3LWSA 4ATQA 3II0A 3FCRA 2BI5A 4A0FA 4M2JA 4ZASA 4MY5A 2VMWA 4U1TA 1MLYA 1AIBA 3FTBA 2R5CA 4WYEA 3GR9A 3UAKA 1ZC9A 3BWNC 2CFBA 1AHFA 1ARTA 1GD9A 3PDXA 1YNUA 3CBFA 2VLFA 3AENA 4OYTA 2D5YA 3NDNA 2OATA 1AKAA 3GJUA 3WGCA 4OBVA 5G4JA 3JW9A 2QB3A 4E3QA 1GCKA 3FQ7A 4F5JA 2VMQA 4JEWA 4K2BA 2ZSMA 1ASMA 1O4SA 4W1WA 1IX8A 1N2TA 1AY5A 1CS1A 3MBBA 3TFUA 1FC4A 1YJSA 3AEPA 3GZDA 4R8DA 1AAWA 1OXPA 4JEXA 5M4DA 2HORA 3PD6B 4ZSYA 1C7OA 5M46A 4ZAHA 4LNMA 3FFHA 1S09A 3BB8A 4WD2A 2GSAA 3KE3A 4JF0A 2QBTA 3NU8A 1IBJA 3HVYA 3TCMA 4F4EA 3BCBA 3HT4A 2GMSA 3VAXA 1WYUB 3IF2A 4UHOA 1KKJA 3QI6A 5DX5A 4DBCA 4Q6RA 1GC4A 3NYUA 3MAFA 5E4ZA 1MDOA 3W1JA 3WKRA 2OKJA 1LW5A 4R5FA 3T32A 3TATA 3A9ZA 3N0LA 1UU1A 4WXBA 5M4BA 2QMAA 4A6RA 2AATA 1EG5A 3K28A 3GSBA 4WYGA 1TPLA 3B46A 2ZP7A 4JE5D 5EQCA 3FVXA 2VGVA 4KXKA 2BHXA 5HXXA 2W7JA 4TMRA 1KL1A 4ADEA 2D7YA 3JWAA 1GEXA 4GDYA 3NX3A 4K2MA 2BIGA 2BI1A 1QJ5A 9AATA 2Z9VA 3WX9A 4BA4A 2FQ6A 3N75A 3D6KA 2W7IA 3FVSA 3RCHB 2Q7WA 5G0AA 3DODA 4RJ0A 4ADDA 1X2AA 1DJUA 5K8BA 3I4JA 2VGWA 1CZEA 1PMOA 4JF1A 3P6KA 1YOOA 3ASBA 2BYJA 1X29A 4W91A 4XEWA 1WKHA 5FT4A 3HL2A 3VK2A 3L8AA 2BYLA 1BJOB 1SZSA 3F6TA 3CQ5A 5FT8A 5D95A 1IUGA 1ASLA 5E3KA 4ZDLA 3WLXA 2V0YA 1AMAA 4OTLA 4A0HA 2ORDA 1AHXA 3NUBA 1I29A 2WK8A 3COGA 4FL0A 4WB0B 5EIGA 2CJDA 4F5HA 3QGUA 1RVUA 4LC3A 5EUDA 4Q76A 1SFFA 2HOYA 1IX6A 2Z67A 3ATHA 3PGYA 4ZWMA 4IXOA 4Y0HA 2BWNA 3I5TA 1AJSA 3TFTA 4J8LA 1QGNA 2BIAA 4BMKA 4GE4A 2JG2A 2ZYJA 2QA3A 3DR7A 2FYFA 4M2MA 4Q75A 3ASAA 4MQQA 2CB1A 2CJHA 5TF5A 3FDBA 1IAYA 3NTJA 4BQ0A 4UHMA 4WXGA 4XK1A 3HLMA 3USFA 1C7GA 2WKAA 4MSOA 2QB2A 4M2KA 4DGTA 2HUIA 1DGDA 3DR4A 1OXOA 3ELPA 2W7MA 3AOVA 1GEWA 3MAUA 4WBTA 1AY4A 1FG7A 1OHYA 8AATA 3QN6A 3LG0A 1BJOA 5FT5A 4KAMA 1BQAA 2W7EA 1YJYA 2AY6A 4XJOA 4IXZA 3EI6A 1SZUA 2D64A 1M0PA 1AMQA 3CQ6A 2E7UA 2W7DA 3WZFA 2X3LA 3FZ7A 3QM2A 3UE8A 4JEYA 4ADCA 1ELQA 1S0AA 1UKJA 1ASFA 1B5PA 1LC8A 1H0CA 2ZUKA 2Z9XA 1QISA 3UWCA 2C0RA 4KYOA 2AY3A 3ISLA 3OP7A 3FD0A 1WYTA 4WYDA 2HUFA 3NU7A 1M0OA 3A9XA 4A6TA 3H7FA 1AKBA 2C7TA 1Z7DA 2JJGA 3EUCA 4MQPA 1AX4A 3WCNA 1ARIA 1D7UA 1YAAA 3G7QA 4Y0IA 3DRDA 2AY5A 5G4IA 2DOUA 1BS0A 4WYAA 4R2NA 1D7SA 3E77A 1X28A 4ZDOA 1ORDA 3FSLA 1BW0A 2EGYA 3EI5A 1I48A 3R4TA 4MGRA 1TOKA 3RBFA 3A2BA 4ITXA 2WK9A 1AKCA 4RJYA 2E54A 1E5FA 2YOBA 1UU0A 1DFOA 1X0MA 4TV7A 1QIRA 3FRKA 3FVUA 4BA5A 3PPLA 4F5MA 3BV0A 2Z9WA 3BC8A 3HQTA 3LVLB 1WYVA 1DTYA 1OATA 4LW2A 4EMYA 1IJIA 1B9HA 3KKIA 2YKYA 4EB7A 3WKSA 2AY8A 4BHDA 2ZY4A 3JU7A 1J04A 1SF2A 2EPJA 3E2YA 1UU2A 2D63A 1GDEA 4CBSA 1ASBA 1G7WA 1XEYA 4A0GA 1M0QA 3K40A 4E77A 1D2FA 1VJOA 3RBLA 1JF9A 2V1PA 3NNKA 2AY2A 3FKDA 4B9BA 3PDBB 2R5EA 2ZC0A 2DR1A 3EI9A 4PFNA 2W7LA 1OHWA 3TQXA 5IWQA 1GC0A 3DC1A 1AHGA 2VGSA 3BN1A 1VP4A 4AO4A 2W7GA 1CZCA 1WSTA 2CSTA 1Z3ZA 5I92A 3WGBA 2X5FA 3OKSA 2VMNA 4L0OA 1YJZA 3MEBA 5G09A 3RI6A 3AEJA 2ZY3A 2YCTA 3EI7A 4IW7A 2JJHA 2D7ZA 1AIAA 3GETA 1V2EA 2C81A 1U08A 3ELEA 1O62A 1JS6A 1AAMA 2ZY5A 1BJWA 2VMTA 3MC6C 5BJ4A 3F0HA 2JISA 4AO9A 2FM1A 1M0NA 1KKPA 2HOZA 3PD6A 2DGKA 2VGZA 4ATPA 3BWNA 1M4NA 1W7LA 1AHEA 2X8UA 3ECDA 1ELUA 3EI8A 5EUEA 3GZCA 3PAAA 1WYUA 3AEMC 2X5DA 5HHYA 1ECXA 4CBRA 3B8XA 2FNUA 1LW4A 4RM1A 2HOXA 4ZLVA 1V2FA 3B1CA 2BWOA 4A6UA 4MQRA 2VMVA 5FT6A 1PFFA 3FDDA 1B8GA 1QITA 2VGTA 4E3RA 4OCAA 4XQ2A 1W7MA 2EZ2A 3ZRQA 2WK7A 5F8VA 2Z20A 3PDBA 2D61A 1JG8A 4HF8A 4IYOB 4RKCA 1CQ6A 2OGEA 2W7HA 2OGAA 3HMUA 1PG8A 4MKKA 4ZM4A 1ARGA 3ZRPA 3NYTA 1GC2A 1TOEA 1TASA 4EU1A 1H1CA 3K7YA 2F8JA 2FNIA 1W23A 3GZDC 3N5MA 4F5LA 2TPLA 1P3WA 3E6GA 3RCHA 4ZDPA 1J32A 2NMPA 2R5CB 2VMXA 4XJLA 4OMAA 4A0RA 2W8WA 3FZ6A 2Z9UA 2O0RA 2DKJA 4B98A 1ASAA 1CQ7A 1W7NA 1JS3A 1RV4A 4W1XA 4F5GA 2HP2A 1YIYA 2CH1A 3E9KA 2FN6A 1EJIA 3PJ0A 1DJ9A 4ZWVA 5DJ9A 4F5IA 4WB0A 3EIAA 5E5IA 2EO5A 3BWOA 1B5OA 1KL2A 1AY8A 3AOWA 4UHNA 1M6SA 2BI3A 3DXWA 1N8PA 3NYSA 4P3MA 4A72A 5D5SA 4GE7A 4RAEA 2ZY2A 3QHXA 3ZZJA 4LW4A 1BJNA 3AELA 2XH1A 3WCOA 1G4XA 3H14A 4O6ZA 2HUUA 4MKJA 5F9SA 1T3IA 3AV7A 2G6WA 3ZRRA 2E7JA 2YCNA 2BIEA 4N0WA 4PFFA 3DYDA 1ZOBA 1GC3A 1PMMA 3HBXA 3KGWA 4OBUA 4WLJA 4TN4A 1CL1A 1CL2A 1LS3A 1AHYA 2CANA 3VOMA 1B4XA 1TATA 2AY7A 1M32A 2AY9A 2CTZA 2D66A 3DU4A 3FQ8A 3G8MA 2W7FA 4PVFA 2C44A 2W7KA 2VI9A 2R0TA 3AATA 1SVVA 2HZPA 4UOYA 3W1HA 2VIAA 1GEYA 3AEMA 3FFRA 4W8IA 4RIZA 2GB3A 2YCPA 1OHVA 1QZ9A 4J5UA 5EAVA 1FG3A 3CQ4A 2ZJGA 4CVQA 4DQ6A 4F5FA 1DJEA 3Q8NA 3R9AA 2BKWA 2JJEA 3E2FA 3B1DA 3JTXA 2VMRA 3A8UX 4E1OA
chains in the Genus database with same CATH superfamily
1GBNA 4U2HA 3A9YA 1MGVA 3LVJA 3NUIA 1M7YA 4UQVA 2AY4A 1DGEA 3E2ZB 1MAPA 1BT4A 1YIZA 4ZM3A 2VMOA 1CQ8A 2XBNA 1KMKA 5AX8A 2W8JA 3MADA 3CAIA 3RUYA 1BQDA 3PIUA 3IHJA 2PB2A 2VLHA 3ACZA 2JJFA 4AZKA 5HDMA 5EIGB 5J8QA 4XJMA 1G7XA 1TARA 2R2NA 3MKJA 2DGLA 4Y0DA 3VP6A 1SZKA 2DKBA 3G0TA 3NRAA 1C0NA 2RFVA 5M49A 2VMYA 4NOGA 5EAAA 4IX8A 4OC9A 3W1IA 1CJ0A 1AJSB 1S08A 1N31A 4ADBA 1I43A 5DB5A 4ITGA 3BS8A 1EQBA 5EFSA 5EUNA 3RQ1A 2CJGA 1AICA 4WXFA 2DGMA 2VIBA 1C7NA 1IAXA 2JGTA 4GEBA 1TOJA 4XAUA 1S06A 2W8VA 3QPGA 4JEZA 5G2PA 4WLHA 4CXQA 1O69A 1D7VA 7AATA 2CY8A 1S07A 1MAQA 5LH9A 3FQAA 3MAFB 1AJRA 4IY7A 1WKGA 2O1BA 4AZJA 3LVKA 2AEVA 1ASNA 5C6UA 1ARSA 2EZ1A 4F5KA 4EB5A 1BJ4A 1TOGA 4HVKA 4FFCA 5BJ3A 4GSAA 2CINA 3DXVA 3L44A 1ZODA 4RITA 2QLRA 4GE9A 2VI8A 2CH2A 3E2ZA 2BI2A 3LVMA 4K2IA 4WYCA 4WYFA 3WY7A 1RVYA 1MDXA 1AMSA 1ARHA 2VGUA 3HDOA 4ISYA 1ASDA 2OKKA 2PO3A 1MDZA 4H51A 1XI9A 2Z1ZA 2D65A 4W1VA 1B9IA 2GQNA 4LNLA 1AMRA 2VMPA 4EFFA 1V2DA 3LY1A 2HP1A 3H9XA 3GBXA 1ASGA 2EYQA 1QJ3A 2YRRA 1IX7A 3B1EA 1SPAA 1Y4IA 1WYTB 2YHKA 3GWPA 4JEVA 2AEUA 4PIWA 2FKIA 2W8UA 1TOIA 4OT8A 5KTBA 1KMJA 2E7IA 4Q31A 1MLZA 3AENB 2EH6A 4JE5A 3I16A 2YRIA 1G4VA 1I41A 1VEFA 4LNJA 3VK3A 4AOAA 5DJ1A 3EZSA 2VMZA 5JAYA 4XJPA 3ZZKA 5LHAA 1DKAA 1BKGA 2GMUA 3FZ8A 2ZSLA 4RKDA 3AEOA 2YKVA 4R5ZA 2AY1A 1C9CA 3BCAA 2BI9A 2PB0A 4ZSWA 1D7RA 3M5UA 1LC7A 3JWBA 3F9TA 4CXRA 1O61A 2VMUA 3EZ1A 1C4KA 3QBOA 2Z1YA 5G2QA 3DZZA 1IVRA 3EIBA 3KGXA 4W5KA 4WP0A 3BCXA 3P1TA 1E5EA 1V72A 1ASCA 1ASEA 1WYVB 4P7YA 4I8AA 3VK4A 4N0BA 4GRXA 4A00A 1LKCA 1RV3A 1W3UA 4RLGA 3MC6A 2OQXA 3LV2A 4IYOA 3JZLA 2YKUA 2W8TA 1LC5A 4AH3A 2VYCA 3AEJC 2YKXA 4IXSA 4QGRA 2Z61A 2VMSA 2BWPA 1LK9A 3PA9A 2O7CA 3LWSA 4ATQA 3II0A 3FCRA 2BI5A 4A0FA 4M2JA 4ZASA 4MY5A 2VMWA 4U1TA 1MLYA 1AIBA 3FTBA 2R5CA 4WYEA 3GR9A 3UAKA 1ZC9A 3BWNC 2CFBA 1AHFA 1ARTA 1GD9A 3PDXA 1YNUA 3CBFA 2VLFA 3AENA 4OYTA 2D5YA 2A1VA 3NDNA 2OATA 1AKAA 3GJUA 3WGCA 4OBVA 5G4JA 3JW9A 2QB3A 4E3QA 1GCKA 3FQ7A 4F5JA 2VMQA 4JEWA 4K2BA 2ZSMA 1ASMA 1O4SA 4W1WA 1IX8A 1N2TA 1AY5A 1CS1A 3MBBA 3TFUA 1FC4A 1YJSA 3AEPA 3GZDA 4R8DA 1AAWA 1OXPA 4JEXA 5M4DA 2HORA 3PD6B 4ZSYA 1C7OA 5M46A 4ZAHA 4LNMA 3FFHA 1S09A 3BB8A 4WD2A 2GSAA 4H63Q 3KE3A 4JF0A 2QBTA 3NU8A 1IBJA 3HVYA 3TCMA 4F4EA 3BCBA 3HT4A 2GMSA 3VAXA 1WYUB 3IF2A 4UHOA 1KKJA 3QI6A 5DX5A 4DBCA 4Q6RA 1GC4A 2G7JA 3NYUA 3MAFA 5E4ZA 1MDOA 3W1JA 3WKRA 2OKJA 1LW5A 4R5FA 3T32A 3TATA 3A9ZA 3N0LA 1UU1A 4WXBA 5M4BA 2QMAA 4A6RA 2AATA 1EG5A 3K28A 3GSBA 4WYGA 1TPLA 3B46A 2ZP7A 4JE5D 5EQCA 3FVXA 2VGVA 4KXKA 2BHXA 5HXXA 2W7JA 4TMRA 1KL1A 4ADEA 2D7YA 3JWAA 1GEXA 4GDYA 3NX3A 4K2MA 2BIGA 2BI1A 1QJ5A 9AATA 2Z9VA 3WX9A 4BA4A 2FQ6A 3N75A 3D6KA 2W7IA 3FVSA 3RCHB 2Q7WA 5G0AA 3DODA 4RJ0A 4ADDA 3N4SA 1X2AA 1DJUA 5K8BA 3I4JA 2VGWA 1CZEA 1PMOA 4JF1A 3P6KA 1YOOA 3ASBA 2BYJA 1X29A 4W91A 4XEWA 1WKHA 5FT4A 3HL2A 3VK2A 3L8AA 2BYLA 1BJOB 1SZSA 3F6TA 3CQ5A 5FT8A 5D95A 1IUGA 1ASLA 5E3KA 4ZDLA 3WLXA 2V0YA 1AMAA 4OTLA 4A0HA 2ORDA 1AHXA 3NUBA 1I29A 2WK8A 3COGA 4FL0A 4WB0B 5EIGA 2CJDA 4F5HA 3QGUA 1RVUA 4LC3A 5EUDA 4Q76A 1SFFA 2HOYA 1IX6A 2Z67A 3ATHA 3PGYA 4ZWMA 4IXOA 4Y0HA 3N7NA 2BWNA 3I5TA 1AJSA 3TFTA 4J8LA 1QGNA 2BIAA 4BMKA 4GE4A 2JG2A 2ZYJA 2QA3A 3DR7A 2FYFA 4M2MA 4Q75A 3ASAA 4MQQA 2CB1A 2CJHA 5TF5A 3FDBA 1IAYA 3NTJA 4BQ0A 4UHMA 4WXGA 4XK1A 3HLMA 3USFA 1C7GA 2WKAA 4MSOA 2QB2A 4M2KA 4DGTA 2HUIA 1DGDA 3DR4A 1OXOA 3ELPA 2W7MA 3AOVA 1GEWA 3MAUA 4WBTA 1AY4A 1FG7A 1OHYA 8AATA 3QN6A 3LG0A 1BJOA 5FT5A 3N4XA 4KAMA 1BQAA 2W7EA 1YJYA 2AY6A 4XJOA 4IXZA 3EI6A 1SZUA 2D64A 1M0PA 1AMQA 3CQ6A 2E7UA 2W7DA 3WZFA 2X3LA 3FZ7A 3QM2A 3UE8A 4JEYA 4ADCA 1ELQA 1S0AA 1UKJA 1ASFA 1B5PA 1LC8A 1H0CA 2ZUKA 2Z9XA 1QISA 3UWCA 2C0RA 4KYOA 2AY3A 3ISLA 3OP7A 3FD0A 1WYTA 4WYDA 2HUFA 3NU7A 4K05A 1M0OA 3A9XA 4A6TA 3H7FA 1AKBA 2C7TA 1Z7DA 2JJGA 3EUCA 4MQPA 1AX4A 3WCNA 1ARIA 1D7UA 1YAAA 3G7QA 4Y0IA 3DRDA 2AY5A 5G4IA 2DOUA 1BS0A 4WYAA 4R2NA 1D7SA 3E77A 1X28A 4ZDOA 1ORDA 3FSLA 1BW0A 2EGYA 3EI5A 1I48A 3R4TA 4MGRA 1TOKA 3RBFA 3A2BA 4ITXA 2WK9A 1AKCA 4RJYA 2E54A 1E5FA 2YOBA 1UU0A 1DFOA 1X0MA 4TV7A 1QIRA 3FRKA 3FVUA 4BA5A 3PPLA 4F5MA 3BV0A 2Z9WA 3BC8A 3HQTA 3LVLB 1WYVA 1DTYA 1OATA 4LW2A 4EMYA 1IJIA 1B9HA 3KKIA 2YKYA 4EB7A 3WKSA 2AY8A 4BHDA 2ZY4A 3JU7A 1J04A 1SF2A 2EPJA 3E2YA 1UU2A 2D63A 1GDEA 4CBSA 1ASBA 1G7WA 1XEYA 4A0GA 1M0QA 3K40A 4E77A 1D2FA 1VJOA 3RBLA 1JF9A 2V1PA 3NNKA 2AY2A 3FKDA 4B9BA 3PDBB 2R5EA 2ZC0A 2DR1A 3EI9A 4PFNA 2W7LA 1OHWA 3TQXA 2QSRA 5IWQA 1GC0A 3DC1A 1AHGA 2VGSA 3BN1A 1KAFA 1VP4A 4AO4A 2W7GA 1CZCA 1WSTA 2CSTA 1Z3ZA 5I92A 3WGBA 2X5FA 2WB6A 3OKSA 2VMNA 4L0OA 1YJZA 3MEBA 5G09A 3RI6A 3AEJA 2ZY3A 2YCTA 3EI7A 4IW7A 2JJHA 2D7ZA 1AIAA 3GETA 1V2EA 2C81A 1U08A 3ELEA 1O62A 1JS6A 1AAMA 2ZY5A 1BJWA 2VMTA 3MC6C 5BJ4A 3F0HA 2JISA 4AO9A 2FM1A 1M0NA 1KKPA 2HOZA 3PD6A 2DGKA 2VGZA 4ATPA 3BWNA 1M4NA 1W7LA 1AHEA 2X8UA 3ECDA 1ELUA 3EI8A 5EUEA 3GZCA 3PAAA 1WYUA 3AEMC 2X5DA 5HHYA 1ECXA 4CBRA 3B8XA 2FNUA 1LW4A 4RM1A 2HOXA 4ZLVA 1V2FA 3B1CA 2BWOA 4A6UA 4MQRA 2VMVA 5FT6A 1PFFA 3FDDA 1B8GA 1QITA 2VGTA 4E3RA 4OCAA 4XQ2A 1W7MA 2EZ2A 3ZRQA 2WK7A 5F8VA 2Z20A 3PDBA 2D61A 1JG8A 4HF8A 4IYOB 4RKCA 1CQ6A 2OGEA 2W7HA 2OGAA 3HMUA 1PG8A 4MKKA 4ZM4A 1ARGA 3ZRPA 3NYTA 1GC2A 1TOEA 1TASA 4EU1A 1H1CA 3K7YA 2F8JA 2FNIA 1W23A 3GZDC 3N5MA 4F5LA 2TPLA 1P3WA 3E6GA 3RCHA 4ZDPA 1J32A 2NMPA 2R5CB 2VMXA 4XJLA 4OMAA 4A0RA 2W8WA 3FZ6A 2Z9UA 2O0RA 2KFPA 2DKJA 4B98A 1ASAA 1CQ7A 1W7NA 1JS3A 1RV4A 4W1XA 4F5GA 2HP2A 1YIYA 2CH1A 3E9KA 2FN6A 1EJIA 3PJ0A 1DJ9A 4ZWVA 5DJ9A 4F5IA 4WB0A 3EIAA 5E5IA 2EO5A 3BWOA 1B5OA 1KL2A 1AY8A 3AOWA 4UHNA 1M6SA 2BI3A 3DXWA 1N8PA 3NYSA 4P3MA 4A72A 5D5SA 4GE7A 4RAEA 2ZY2A 3QHXA 3ZZJA 4LW4A 1BJNA 3AELA 2XH1A 3WCOA 1G4XA 3H14A 4O6ZA 2HUUA 4MKJA 5F9SA 1T3IA 3AV7A 2G6WA 3ZRRA 2E7JA 2YCNA 2BIEA 4N0WA 4PFFA 3DYDA 1ZOBA 1GC3A 1PMMA 3HBXA 3KGWA 4OBUA 4WLJA 4TN4A 1CL1A 1CL2A 1LS3A 1AHYA 2CANA 3VOMA 1B4XA 1TATA 2AY7A 1M32A 2AY9A 2CTZA 2D66A 3DU4A 3FQ8A 3G8MA 3N4RA 2W7FA 4PVFA 2C44A 2W7KA 2VI9A 2R0TA 3AATA 1SVVA 2HZPA 4UOYA 3W1HA 2VIAA 1GEYA 3AEMA 3FFRA 4W8IA 4RIZA 2GB3A 2YCPA 1OHVA 1QZ9A 4J5UA 5EAVA 1FG3A 3CQ4A 2ZJGA 4CVQA 4DQ6A 4F5FA 1DJEA 3Q8NA 3R9AA 2BKWA 2JJEA 3E2FA 3B1DA 3JTXA 2VMRA 3A8UX 4E1OA
chains in the Genus database with same CATH topology
1GBNA 4U2HA 3A9YA 1MGVA 3LVJA 3NUIA 1M7YA 4UQVA 2AY4A 1DGEA 3E2ZB 1MAPA 1BT4A 1YIZA 4ZM3A 2VMOA 1CQ8A 2XBNA 1KMKA 5AX8A 2W8JA 3MADA 3CAIA 3RUYA 1BQDA 3PIUA 3IHJA 2PB2A 2VLHA 3ACZA 2JJFA 4AZKA 5HDMA 5EIGB 5J8QA 4XJMA 1G7XA 1TARA 2R2NA 3MKJA 2DGLA 4Y0DA 3VP6A 1SZKA 2DKBA 3G0TA 3NRAA 1C0NA 2RFVA 5M49A 2VMYA 4NOGA 5EAAA 4IX8A 4OC9A 3W1IA 1CJ0A 1AJSB 1S08A 1N31A 4ADBA 1I43A 5DB5A 4ITGA 3BS8A 1EQBA 5EFSA 5EUNA 3RQ1A 2CJGA 1AICA 4WXFA 2DGMA 2VIBA 1C7NA 1IAXA 2JGTA 4GEBA 1TOJA 4XAUA 1S06A 2W8VA 3QPGA 4JEZA 5G2PA 4WLHA 4CXQA 1O69A 1D7VA 7AATA 2CY8A 1S07A 1MAQA 5LH9A 3FQAA 3MAFB 1AJRA 4IY7A 1WKGA 2O1BA 4AZJA 3LVKA 2AEVA 1ASNA 5C6UA 1ARSA 2EZ1A 4F5KA 4EB5A 1BJ4A 1TOGA 4HVKA 4FFCA 5BJ3A 4GSAA 2CINA 3DXVA 3L44A 1ZODA 4RITA 2QLRA 4GE9A 2VI8A 2CH2A 3E2ZA 2BI2A 3LVMA 4K2IA 4WYCA 4WYFA 3WY7A 1RVYA 1MDXA 1AMSA 1ARHA 2VGUA 3HDOA 4ISYA 1ASDA 2OKKA 2PO3A 1MDZA 4H51A 1XI9A 2Z1ZA 2D65A 4W1VA 1B9IA 2GQNA 4LNLA 1AMRA 2VMPA 4EFFA 1V2DA 3LY1A 2HP1A 3H9XA 3GBXA 1ASGA 2EYQA 1QJ3A 2YRRA 1IX7A 3B1EA 1SPAA 1Y4IA 1WYTB 2YHKA 3GWPA 4JEVA 2AEUA 4PIWA 2FKIA 2W8UA 1TOIA 4OT8A 5KTBA 1KMJA 2E7IA 4Q31A 1MLZA 3AENB 2EH6A 4JE5A 3I16A 2YRIA 1G4VA 1I41A 1VEFA 4LNJA 3VK3A 4AOAA 5DJ1A 3EZSA 2VMZA 5JAYA 4XJPA 3ZZKA 5LHAA 1DKAA 1BKGA 2GMUA 3FZ8A 2ZSLA 4RKDA 3AEOA 2YKVA 4R5ZA 2AY1A 1C9CA 3BCAA 2BI9A 2PB0A 4ZSWA 1D7RA 3M5UA 1LC7A 3JWBA 3F9TA 4CXRA 1O61A 2VMUA 3EZ1A 1C4KA 3QBOA 2Z1YA 5G2QA 3DZZA 1IVRA 3EIBA 3KGXA 4W5KA 4WP0A 3BCXA 3P1TA 1E5EA 1V72A 1ASCA 1ASEA 1WYVB 4P7YA 4I8AA 3VK4A 4N0BA 4GRXA 4A00A 1LKCA 1RV3A 1W3UA 4RLGA 3MC6A 2OQXA 3LV2A 4IYOA 3JZLA 2YKUA 2W8TA 1LC5A 4AH3A 2VYCA 3AEJC 2YKXA 4IXSA 4QGRA 2Z61A 2VMSA 2BWPA 1LK9A 3PA9A 2O7CA 3LWSA 4ATQA 3II0A 3FCRA 2BI5A 4A0FA 4M2JA 4ZASA 4MY5A 2VMWA 4U1TA 1MLYA 1AIBA 3FTBA 2R5CA 4WYEA 3GR9A 3UAKA 1ZC9A 3BWNC 2CFBA 1AHFA 1ARTA 1GD9A 3PDXA 1YNUA 3CBFA 2VLFA 3AENA 4OYTA 2D5YA 2A1VA 3NDNA 2OATA 1AKAA 3GJUA 3WGCA 4OBVA 5G4JA 3JW9A 2QB3A 4E3QA 1GCKA 3FQ7A 4F5JA 2VMQA 4JEWA 4K2BA 2ZSMA 1ASMA 1O4SA 4W1WA 1IX8A 1N2TA 1AY5A 1CS1A 3MBBA 3TFUA 1FC4A 1YJSA 3AEPA 3GZDA 4R8DA 1AAWA 1OXPA 4JEXA 5M4DA 2HORA 3PD6B 4ZSYA 1C7OA 5M46A 4ZAHA 4LNMA 3FFHA 1S09A 3BB8A 4WD2A 2GSAA 4H63Q 3KE3A 4JF0A 2QBTA 3NU8A 1IBJA 3HVYA 3TCMA 4F4EA 3BCBA 3HT4A 2GMSA 3VAXA 1WYUB 3IF2A 4UHOA 1KKJA 3QI6A 5DX5A 4DBCA 4Q6RA 1GC4A 2G7JA 3NYUA 3MAFA 5E4ZA 1MDOA 3W1JA 3WKRA 2OKJA 1LW5A 4R5FA 3T32A 3TATA 3A9ZA 3N0LA 1UU1A 4WXBA 5M4BA 2QMAA 4A6RA 2AATA 1EG5A 3K28A 3GSBA 4WYGA 1TPLA 3B46A 2ZP7A 4JE5D 5EQCA 3FVXA 2VGVA 4KXKA 2BHXA 5HXXA 2W7JA 4TMRA 1KL1A 4ADEA 2D7YA 3JWAA 1GEXA 4GDYA 3NX3A 4K2MA 2BIGA 2BI1A 1QJ5A 9AATA 2Z9VA 3WX9A 4BA4A 2FQ6A 3N75A 3D6KA 2W7IA 3FVSA 3RCHB 2Q7WA 5G0AA 3DODA 4RJ0A 4ADDA 3N4SA 1X2AA 1DJUA 5K8BA 3I4JA 2VGWA 1CZEA 1PMOA 4JF1A 3P6KA 1YOOA 3ASBA 2BYJA 1X29A 4W91A 4XEWA 1WKHA 5FT4A 3HL2A 3VK2A 3L8AA 2BYLA 1BJOB 1SZSA 3F6TA 3CQ5A 5FT8A 5D95A 1IUGA 1ASLA 5E3KA 4ZDLA 3WLXA 2V0YA 1AMAA 4OTLA 4A0HA 2ORDA 1AHXA 3NUBA 1I29A 2WK8A 3COGA 4FL0A 4WB0B 5EIGA 2CJDA 4F5HA 3QGUA 1RVUA 4LC3A 5EUDA 4Q76A 1SFFA 2HOYA 1IX6A 2Z67A 3ATHA 3PGYA 4ZWMA 4IXOA 4Y0HA 3N7NA 2BWNA 3I5TA 1AJSA 3TFTA 4J8LA 1QGNA 2BIAA 4BMKA 4GE4A 2JG2A 2ZYJA 2QA3A 3DR7A 2FYFA 4M2MA 4Q75A 3ASAA 4MQQA 2CB1A 2CJHA 5TF5A 3FDBA 1IAYA 3NTJA 4BQ0A 4UHMA 4WXGA 4XK1A 3HLMA 3USFA 1C7GA 2WKAA 4MSOA 2QB2A 4M2KA 4DGTA 2HUIA 1DGDA 3DR4A 1OXOA 3ELPA 2W7MA 3AOVA 1GEWA 3MAUA 4WBTA 1AY4A 1FG7A 1OHYA 8AATA 3QN6A 3LG0A 1BJOA 5FT5A 3N4XA 4KAMA 1BQAA 2W7EA 1YJYA 2AY6A 4XJOA 4IXZA 3EI6A 1SZUA 2D64A 1M0PA 1AMQA 3CQ6A 2E7UA 2W7DA 3WZFA 2X3LA 3FZ7A 3QM2A 3UE8A 4JEYA 4ADCA 1ELQA 1S0AA 1UKJA 1ASFA 1B5PA 1LC8A 1H0CA 2ZUKA 2Z9XA 1QISA 3UWCA 2C0RA 4KYOA 2AY3A 3ISLA 3OP7A 3FD0A 1WYTA 4WYDA 2HUFA 3NU7A 4K05A 1M0OA 3A9XA 4A6TA 3H7FA 1AKBA 2C7TA 1Z7DA 2JJGA 3EUCA 4MQPA 1AX4A 3WCNA 1ARIA 1D7UA 1YAAA 3G7QA 4Y0IA 3DRDA 2AY5A 5G4IA 2DOUA 1BS0A 4WYAA 4R2NA 1D7SA 3E77A 1X28A 4ZDOA 1ORDA 3FSLA 1BW0A 2EGYA 3EI5A 1I48A 3R4TA 4MGRA 1TOKA 3RBFA 3A2BA 4ITXA 2WK9A 1AKCA 4RJYA 2E54A 1E5FA 2YOBA 1UU0A 1DFOA 1X0MA 4TV7A 1QIRA 3FRKA 3FVUA 4BA5A 3PPLA 4F5MA 3BV0A 2Z9WA 3BC8A 3HQTA 3LVLB 1WYVA 1DTYA 1OATA 4LW2A 4EMYA 1IJIA 1B9HA 3KKIA 2YKYA 4EB7A 3WKSA 2AY8A 4BHDA 2ZY4A 3JU7A 1J04A 1SF2A 2EPJA 3E2YA 1UU2A 2D63A 1GDEA 4CBSA 1ASBA 1G7WA 1XEYA 4A0GA 1M0QA 3K40A 4E77A 1D2FA 1VJOA 3RBLA 1JF9A 2V1PA 3NNKA 2AY2A 3FKDA 4B9BA 3PDBB 2R5EA 2ZC0A 2DR1A 3EI9A 4PFNA 2W7LA 1OHWA 3TQXA 2QSRA 5IWQA 1GC0A 3DC1A 1AHGA 2VGSA 3BN1A 1VP4A 4AO4A 2W7GA 1CZCA 1WSTA 2CSTA 1Z3ZA 5I92A 3WGBA 2X5FA 2WB6A 3OKSA 2VMNA 4L0OA 1YJZA 3MEBA 5G09A 3RI6A 3AEJA 2ZY3A 2YCTA 3EI7A 4IW7A 2JJHA 2D7ZA 1AIAA 3GETA 1V2EA 2C81A 1U08A 3ELEA 1O62A 1JS6A 1AAMA 2ZY5A 1BJWA 2VMTA 3MC6C 5BJ4A 3F0HA 2JISA 4AO9A 2FM1A 1M0NA 1KKPA 2HOZA 3PD6A 2DGKA 2VGZA 4ATPA 3BWNA 1M4NA 1W7LA 1AHEA 2X8UA 3ECDA 1ELUA 3EI8A 5EUEA 3GZCA 3PAAA 1WYUA 3AEMC 2X5DA 5HHYA 1ECXA 4CBRA 3B8XA 2FNUA 1LW4A 4RM1A 2HOXA 4ZLVA 1V2FA 3B1CA 2BWOA 4A6UA 4MQRA 2VMVA 5FT6A 1PFFA 3FDDA 1B8GA 1QITA 2VGTA 4E3RA 4OCAA 4XQ2A 1W7MA 2EZ2A 3ZRQA 2WK7A 5F8VA 2Z20A 3PDBA 2D61A 1JG8A 4HF8A 4IYOB 4RKCA 1CQ6A 2OGEA 2W7HA 2OGAA 3HMUA 1PG8A 4MKKA 4ZM4A 1ARGA 3ZRPA 3NYTA 1GC2A 1TOEA 1TASA 4EU1A 1H1CA 3K7YA 2F8JA 2FNIA 1W23A 3GZDC 3N5MA 4F5LA 2TPLA 1P3WA 3E6GA 3RCHA 4ZDPA 1J32A 2NMPA 2R5CB 2VMXA 4XJLA 4OMAA 4A0RA 2W8WA 3FZ6A 2Z9UA 2O0RA 2KFPA 2DKJA 4B98A 1ASAA 1CQ7A 1W7NA 1JS3A 1RV4A 4W1XA 4F5GA 2HP2A 1YIYA 2CH1A 3E9KA 2FN6A 1EJIA 3PJ0A 1DJ9A 4ZWVA 5DJ9A 4F5IA 4WB0A 3EIAA 5E5IA 2EO5A 3BWOA 1B5OA 1KL2A 1AY8A 3AOWA 4UHNA 1M6SA 2BI3A 3DXWA 1N8PA 3NYSA 4P3MA 4A72A 5D5SA 4GE7A 4RAEA 2ZY2A 3QHXA 3ZZJA 4LW4A 1BJNA 3AELA 2XH1A 3WCOA 1G4XA 3H14A 4O6ZA 2HUUA 4MKJA 5F9SA 1T3IA 3AV7A 2G6WA 3ZRRA 2E7JA 2YCNA 2BIEA 4N0WA 4PFFA 3DYDA 1ZOBA 1GC3A 1PMMA 3HBXA 3KGWA 4OBUA 4WLJA 4TN4A 1CL1A 1CL2A 1LS3A 1AHYA 2CANA 3VOMA 1B4XA 1TATA 2AY7A 1M32A 2AY9A 2CTZA 2D66A 3DU4A 3FQ8A 3G8MA 3N4RA 2W7FA 4PVFA 2C44A 2W7KA 2VI9A 2R0TA 3AATA 1SVVA 2HZPA 4UOYA 3W1HA 2VIAA 1GEYA 3AEMA 3FFRA 4W8IA 4RIZA 2GB3A 2YCPA 1OHVA 1QZ9A 4J5UA 5EAVA 1FG3A 3CQ4A 2ZJGA 4CVQA 4DQ6A 4F5FA 1DJEA 3Q8NA 3R9AA 2BKWA 2JJEA 3E2FA 3B1DA 3JTXA 2VMRA 3A8UX 4E1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GBN A;  4U2H A;  3A9Y A;  1MGV A;  3LVJ A;  3NUI A;  1M7Y A;  4UQV A;  2AY4 A;  1DGE A;  3E2Z B;  1MAP A;  1BT4 A;  1YIZ A;  4ZM3 A;  2VMO A;  1CQ8 A;  2XBN A;  1KMK A;  5AX8 A;  2W8J A;  3MAD A;  3CAI A;  3RUY A;  1BQD A;  3PIU A;  3IHJ A;  2PB2 A;  2VLH A;  3ACZ A;  2JJF A;  4AZK A;  5HDM A;  5EIG B;  5J8Q A;  4XJM A;  1G7X A;  1TAR A;  2R2N A;  3MKJ A;  2DGL A;  4Y0D A;  3VP6 A;  1SZK A;  2DKB A;  3G0T A;  3NRA A;  1C0N A;  2RFV A;  5M49 A;  2VMY A;  4NOG A;  5EAA A;  4IX8 A;  4OC9 A;  3W1I A;  1CJ0 A;  1AJS B;  1S08 A;  1N31 A;  4ADB A;  1I43 A;  5DB5 A;  4ITG A;  3BS8 A;  1EQB A;  5EFS A;  5EUN A;  3RQ1 A;  2CJG A;  1AIC A;  4WXF A;  2DGM A;  2VIB A;  1C7N A;  1IAX A;  2JGT A;  4GEB A;  1TOJ A;  4XAU A;  1S06 A;  2W8V A;  3QPG A;  4JEZ A;  5G2P A;  4WLH A;  4CXQ A;  1O69 A;  1D7V A;  7AAT A;  2CY8 A;  1S07 A;  1MAQ A;  5LH9 A;  3FQA A;  3MAF B;  1AJR A;  4IY7 A;  1WKG A;  2O1B A;  4AZJ A;  3LVK A;  2AEV A;  1ASN A;  5C6U A;  1ARS A;  2EZ1 A;  4F5K A;  4EB5 A;  1BJ4 A;  1TOG A;  4HVK A;  4FFC A;  5BJ3 A;  4GSA A;  2CIN A;  3DXV A;  3L44 A;  1ZOD A;  4RIT A;  2QLR A;  4GE9 A;  2VI8 A;  2CH2 A;  3E2Z A;  2BI2 A;  3LVM A;  4K2I A;  4WYC A;  4WYF A;  3WY7 A;  1RVY A;  1MDX A;  1AMS A;  1ARH A;  2VGU A;  3HDO A;  4ISY A;  1ASD A;  2OKK A;  2PO3 A;  1MDZ A;  4H51 A;  1XI9 A;  2Z1Z A;  2D65 A;  4W1V A;  1B9I A;  2GQN A;  4LNL A;  1AMR A;  2VMP A;  4EFF A;  1V2D A;  3LY1 A;  2HP1 A;  3GBX A;  1ASG A;  1QJ3 A;  2YRR A;  1IX7 A;  3B1E A;  1SPA A;  1Y4I A;  1WYT B;  2YHK A;  3GWP A;  4JEV A;  2AEU A;  4PIW A;  2W8U A;  1TOI A;  4OT8 A;  1KMJ A;  2E7I A;  4Q31 A;  1MLZ A;  3AEN B;  2EH6 A;  4JE5 A;  3I16 A;  2YRI A;  1G4V A;  1I41 A;  1VEF A;  4LNJ A;  3VK3 A;  4AOA A;  5DJ1 A;  3EZS A;  2VMZ A;  5JAY A;  4XJP A;  3ZZK A;  5LHA A;  1DKA A;  1BKG A;  2GMU A;  3FZ8 A;  2ZSL A;  4RKD A;  3AEO A;  2YKV A;  4R5Z A;  2AY1 A;  1C9C A;  3BCA A;  2BI9 A;  2PB0 A;  4ZSW A;  1D7R A;  3M5U A;  1LC7 A;  3JWB A;  3F9T A;  4CXR A;  1O61 A;  2VMU A;  3EZ1 A;  1C4K A;  3QBO A;  2Z1Y A;  5G2Q A;  3DZZ A;  1IVR A;  3EIB A;  3KGX A;  4W5K A;  4WP0 A;  3BCX A;  3P1T A;  1E5E A;  1V72 A;  1ASC A;  1ASE A;  1WYV B;  4P7Y A;  4I8A A;  3VK4 A;  4N0B A;  4GRX A;  4A00 A;  1LKC A;  1RV3 A;  1W3U A;  4RLG A;  3MC6 A;  2OQX A;  3LV2 A;  4IYO A;  3JZL A;  2YKU A;  2W8T A;  1LC5 A;  4AH3 A;  2VYC A;  3AEJ C;  2YKX A;  4IXS A;  4QGR A;  2Z61 A;  2VMS A;  2BWP A;  1LK9 A;  3PA9 A;  2O7C A;  3LWS A;  4ATQ A;  3II0 A;  3FCR A;  2BI5 A;  4A0F A;  4M2J A;  4ZAS A;  4MY5 A;  2VMW A;  4U1T A;  1MLY A;  1AIB A;  3FTB A;  2R5C A;  4WYE A;  3GR9 A;  3UAK A;  1ZC9 A;  3BWN C;  2CFB A;  1AHF A;  1ART A;  1GD9 A;  3PDX A;  1YNU A;  3CBF A;  2VLF A;  3AEN A;  4OYT A;  2D5Y A;  3NDN A;  2OAT A;  1AKA A;  3GJU A;  3WGC A;  4OBV A;  5G4J A;  3JW9 A;  2QB3 A;  4E3Q A;  1GCK A;  3FQ7 A;  4F5J A;  2VMQ A;  4JEW A;  4K2B A;  2ZSM A;  1ASM A;  1O4S A;  4W1W A;  1IX8 A;  1N2T A;  1AY5 A;  1CS1 A;  3MBB A;  3TFU A;  1FC4 A;  1YJS A;  3AEP A;  3GZD A;  4R8D A;  1AAW A;  1OXP A;  4JEX A;  5M4D A;  2HOR A;  3PD6 B;  4ZSY A;  1C7O A;  5M46 A;  4ZAH A;  4LNM A;  3FFH A;  1S09 A;  3BB8 A;  4WD2 A;  2GSA A;  3KE3 A;  4JF0 A;  2QBT A;  3NU8 A;  1IBJ A;  3HVY A;  3TCM A;  4F4E A;  3BCB A;  3HT4 A;  2GMS A;  3VAX A;  1WYU B;  3IF2 A;  4UHO A;  1KKJ A;  3QI6 A;  5DX5 A;  4DBC A;  4Q6R A;  1GC4 A;  3NYU A;  3MAF A;  5E4Z A;  1MDO A;  3W1J A;  3WKR A;  2OKJ A;  1LW5 A;  4R5F A;  3T32 A;  3TAT A;  3A9Z A;  3N0L A;  1UU1 A;  4WXB A;  5M4B A;  2QMA A;  4A6R A;  2AAT A;  1EG5 A;  3K28 A;  3GSB A;  4WYG A;  1TPL A;  3B46 A;  2ZP7 A;  4JE5 D;  5EQC A;  3FVX A;  2VGV A;  4KXK A;  2BHX A;  5HXX A;  2W7J A;  4TMR A;  1KL1 A;  4ADE A;  2D7Y A;  3JWA A;  1GEX A;  4GDY A;  3NX3 A;  4K2M A;  2BIG A;  2BI1 A;  1QJ5 A;  9AAT A;  2Z9V A;  3WX9 A;  4BA4 A;  2FQ6 A;  3N75 A;  3D6K A;  2W7I A;  3FVS A;  3RCH B;  2Q7W A;  5G0A A;  3DOD A;  4RJ0 A;  4ADD A;  1X2A A;  1DJU A;  5K8B A;  3I4J A;  2VGW A;  1CZE A;  1PMO A;  4JF1 A;  3P6K A;  1YOO A;  3ASB A;  2BYJ A;  1X29 A;  4W91 A;  4XEW A;  1WKH A;  5FT4 A;  3HL2 A;  3VK2 A;  3L8A A;  2BYL A;  1BJO B;  1SZS A;  3F6T A;  3CQ5 A;  5FT8 A;  5D95 A;  1IUG A;  1ASL A;  5E3K A;  4ZDL A;  3WLX A;  2V0Y A;  1AMA A;  4OTL A;  4A0H A;  2ORD A;  1AHX A;  3NUB A;  1I29 A;  2WK8 A;  3COG A;  4FL0 A;  4WB0 B;  5EIG A;  2CJD A;  4F5H A;  3QGU A;  1RVU A;  4LC3 A;  5EUD A;  4Q76 A;  1SFF A;  2HOY A;  1IX6 A;  2Z67 A;  3ATH A;  3PGY A;  4ZWM A;  4IXO A;  4Y0H A;  2BWN A;  3I5T A;  1AJS A;  3TFT A;  4J8L A;  1QGN A;  2BIA A;  4BMK A;  4GE4 A;  2JG2 A;  2ZYJ A;  2QA3 A;  3DR7 A;  2FYF A;  4M2M A;  4Q75 A;  3ASA A;  4MQQ A;  2CB1 A;  2CJH A;  5TF5 A;  3FDB A;  1IAY A;  3NTJ A;  4BQ0 A;  4UHM A;  4WXG A;  4XK1 A;  3HLM A;  3USF A;  1C7G A;  2WKA A;  4MSO A;  2QB2 A;  4M2K A;  4DGT A;  2HUI A;  1DGD A;  3DR4 A;  1OXO A;  3ELP A;  2W7M A;  3AOV A;  1GEW A;  3MAU A;  4WBT A;  1AY4 A;  1FG7 A;  1OHY A;  8AAT A;  3QN6 A;  3LG0 A;  1BJO A;  5FT5 A;  4KAM A;  1BQA A;  2W7E A;  1YJY A;  2AY6 A;  4XJO A;  4IXZ A;  3EI6 A;  1SZU A;  2D64 A;  1M0P A;  1AMQ A;  3CQ6 A;  2E7U A;  2W7D A;  3WZF A;  2X3L A;  3FZ7 A;  3QM2 A;  3UE8 A;  4JEY A;  4ADC A;  1ELQ A;  1S0A A;  1UKJ A;  1ASF A;  1B5P A;  1LC8 A;  1H0C A;  2ZUK A;  2Z9X A;  1QIS A;  3UWC A;  2C0R A;  4KYO A;  2AY3 A;  3ISL A;  3OP7 A;  3FD0 A;  1WYT A;  4WYD A;  2HUF A;  3NU7 A;  1M0O A;  3A9X A;  4A6T A;  3H7F A;  1AKB A;  2C7T A;  1Z7D A;  2JJG A;  3EUC A;  4MQP A;  1AX4 A;  3WCN A;  1ARI A;  1D7U A;  1YAA A;  3G7Q A;  4Y0I A;  3DRD A;  2AY5 A;  5G4I A;  2DOU A;  1BS0 A;  4WYA A;  4R2N A;  1D7S A;  3E77 A;  1X28 A;  4ZDO A;  1ORD A;  3FSL A;  1BW0 A;  2EGY A;  3EI5 A;  1I48 A;  3R4T A;  4MGR A;  1TOK A;  3RBF A;  3A2B A;  4ITX A;  2WK9 A;  1AKC A;  4RJY A;  2E54 A;  1E5F A;  2YOB A;  1UU0 A;  1DFO A;  1X0M A;  4TV7 A;  1QIR A;  3FRK A;  3FVU A;  4BA5 A;  3PPL A;  4F5M A;  3BV0 A;  2Z9W A;  3BC8 A;  3HQT A;  3LVL B;  1WYV A;  1DTY A;  1OAT A;  4LW2 A;  4EMY A;  1IJI A;  1B9H A;  3KKI A;  2YKY A;  4EB7 A;  3WKS A;  2AY8 A;  4BHD A;  2ZY4 A;  3JU7 A;  1J04 A;  1SF2 A;  2EPJ A;  3E2Y A;  1UU2 A;  2D63 A;  1GDE A;  4CBS A;  1ASB A;  1G7W A;  1XEY A;  4A0G A;  1M0Q A;  3K40 A;  4E77 A;  1D2F A;  1VJO A;  3RBL A;  1JF9 A;  2V1P A;  3NNK A;  2AY2 A;  3FKD A;  4B9B A;  3PDB B;  2R5E A;  2ZC0 A;  2DR1 A;  3EI9 A;  4PFN A;  2W7L A;  1OHW A;  3TQX A;  5IWQ A;  1GC0 A;  3DC1 A;  1AHG A;  2VGS A;  3BN1 A;  1VP4 A;  4AO4 A;  2W7G A;  1CZC A;  1WST A;  2CST A;  1Z3Z A;  5I92 A;  3WGB A;  2X5F A;  3OKS A;  2VMN A;  4L0O A;  1YJZ A;  3MEB A;  5G09 A;  3RI6 A;  3AEJ A;  2ZY3 A;  2YCT A;  3EI7 A;  4IW7 A;  2JJH A;  2D7Z A;  1AIA A;  3GET A;  1V2E A;  2C81 A;  1U08 A;  3ELE A;  1O62 A;  1JS6 A;  1AAM A;  2ZY5 A;  1BJW A;  2VMT A;  3MC6 C;  5BJ4 A;  3F0H A;  2JIS A;  4AO9 A;  2FM1 A;  1M0N A;  1KKP A;  2HOZ A;  3PD6 A;  2DGK A;  2VGZ A;  4ATP A;  3BWN A;  1M4N A;  1W7L A;  1AHE A;  2X8U A;  3ECD A;  1ELU A;  3EI8 A;  5EUE A;  3GZC A;  3PAA A;  1WYU A;  3AEM C;  2X5D A;  5HHY A;  1ECX A;  4CBR A;  3B8X A;  2FNU A;  1LW4 A;  4RM1 A;  2HOX A;  4ZLV A;  1V2F A;  3B1C A;  2BWO A;  4A6U A;  4MQR A;  2VMV A;  5FT6 A;  1PFF A;  3FDD A;  1B8G A;  1QIT A;  2VGT A;  4E3R A;  4OCA A;  4XQ2 A;  1W7M A;  2EZ2 A;  3ZRQ A;  2WK7 A;  5F8V A;  2Z20 A;  3PDB A;  2D61 A;  1JG8 A;  4HF8 A;  4IYO B;  4RKC A;  1CQ6 A;  2OGE A;  2W7H A;  2OGA A;  3HMU A;  1PG8 A;  4MKK A;  4ZM4 A;  1ARG A;  3ZRP A;  3NYT A;  1GC2 A;  1TOE A;  1TAS A;  4EU1 A;  1H1C A;  3K7Y A;  2F8J A;  2FNI A;  1W23 A;  3GZD C;  3N5M A;  4F5L A;  2TPL A;  1P3W A;  3E6G A;  3RCH A;  4ZDP A;  1J32 A;  2NMP A;  2R5C B;  2VMX A;  4XJL A;  4OMA A;  4A0R A;  2W8W A;  3FZ6 A;  2Z9U A;  2O0R A;  2DKJ A;  4B98 A;  1ASA A;  1CQ7 A;  1W7N A;  1JS3 A;  1RV4 A;  4W1X A;  4F5G A;  2HP2 A;  1YIY A;  2CH1 A;  3E9K A;  2FN6 A;  1EJI A;  3PJ0 A;  1DJ9 A;  4ZWV A;  5DJ9 A;  4F5I A;  4WB0 A;  3EIA A;  5E5I A;  2EO5 A;  3BWO A;  1B5O A;  1KL2 A;  1AY8 A;  3AOW A;  4UHN A;  1M6S A;  2BI3 A;  3DXW A;  1N8P A;  3NYS A;  4P3M A;  4A72 A;  5D5S A;  4GE7 A;  4RAE A;  2ZY2 A;  3QHX A;  3ZZJ A;  4LW4 A;  1BJN A;  3AEL A;  2XH1 A;  3WCO A;  1G4X A;  3H14 A;  4O6Z A;  2HUU A;  4MKJ A;  5F9S A;  1T3I A;  3AV7 A;  2G6W A;  3ZRR A;  2E7J A;  2YCN A;  2BIE A;  4N0W A;  4PFF A;  3DYD A;  1ZOB A;  1GC3 A;  1PMM A;  3HBX A;  3KGW A;  4OBU A;  4WLJ A;  4TN4 A;  1CL1 A;  1CL2 A;  1LS3 A;  1AHY A;  2CAN A;  3VOM A;  1B4X A;  1TAT A;  2AY7 A;  1M32 A;  2AY9 A;  2CTZ A;  2D66 A;  3DU4 A;  3FQ8 A;  3G8M A;  2W7F A;  4PVF A;  2C44 A;  2W7K A;  2VI9 A;  2R0T A;  3AAT A;  1SVV A;  2HZP A;  4UOY A;  3W1H A;  2VIA A;  1GEY A;  3AEM A;  3FFR A;  4W8I A;  4RIZ A;  2GB3 A;  2YCP A;  1OHV A;  1QZ9 A;  4J5U A;  5EAV A;  1FG3 A;  3CQ4 A;  2ZJG A;  4CVQ A;  4DQ6 A;  4F5F A;  1DJE A;  3Q8N A;  3R9A A;  2BKW A;  2JJE A;  3E2F A;  3B1D A;  3JTX A;  2VMR A;  3A8U X;  4E1O A; 
#chains in the Genus database with same CATH topology
 1GBN A;  4U2H A;  3A9Y A;  1MGV A;  3LVJ A;  3NUI A;  1M7Y A;  4UQV A;  2AY4 A;  1DGE A;  3E2Z B;  1MAP A;  1BT4 A;  1YIZ A;  4ZM3 A;  2VMO A;  1CQ8 A;  2XBN A;  1KMK A;  5AX8 A;  2W8J A;  3MAD A;  3CAI A;  3RUY A;  1BQD A;  3PIU A;  3IHJ A;  2PB2 A;  2VLH A;  3ACZ A;  2JJF A;  4AZK A;  5HDM A;  5EIG B;  5J8Q A;  4XJM A;  1G7X A;  1TAR A;  2R2N A;  3MKJ A;  2DGL A;  4Y0D A;  3VP6 A;  1SZK A;  2DKB A;  3G0T A;  3NRA A;  1C0N A;  2RFV A;  5M49 A;  2VMY A;  4NOG A;  5EAA A;  4IX8 A;  4OC9 A;  3W1I A;  1CJ0 A;  1AJS B;  1S08 A;  1N31 A;  4ADB A;  1I43 A;  5DB5 A;  4ITG A;  3BS8 A;  1EQB A;  5EFS A;  5EUN A;  3RQ1 A;  2CJG A;  1AIC A;  4WXF A;  2DGM A;  2VIB A;  1C7N A;  1IAX A;  2JGT A;  4GEB A;  1TOJ A;  4XAU A;  1S06 A;  2W8V A;  3QPG A;  4JEZ A;  5G2P A;  4WLH A;  4CXQ A;  1O69 A;  1D7V A;  7AAT A;  2CY8 A;  1S07 A;  1MAQ A;  5LH9 A;  3FQA A;  3MAF B;  1AJR A;  4IY7 A;  1WKG A;  2O1B A;  4AZJ A;  3LVK A;  2AEV A;  1ASN A;  5C6U A;  1ARS A;  2EZ1 A;  4F5K A;  4EB5 A;  1BJ4 A;  1TOG A;  4HVK A;  4FFC A;  5BJ3 A;  4GSA A;  2CIN A;  3DXV A;  3L44 A;  1ZOD A;  4RIT A;  2QLR A;  4GE9 A;  2VI8 A;  2CH2 A;  3E2Z A;  2BI2 A;  3LVM A;  4K2I A;  4WYC A;  4WYF A;  3WY7 A;  1RVY A;  1MDX A;  1AMS A;  1ARH A;  2VGU A;  3HDO A;  4ISY A;  1ASD A;  2OKK A;  2PO3 A;  1MDZ A;  4H51 A;  1XI9 A;  2Z1Z A;  2D65 A;  4W1V A;  1B9I A;  2GQN A;  4LNL A;  1AMR A;  2VMP A;  4EFF A;  1V2D A;  3LY1 A;  2HP1 A;  3H9X A;  3GBX A;  1ASG A;  2EYQ A;  1QJ3 A;  2YRR A;  1IX7 A;  3B1E A;  1SPA A;  1Y4I A;  1WYT B;  2YHK A;  3GWP A;  4JEV A;  2AEU A;  4PIW A;  2FKI A;  2W8U A;  1TOI A;  4OT8 A;  5KTB A;  1KMJ A;  2E7I A;  4Q31 A;  1MLZ A;  3AEN B;  2EH6 A;  4JE5 A;  3I16 A;  2YRI A;  1G4V A;  1I41 A;  1VEF A;  4LNJ A;  3VK3 A;  4AOA A;  5DJ1 A;  3EZS A;  2VMZ A;  5JAY A;  4XJP A;  3ZZK A;  5LHA A;  1DKA A;  1BKG A;  2GMU A;  3FZ8 A;  2ZSL A;  4RKD A;  3AEO A;  2YKV A;  4R5Z A;  2AY1 A;  1C9C A;  3BCA A;  2BI9 A;  2PB0 A;  4ZSW A;  1D7R A;  3M5U A;  1LC7 A;  3JWB A;  3F9T A;  4CXR A;  1O61 A;  2VMU A;  3EZ1 A;  1C4K A;  3QBO A;  2Z1Y A;  5G2Q A;  3DZZ A;  1IVR A;  3EIB A;  3KGX A;  4W5K A;  4WP0 A;  3BCX A;  3P1T A;  1E5E A;  1V72 A;  1ASC A;  1ASE A;  1WYV B;  4P7Y A;  4I8A A;  3VK4 A;  4N0B A;  4GRX A;  4A00 A;  1LKC A;  1RV3 A;  1W3U A;  4RLG A;  3MC6 A;  2OQX A;  3LV2 A;  4IYO A;  3JZL A;  2YKU A;  2W8T A;  1LC5 A;  4AH3 A;  2VYC A;  3AEJ C;  2YKX A;  4IXS A;  4QGR A;  2Z61 A;  2VMS A;  2BWP A;  1LK9 A;  3PA9 A;  2O7C A;  3LWS A;  4ATQ A;  3II0 A;  3FCR A;  2BI5 A;  4A0F A;  4M2J A;  4ZAS A;  4MY5 A;  2VMW A;  4U1T A;  1MLY A;  1AIB A;  3FTB A;  2R5C A;  4WYE A;  3GR9 A;  3UAK A;  1ZC9 A;  3BWN C;  2CFB A;  1AHF A;  1ART A;  1GD9 A;  3PDX A;  1YNU A;  3CBF A;  2VLF A;  3AEN A;  4OYT A;  2D5Y A;  2A1V A;  3NDN A;  2OAT A;  1AKA A;  3GJU A;  3WGC A;  4OBV A;  5G4J A;  3JW9 A;  2QB3 A;  4E3Q A;  1GCK A;  3FQ7 A;  4F5J A;  2VMQ A;  4JEW A;  4K2B A;  2ZSM A;  1ASM A;  1O4S A;  4W1W A;  1IX8 A;  1N2T A;  1AY5 A;  1CS1 A;  3MBB A;  3TFU A;  1FC4 A;  1YJS A;  3AEP A;  3GZD A;  4R8D A;  1AAW A;  1OXP A;  4JEX A;  5M4D A;  2HOR A;  3PD6 B;  4ZSY A;  1C7O A;  5M46 A;  4ZAH A;  4LNM A;  3FFH A;  1S09 A;  3BB8 A;  4WD2 A;  2GSA A;  4H63 Q;  3KE3 A;  4JF0 A;  2QBT A;  3NU8 A;  1IBJ A;  3HVY A;  3TCM A;  4F4E A;  3BCB A;  3HT4 A;  2GMS A;  3VAX A;  1WYU B;  3IF2 A;  4UHO A;  1KKJ A;  3QI6 A;  5DX5 A;  4DBC A;  4Q6R A;  1GC4 A;  2G7J A;  3NYU A;  3MAF A;  5E4Z A;  1MDO A;  3W1J A;  3WKR A;  2OKJ A;  1LW5 A;  4R5F A;  3T32 A;  3TAT A;  3A9Z A;  3N0L A;  1UU1 A;  4WXB A;  5M4B A;  2QMA A;  4A6R A;  2AAT A;  1EG5 A;  3K28 A;  3GSB A;  4WYG A;  1TPL A;  3B46 A;  2ZP7 A;  4JE5 D;  5EQC A;  3FVX A;  2VGV A;  4KXK A;  2BHX A;  5HXX A;  2W7J A;  4TMR A;  1KL1 A;  4ADE A;  2D7Y A;  3JWA A;  1GEX A;  4GDY A;  3NX3 A;  4K2M A;  2BIG A;  2BI1 A;  1QJ5 A;  9AAT A;  2Z9V A;  3WX9 A;  4BA4 A;  2FQ6 A;  3N75 A;  3D6K A;  2W7I A;  3FVS A;  3RCH B;  2Q7W A;  5G0A A;  3DOD A;  4RJ0 A;  4ADD A;  3N4S A;  1X2A A;  1DJU A;  5K8B A;  3I4J A;  2VGW A;  1CZE A;  1PMO A;  4JF1 A;  3P6K A;  1YOO A;  3ASB A;  2BYJ A;  1X29 A;  4W91 A;  4XEW A;  1WKH A;  5FT4 A;  3HL2 A;  3VK2 A;  3L8A A;  2BYL A;  1BJO B;  1SZS A;  3F6T A;  3CQ5 A;  5FT8 A;  5D95 A;  1IUG A;  1ASL A;  5E3K A;  4ZDL A;  3WLX A;  2V0Y A;  1AMA A;  4OTL A;  4A0H A;  2ORD A;  1AHX A;  3NUB A;  1I29 A;  2WK8 A;  3COG A;  4FL0 A;  4WB0 B;  5EIG A;  2CJD A;  4F5H A;  3QGU A;  1RVU A;  4LC3 A;  5EUD A;  4Q76 A;  1SFF A;  2HOY A;  1IX6 A;  2Z67 A;  3ATH A;  3PGY A;  4ZWM A;  4IXO A;  4Y0H A;  3N7N A;  2BWN A;  3I5T A;  1AJS A;  3TFT A;  4J8L A;  1QGN A;  2BIA A;  4BMK A;  4GE4 A;  2JG2 A;  2ZYJ A;  2QA3 A;  3DR7 A;  2FYF A;  4M2M A;  4Q75 A;  3ASA A;  4MQQ A;  2CB1 A;  2CJH A;  5TF5 A;  3FDB A;  1IAY A;  3NTJ A;  4BQ0 A;  4UHM A;  4WXG A;  4XK1 A;  3HLM A;  3USF A;  1C7G A;  2WKA A;  4MSO A;  2QB2 A;  4M2K A;  4DGT A;  2HUI A;  1DGD A;  3DR4 A;  1OXO A;  3ELP A;  2W7M A;  3AOV A;  1GEW A;  3MAU A;  4WBT A;  1AY4 A;  1FG7 A;  1OHY A;  8AAT A;  3QN6 A;  3LG0 A;  1BJO A;  5FT5 A;  3N4X A;  4KAM A;  1BQA A;  2W7E A;  1YJY A;  2AY6 A;  4XJO A;  4IXZ A;  3EI6 A;  1SZU A;  2D64 A;  1M0P A;  1AMQ A;  3CQ6 A;  2E7U A;  2W7D A;  3WZF A;  2X3L A;  3FZ7 A;  3QM2 A;  3UE8 A;  4JEY A;  4ADC A;  1ELQ A;  1S0A A;  1UKJ A;  1ASF A;  1B5P A;  1LC8 A;  1H0C A;  2ZUK A;  2Z9X A;  1QIS A;  3UWC A;  2C0R A;  4KYO A;  2AY3 A;  3ISL A;  3OP7 A;  3FD0 A;  1WYT A;  4WYD A;  2HUF A;  3NU7 A;  4K05 A;  1M0O A;  3A9X A;  4A6T A;  3H7F A;  1AKB A;  2C7T A;  1Z7D A;  2JJG A;  3EUC A;  4MQP A;  1AX4 A;  3WCN A;  1ARI A;  1D7U A;  1YAA A;  3G7Q A;  4Y0I A;  3DRD A;  2AY5 A;  5G4I A;  2DOU A;  1BS0 A;  4WYA A;  4R2N A;  1D7S A;  3E77 A;  1X28 A;  4ZDO A;  1ORD A;  3FSL A;  1BW0 A;  2EGY A;  3EI5 A;  1I48 A;  3R4T A;  4MGR A;  1TOK A;  3RBF A;  3A2B A;  4ITX A;  2WK9 A;  1AKC A;  4RJY A;  2E54 A;  1E5F A;  2YOB A;  1UU0 A;  1DFO A;  1X0M A;  4TV7 A;  1QIR A;  3FRK A;  3FVU A;  4BA5 A;  3PPL A;  4F5M A;  3BV0 A;  2Z9W A;  3BC8 A;  3HQT A;  3LVL B;  1WYV A;  1DTY A;  1OAT A;  4LW2 A;  4EMY A;  1IJI A;  1B9H A;  3KKI A;  2YKY A;  4EB7 A;  3WKS A;  2AY8 A;  4BHD A;  2ZY4 A;  3JU7 A;  1J04 A;  1SF2 A;  2EPJ A;  3E2Y A;  1UU2 A;  2D63 A;  1GDE A;  4CBS A;  1ASB A;  1G7W A;  1XEY A;  4A0G A;  1M0Q A;  3K40 A;  4E77 A;  1D2F A;  1VJO A;  3RBL A;  1JF9 A;  2V1P A;  3NNK A;  2AY2 A;  3FKD A;  4B9B A;  3PDB B;  2R5E A;  2ZC0 A;  2DR1 A;  3EI9 A;  4PFN A;  2W7L A;  1OHW A;  3TQX A;  2QSR A;  5IWQ A;  1GC0 A;  3DC1 A;  1AHG A;  2VGS A;  3BN1 A;  1KAF A;  1VP4 A;  4AO4 A;  2W7G A;  1CZC A;  1WST A;  2CST A;  1Z3Z A;  5I92 A;  3WGB A;  2X5F A;  2WB6 A;  3OKS A;  2VMN A;  4L0O A;  1YJZ A;  3MEB A;  5G09 A;  3RI6 A;  3AEJ A;  2ZY3 A;  2YCT A;  3EI7 A;  4IW7 A;  2JJH A;  2D7Z A;  1AIA A;  3GET A;  1V2E A;  2C81 A;  1U08 A;  3ELE A;  1O62 A;  1JS6 A;  1AAM A;  2ZY5 A;  1BJW A;  2VMT A;  3MC6 C;  5BJ4 A;  3F0H A;  2JIS A;  4AO9 A;  2FM1 A;  1M0N A;  1KKP A;  2HOZ A;  3PD6 A;  2DGK A;  2VGZ A;  4ATP A;  3BWN A;  1M4N A;  1W7L A;  1AHE A;  2X8U A;  3ECD A;  1ELU A;  3EI8 A;  5EUE A;  3GZC A;  3PAA A;  1WYU A;  3AEM C;  2X5D A;  5HHY A;  1ECX A;  4CBR A;  3B8X A;  2FNU A;  1LW4 A;  4RM1 A;  2HOX A;  4ZLV A;  1V2F A;  3B1C A;  2BWO A;  4A6U A;  4MQR A;  2VMV A;  5FT6 A;  1PFF A;  3FDD A;  1B8G A;  1QIT A;  2VGT A;  4E3R A;  4OCA A;  4XQ2 A;  1W7M A;  2EZ2 A;  3ZRQ A;  2WK7 A;  5F8V A;  2Z20 A;  3PDB A;  2D61 A;  1JG8 A;  4HF8 A;  4IYO B;  4RKC A;  1CQ6 A;  2OGE A;  2W7H A;  2OGA A;  3HMU A;  1PG8 A;  4MKK A;  4ZM4 A;  1ARG A;  3ZRP A;  3NYT A;  1GC2 A;  1TOE A;  1TAS A;  4EU1 A;  1H1C A;  3K7Y A;  2F8J A;  2FNI A;  1W23 A;  3GZD C;  3N5M A;  4F5L A;  2TPL A;  1P3W A;  3E6G A;  3RCH A;  4ZDP A;  1J32 A;  2NMP A;  2R5C B;  2VMX A;  4XJL A;  4OMA A;  4A0R A;  2W8W A;  3FZ6 A;  2Z9U A;  2O0R A;  2KFP A;  2DKJ A;  4B98 A;  1ASA A;  1CQ7 A;  1W7N A;  1JS3 A;  1RV4 A;  4W1X A;  4F5G A;  2HP2 A;  1YIY A;  2CH1 A;  3E9K A;  2FN6 A;  1EJI A;  3PJ0 A;  1DJ9 A;  4ZWV A;  5DJ9 A;  4F5I A;  4WB0 A;  3EIA A;  5E5I A;  2EO5 A;  3BWO A;  1B5O A;  1KL2 A;  1AY8 A;  3AOW A;  4UHN A;  1M6S A;  2BI3 A;  3DXW A;  1N8P A;  3NYS A;  4P3M A;  4A72 A;  5D5S A;  4GE7 A;  4RAE A;  2ZY2 A;  3QHX A;  3ZZJ A;  4LW4 A;  1BJN A;  3AEL A;  2XH1 A;  3WCO A;  1G4X A;  3H14 A;  4O6Z A;  2HUU A;  4MKJ A;  5F9S A;  1T3I A;  3AV7 A;  2G6W A;  3ZRR A;  2E7J A;  2YCN A;  2BIE A;  4N0W A;  4PFF A;  3DYD A;  1ZOB A;  1GC3 A;  1PMM A;  3HBX A;  3KGW A;  4OBU A;  4WLJ A;  4TN4 A;  1CL1 A;  1CL2 A;  1LS3 A;  1AHY A;  2CAN A;  3VOM A;  1B4X A;  1TAT A;  2AY7 A;  1M32 A;  2AY9 A;  2CTZ A;  2D66 A;  3DU4 A;  3FQ8 A;  3G8M A;  3N4R A;  2W7F A;  4PVF A;  2C44 A;  2W7K A;  2VI9 A;  2R0T A;  3AAT A;  1SVV A;  2HZP A;  4UOY A;  3W1H A;  2VIA A;  1GEY A;  3AEM A;  3FFR A;  4W8I A;  4RIZ A;  2GB3 A;  2YCP A;  1OHV A;  1QZ9 A;  4J5U A;  5EAV A;  1FG3 A;  3CQ4 A;  2ZJG A;  4CVQ A;  4DQ6 A;  4F5F A;  1DJE A;  3Q8N A;  3R9A A;  2BKW A;  2JJE A;  3E2F A;  3B1D A;  3JTX A;  2VMR A;  3A8U X;  4E1O A; 
#chains in the Genus database with same CATH homology
 1GBN A;  4U2H A;  3A9Y A;  1MGV A;  3LVJ A;  3NUI A;  1M7Y A;  4UQV A;  2AY4 A;  1DGE A;  3E2Z B;  1MAP A;  1BT4 A;  1YIZ A;  4ZM3 A;  2VMO A;  1CQ8 A;  2XBN A;  1KMK A;  5AX8 A;  2W8J A;  3MAD A;  3CAI A;  3RUY A;  1BQD A;  3PIU A;  3IHJ A;  2PB2 A;  2VLH A;  3ACZ A;  2JJF A;  4AZK A;  5HDM A;  5EIG B;  5J8Q A;  4XJM A;  1G7X A;  1TAR A;  2R2N A;  3MKJ A;  2DGL A;  4Y0D A;  3VP6 A;  1SZK A;  2DKB A;  3G0T A;  3NRA A;  1C0N A;  2RFV A;  5M49 A;  2VMY A;  4NOG A;  5EAA A;  4IX8 A;  4OC9 A;  3W1I A;  1CJ0 A;  1AJS B;  1S08 A;  1N31 A;  4ADB A;  1I43 A;  5DB5 A;  4ITG A;  3BS8 A;  1EQB A;  5EFS A;  5EUN A;  3RQ1 A;  2CJG A;  1AIC A;  4WXF A;  2DGM A;  2VIB A;  1C7N A;  1IAX A;  2JGT A;  4GEB A;  1TOJ A;  4XAU A;  1S06 A;  2W8V A;  3QPG A;  4JEZ A;  5G2P A;  4WLH A;  4CXQ A;  1O69 A;  1D7V A;  7AAT A;  2CY8 A;  1S07 A;  1MAQ A;  5LH9 A;  3FQA A;  3MAF B;  1AJR A;  4IY7 A;  1WKG A;  2O1B A;  4AZJ A;  3LVK A;  2AEV A;  1ASN A;  5C6U A;  1ARS A;  2EZ1 A;  4F5K A;  4EB5 A;  1BJ4 A;  1TOG A;  4HVK A;  4FFC A;  5BJ3 A;  4GSA A;  2CIN A;  3DXV A;  3L44 A;  1ZOD A;  4RIT A;  2QLR A;  4GE9 A;  2VI8 A;  2CH2 A;  3E2Z A;  2BI2 A;  3LVM A;  4K2I A;  4WYC A;  4WYF A;  3WY7 A;  1RVY A;  1MDX A;  1AMS A;  1ARH A;  2VGU A;  3HDO A;  4ISY A;  1ASD A;  2OKK A;  2PO3 A;  1MDZ A;  4H51 A;  1XI9 A;  2Z1Z A;  2D65 A;  4W1V A;  1B9I A;  2GQN A;  4LNL A;  1AMR A;  2VMP A;  4EFF A;  1V2D A;  3LY1 A;  2HP1 A;  3H9X A;  3GBX A;  1ASG A;  2EYQ A;  1QJ3 A;  2YRR A;  1IX7 A;  3B1E A;  1SPA A;  1Y4I A;  1WYT B;  2YHK A;  3GWP A;  4JEV A;  2AEU A;  4PIW A;  2FKI A;  2W8U A;  1TOI A;  4OT8 A;  5KTB A;  1KMJ A;  2E7I A;  4Q31 A;  1MLZ A;  3AEN B;  2EH6 A;  4JE5 A;  3I16 A;  2YRI A;  1G4V A;  1I41 A;  1VEF A;  4LNJ A;  3VK3 A;  4AOA A;  5DJ1 A;  3EZS A;  2VMZ A;  5JAY A;  4XJP A;  3ZZK A;  5LHA A;  1DKA A;  1BKG A;  2GMU A;  3FZ8 A;  2ZSL A;  4RKD A;  3AEO A;  2YKV A;  4R5Z A;  2AY1 A;  1C9C A;  3BCA A;  2BI9 A;  2PB0 A;  4ZSW A;  1D7R A;  3M5U A;  1LC7 A;  3JWB A;  3F9T A;  4CXR A;  1O61 A;  2VMU A;  3EZ1 A;  1C4K A;  3QBO A;  2Z1Y A;  5G2Q A;  3DZZ A;  1IVR A;  3EIB A;  3KGX A;  4W5K A;  4WP0 A;  3BCX A;  3P1T A;  1E5E A;  1V72 A;  1ASC A;  1ASE A;  1WYV B;  4P7Y A;  4I8A A;  3VK4 A;  4N0B A;  4GRX A;  4A00 A;  1LKC A;  1RV3 A;  1W3U A;  4RLG A;  3MC6 A;  2OQX A;  3LV2 A;  4IYO A;  3JZL A;  2YKU A;  2W8T A;  1LC5 A;  4AH3 A;  2VYC A;  3AEJ C;  2YKX A;  4IXS A;  4QGR A;  2Z61 A;  2VMS A;  2BWP A;  1LK9 A;  3PA9 A;  2O7C A;  3LWS A;  4ATQ A;  3II0 A;  3FCR A;  2BI5 A;  4A0F A;  4M2J A;  4ZAS A;  4MY5 A;  2VMW A;  4U1T A;  1MLY A;  1AIB A;  3FTB A;  2R5C A;  4WYE A;  3GR9 A;  3UAK A;  1ZC9 A;  3BWN C;  2CFB A;  1AHF A;  1ART A;  1GD9 A;  3PDX A;  1YNU A;  3CBF A;  2VLF A;  3AEN A;  4OYT A;  2D5Y A;  2A1V A;  3NDN A;  2OAT A;  1AKA A;  3GJU A;  3WGC A;  4OBV A;  5G4J A;  3JW9 A;  2QB3 A;  4E3Q A;  1GCK A;  3FQ7 A;  4F5J A;  2VMQ A;  4JEW A;  4K2B A;  2ZSM A;  1ASM A;  1O4S A;  4W1W A;  1IX8 A;  1N2T A;  1AY5 A;  1CS1 A;  3MBB A;  3TFU A;  1FC4 A;  1YJS A;  3AEP A;  3GZD A;  4R8D A;  1AAW A;  1OXP A;  4JEX A;  5M4D A;  2HOR A;  3PD6 B;  4ZSY A;  1C7O A;  5M46 A;  4ZAH A;  4LNM A;  3FFH A;  1S09 A;  3BB8 A;  4WD2 A;  2GSA A;  4H63 Q;  3KE3 A;  4JF0 A;  2QBT A;  3NU8 A;  1IBJ A;  3HVY A;  3TCM A;  4F4E A;  3BCB A;  3HT4 A;  2GMS A;  3VAX A;  1WYU B;  3IF2 A;  4UHO A;  1KKJ A;  3QI6 A;  5DX5 A;  4DBC A;  4Q6R A;  1GC4 A;  2G7J A;  3NYU A;  3MAF A;  5E4Z A;  1MDO A;  3W1J A;  3WKR A;  2OKJ A;  1LW5 A;  4R5F A;  3T32 A;  3TAT A;  3A9Z A;  3N0L A;  1UU1 A;  4WXB A;  5M4B A;  2QMA A;  4A6R A;  2AAT A;  1EG5 A;  3K28 A;  3GSB A;  4WYG A;  1TPL A;  3B46 A;  2ZP7 A;  4JE5 D;  5EQC A;  3FVX A;  2VGV A;  4KXK A;  2BHX A;  5HXX A;  2W7J A;  4TMR A;  1KL1 A;  4ADE A;  2D7Y A;  3JWA A;  1GEX A;  4GDY A;  3NX3 A;  4K2M A;  2BIG A;  2BI1 A;  1QJ5 A;  9AAT A;  2Z9V A;  3WX9 A;  4BA4 A;  2FQ6 A;  3N75 A;  3D6K A;  2W7I A;  3FVS A;  3RCH B;  2Q7W A;  5G0A A;  3DOD A;  4RJ0 A;  4ADD A;  3N4S A;  1X2A A;  1DJU A;  5K8B A;  3I4J A;  2VGW A;  1CZE A;  1PMO A;  4JF1 A;  3P6K A;  1YOO A;  3ASB A;  2BYJ A;  1X29 A;  4W91 A;  4XEW A;  1WKH A;  5FT4 A;  3HL2 A;  3VK2 A;  3L8A A;  2BYL A;  1BJO B;  1SZS A;  3F6T A;  3CQ5 A;  5FT8 A;  5D95 A;  1IUG A;  1ASL A;  5E3K A;  4ZDL A;  3WLX A;  2V0Y A;  1AMA A;  4OTL A;  4A0H A;  2ORD A;  1AHX A;  3NUB A;  1I29 A;  2WK8 A;  3COG A;  4FL0 A;  4WB0 B;  5EIG A;  2CJD A;  4F5H A;  3QGU A;  1RVU A;  4LC3 A;  5EUD A;  4Q76 A;  1SFF A;  2HOY A;  1IX6 A;  2Z67 A;  3ATH A;  3PGY A;  4ZWM A;  4IXO A;  4Y0H A;  3N7N A;  2BWN A;  3I5T A;  1AJS A;  3TFT A;  4J8L A;  1QGN A;  2BIA A;  4BMK A;  4GE4 A;  2JG2 A;  2ZYJ A;  2QA3 A;  3DR7 A;  2FYF A;  4M2M A;  4Q75 A;  3ASA A;  4MQQ A;  2CB1 A;  2CJH A;  5TF5 A;  3FDB A;  1IAY A;  3NTJ A;  4BQ0 A;  4UHM A;  4WXG A;  4XK1 A;  3HLM A;  3USF A;  1C7G A;  2WKA A;  4MSO A;  2QB2 A;  4M2K A;  4DGT A;  2HUI A;  1DGD A;  3DR4 A;  1OXO A;  3ELP A;  2W7M A;  3AOV A;  1GEW A;  3MAU A;  4WBT A;  1AY4 A;  1FG7 A;  1OHY A;  8AAT A;  3QN6 A;  3LG0 A;  1BJO A;  5FT5 A;  3N4X A;  4KAM A;  1BQA A;  2W7E A;  1YJY A;  2AY6 A;  4XJO A;  4IXZ A;  3EI6 A;  1SZU A;  2D64 A;  1M0P A;  1AMQ A;  3CQ6 A;  2E7U A;  2W7D A;  3WZF A;  2X3L A;  3FZ7 A;  3QM2 A;  3UE8 A;  4JEY A;  4ADC A;  1ELQ A;  1S0A A;  1UKJ A;  1ASF A;  1B5P A;  1LC8 A;  1H0C A;  2ZUK A;  2Z9X A;  1QIS A;  3UWC A;  2C0R A;  4KYO A;  2AY3 A;  3ISL A;  3OP7 A;  3FD0 A;  1WYT A;  4WYD A;  2HUF A;  3NU7 A;  4K05 A;  1M0O A;  3A9X A;  4A6T A;  3H7F A;  1AKB A;  2C7T A;  1Z7D A;  2JJG A;  3EUC A;  4MQP A;  1AX4 A;  3WCN A;  1ARI A;  1D7U A;  1YAA A;  3G7Q A;  4Y0I A;  3DRD A;  2AY5 A;  5G4I A;  2DOU A;  1BS0 A;  4WYA A;  4R2N A;  1D7S A;  3E77 A;  1X28 A;  4ZDO A;  1ORD A;  3FSL A;  1BW0 A;  2EGY A;  3EI5 A;  1I48 A;  3R4T A;  4MGR A;  1TOK A;  3RBF A;  3A2B A;  4ITX A;  2WK9 A;  1AKC A;  4RJY A;  2E54 A;  1E5F A;  2YOB A;  1UU0 A;  1DFO A;  1X0M A;  4TV7 A;  1QIR A;  3FRK A;  3FVU A;  4BA5 A;  3PPL A;  4F5M A;  3BV0 A;  2Z9W A;  3BC8 A;  3HQT A;  3LVL B;  1WYV A;  1DTY A;  1OAT A;  4LW2 A;  4EMY A;  1IJI A;  1B9H A;  3KKI A;  2YKY A;  4EB7 A;  3WKS A;  2AY8 A;  4BHD A;  2ZY4 A;  3JU7 A;  1J04 A;  1SF2 A;  2EPJ A;  3E2Y A;  1UU2 A;  2D63 A;  1GDE A;  4CBS A;  1ASB A;  1G7W A;  1XEY A;  4A0G A;  1M0Q A;  3K40 A;  4E77 A;  1D2F A;  1VJO A;  3RBL A;  1JF9 A;  2V1P A;  3NNK A;  2AY2 A;  3FKD A;  4B9B A;  3PDB B;  2R5E A;  2ZC0 A;  2DR1 A;  3EI9 A;  4PFN A;  2W7L A;  1OHW A;  3TQX A;  2QSR A;  5IWQ A;  1GC0 A;  3DC1 A;  1AHG A;  2VGS A;  3BN1 A;  1VP4 A;  4AO4 A;  2W7G A;  1CZC A;  1WST A;  2CST A;  1Z3Z A;  5I92 A;  3WGB A;  2X5F A;  2WB6 A;  3OKS A;  2VMN A;  4L0O A;  1YJZ A;  3MEB A;  5G09 A;  3RI6 A;  3AEJ A;  2ZY3 A;  2YCT A;  3EI7 A;  4IW7 A;  2JJH A;  2D7Z A;  1AIA A;  3GET A;  1V2E A;  2C81 A;  1U08 A;  3ELE A;  1O62 A;  1JS6 A;  1AAM A;  2ZY5 A;  1BJW A;  2VMT A;  3MC6 C;  5BJ4 A;  3F0H A;  2JIS A;  4AO9 A;  2FM1 A;  1M0N A;  1KKP A;  2HOZ A;  3PD6 A;  2DGK A;  2VGZ A;  4ATP A;  3BWN A;  1M4N A;  1W7L A;  1AHE A;  2X8U A;  3ECD A;  1ELU A;  3EI8 A;  5EUE A;  3GZC A;  3PAA A;  1WYU A;  3AEM C;  2X5D A;  5HHY A;  1ECX A;  4CBR A;  3B8X A;  2FNU A;  1LW4 A;  4RM1 A;  2HOX A;  4ZLV A;  1V2F A;  3B1C A;  2BWO A;  4A6U A;  4MQR A;  2VMV A;  5FT6 A;  1PFF A;  3FDD A;  1B8G A;  1QIT A;  2VGT A;  4E3R A;  4OCA A;  4XQ2 A;  1W7M A;  2EZ2 A;  3ZRQ A;  2WK7 A;  5F8V A;  2Z20 A;  3PDB A;  2D61 A;  1JG8 A;  4HF8 A;  4IYO B;  4RKC A;  1CQ6 A;  2OGE A;  2W7H A;  2OGA A;  3HMU A;  1PG8 A;  4MKK A;  4ZM4 A;  1ARG A;  3ZRP A;  3NYT A;  1GC2 A;  1TOE A;  1TAS A;  4EU1 A;  1H1C A;  3K7Y A;  2F8J A;  2FNI A;  1W23 A;  3GZD C;  3N5M A;  4F5L A;  2TPL A;  1P3W A;  3E6G A;  3RCH A;  4ZDP A;  1J32 A;  2NMP A;  2R5C B;  2VMX A;  4XJL A;  4OMA A;  4A0R A;  2W8W A;  3FZ6 A;  2Z9U A;  2O0R A;  2KFP A;  2DKJ A;  4B98 A;  1ASA A;  1CQ7 A;  1W7N A;  1JS3 A;  1RV4 A;  4W1X A;  4F5G A;  2HP2 A;  1YIY A;  2CH1 A;  3E9K A;  2FN6 A;  1EJI A;  3PJ0 A;  1DJ9 A;  4ZWV A;  5DJ9 A;  4F5I A;  4WB0 A;  3EIA A;  5E5I A;  2EO5 A;  3BWO A;  1B5O A;  1KL2 A;  1AY8 A;  3AOW A;  4UHN A;  1M6S A;  2BI3 A;  3DXW A;  1N8P A;  3NYS A;  4P3M A;  4A72 A;  5D5S A;  4GE7 A;  4RAE A;  2ZY2 A;  3QHX A;  3ZZJ A;  4LW4 A;  1BJN A;  3AEL A;  2XH1 A;  3WCO A;  1G4X A;  3H14 A;  4O6Z A;  2HUU A;  4MKJ A;  5F9S A;  1T3I A;  3AV7 A;  2G6W A;  3ZRR A;  2E7J A;  2YCN A;  2BIE A;  4N0W A;  4PFF A;  3DYD A;  1ZOB A;  1GC3 A;  1PMM A;  3HBX A;  3KGW A;  4OBU A;  4WLJ A;  4TN4 A;  1CL1 A;  1CL2 A;  1LS3 A;  1AHY A;  2CAN A;  3VOM A;  1B4X A;  1TAT A;  2AY7 A;  1M32 A;  2AY9 A;  2CTZ A;  2D66 A;  3DU4 A;  3FQ8 A;  3G8M A;  3N4R A;  2W7F A;  4PVF A;  2C44 A;  2W7K A;  2VI9 A;  2R0T A;  3AAT A;  1SVV A;  2HZP A;  4UOY A;  3W1H A;  2VIA A;  1GEY A;  3AEM A;  3FFR A;  4W8I A;  4RIZ A;  2GB3 A;  2YCP A;  1OHV A;  1QZ9 A;  4J5U A;  5EAV A;  1FG3 A;  3CQ4 A;  2ZJG A;  4CVQ A;  4DQ6 A;  4F5F A;  1DJE A;  3Q8N A;  3R9A A;  2BKW A;  2JJE A;  3E2F A;  3B1D A;  3JTX A;  2VMR A;  3A8U X;  4E1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...