3TUYC

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule keywords Myosin heavy chain
molecule tags Structural protein
total genus 46
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyC02
1RROA 1QLSA 2HPSA 4I5JA 2L0PA 2KAYA 4MRXA 5DKQA 2NLNA 5AFPA 1EG4A 3PALA 1SCVA 2ZRSA 4IL1A 4M2OA 1F8HA 3ZNIA 2OTGB 1X02A 1TN4A 2O60A 4PHKA 1KFXL 5CSJA 3KHEA 2KDHA 1AP4A 2LNKA 4OV2A 3A8RA 4HREE 4GBAA 1SKTA 5JJGA 1LINA 1JF0A 1UHKA 1SY9A 3VGOA 4GAOA 5BPJA 1K9PA 3EKHA 2E6WA 2MLEC 1DJWA 3SJSA 3CR5X 3DD4A 4CLNA 1CMFA 1MXLC 2M29A 1DJZA 1MR8A 3O4YA 5F6TA 5IBWA 4XJKA 1K96A 2HF5A 4MVFA 3GK4X 3IQOA 1N0YA 1FPWA 4BY4A 4PE0A 2WCBA 2SASA 4QJ5B 2Y1NA 3E3RA 1A4PA 2KBIA 4M2QA 1C07A 1S6IA 4A4CA 4MBEA 1PRWA 1QIWA 1QATA 3O2PA 4ORCB 4HSZA 2KYFA 1QLKA 3TUYC 3AKAA 1YUTA 4XJKB 4YI8A 2CT9A 3I5GC 1ALVA 2CTNA 4MLWA 3NSOA 5CSFA 1OE9B 2WC8A 3BQ3A 2I18A 2JRFA 2K2FA 4ZCVA 4F0ZB 4WQ3A 1UHIA 1M63B 4PALA 4PHNA 3TDIA 1CFCA 3WHTB 1N65A 1YVLA 2JQ6A 2V53A 1LA0A 3TZ1A 2BKHB 2M97A 4YGCB 1NX1A 3PFVA 1XVJA 4MZKA 1WDCC 1CNPA 3KEVA 3OX5A 4MN0A 2KI4C 3CS1A 5ER4X 3DF0A 1B9AA 5KU1A 1DJGA 1XFXO 1WRZA 2AUCA 3CGAA 5G08A 1PSRA 4ORAB 2F2PA 5J3XA 4AQIA 5KSZA 3BOWA 2BBNA 2JTTA 2MAZA 2JXCA 3KF9A 1QIVA 1UWOA 1WRKA 3VROA 1AK8A 2ZNEA 4PE7A 2BCBA 1BMOA 2LVJA 2ZKMX 4DCKA 1WLMA 1KK7Z 3D0YB 2BE6A 3EK7A 5AERA 1KK8B 2MJWB 4CFQA 2HETA 2K0JA 1J7QA 1SL7A 2OPOA 1UP5A 2LM5A 1U5IA 1V1FA 4U8DA 2LVKA 3LK1A 1GGZA 1K2HA 3GK2A 1DJHA 1RK9A 1W7IB 2JTZA 1YRUB 3EVRA 1IGVA 4C0KA 2H2KA 3BOWB 1AJ4A 1K8UA 4PDZA 1RECA 4OR9B 1F70A 1WY9A 2KBMA 1YRTB 2VRGA 3DVKA 4FQOA 5PALA 2KSPA 1LA3A 2Q4UA 1NWDA 3BUMB 2JC2A 1U5IB 3PN7C 1TNXA 1NP8A 2MLFC 1J55A 2K7CA 3OX6A 5B8IB 1LKJA 2G9BA 1RFJA 3FIAA 2RGIA 2NXQA 1EJ3A 1R2UA 3LK0A 1G8IA 1XFYO 2FOTA 5HKWA 1EXRA 1NCZA 4R1EA 5KTYA 1KQMC 1DMOA 4DS7A 2ZRTA 5I2QA 1QTXA 1B7TY 1DJXA 1TCFA 3BUWB 3FWCA 2L98A 1GQMA 2LMTA 2LAPA 3DVMA 1SYMA 1L2OB 1Y1XA 2F8PA 4YGEB 2JOJA 1LVCD 2L51A 1YX8A 2LP3A 1MWNA 2NCPA 2LCPA 2HQWA 1S6JA 1Y1UA 2PRUA 1NX2A 3A4UB 3GK1A 5CPVA 2K61A 3TDZA 4QJ3B 1IQ3A 1NSHA 1DF0A 3TS5B 1XFVO 1M39A 3ICBA 1S5GZ 3PN7B 2FCEA 2M0RA 4GNKB 2GGMA 2F2OA 2ZN9A 1QVIZ 2L4IA 1WLZA 2LANA 3RM1A 3OB1B 4E68A 1J1EA 2WOSA 4I5NB 1SW8A 1KWOB 4GFTA 1MHOA 1KQMB 1TNPA 1OMVA 2BCXA 1MXEA 2KOTA 4ORBB 1JC2A 1DGUA 1L7ZA 3FWBA 4C0LA 1H4BA 4Q04A 1DF0B 1FF1A 2L4HA 2KYCA 3SG6A 1BJFA 2K7DA 3PM8A 1CLLA 4L9MA 1XYDA 3HX4A 4ETOA 2LLUA 5I8NA 1CDPA 3H4SE 3SG7A 2M8UA 2M1KB 4MEWA 2M49B 2FJUB 4A4BA 1IG5A 1CTRA 2LLTA 2EGDA 1H8BA 3SIBA 2I2RE 1FBVA 2TN4A 4YGBB 1CMGA 1KCYA 2ZFDA 3CTNA 1QX2A 1F54A 1KK8C 1TNQA 4PHJA 1J7RA 2GGZA 1FW4A 2PASA 4HRGA 2OS8B 2I94A 1Y6WA 2JXLA 4CIDA 1SPYA 1QASA 1UHHA 1HQVA 1Y0VH 2MRDA 1NPQA 1VRKA 1EH2A 2WORA 1XK4A 5K89A 2FCDA 1DJIA 1IQ5A 3D0YA 3I5IB 4DRWA 1K95A 3AAKA 2H61C 1PVBA 2B1UA 1NX0A 1V1GA 4NDCA 1A03A 1AJ5A 1M45A 1YURA 2JULA 1UURA 1A29A 4WRIA 1OQPA 4DUQA 3I5HB 2LP2A 4TNCA 3BXKA 1XFWO 1XFUO 2F33A 3CZTX 4N1FA 1FI5A 5CSNA 1CFFA 5HYDA 1TRFA 1DJYA 3HCMA 2H61A 1B1GA 1DT7B 3EKJA 1MUXA 3OHMB 4YBHB 2JT3A 5D7FA 1S1EA 2LHIA 1EL4A 3AAJA 4AOMA 1L2OC 2LE9B 4XYNA 1KSMA 1PALA 1SBJA 3WHUB 1CKKA 1B7TZ 4P5OE 1WRLA 1XA5A 1QX5B 1AVSA 1GJYA 2JWWA 5JOLA 1JF2A 1S3PA 2JPTA 2K7BA 1XO5A 2BL0B 1AUIB 2L2EA 4QJ4B 4NQGA 1OMRA 4DIRA 1K90D 3TS5C 2BKIB 2KQ6A 3NXAA 2CCMA 1YUSA 3IF7A 1W7JB 3O6BA 1GGWA 2L50A 1YTZC 2MBXA 1RTP1 1S36A 2WNDA 1BR4B 5HLOA 2KGRA 1JSAA 3VRPA 1SK6D 2LLSA 3EVVA 2MA2A 4MZLA 1KWOC 1SMGA 2JT8A 1B8LA 1OZOA 1BF5A 1SL8A 2KI6D 3O78A 3LLEA 4N1GA 1UHJA 5CSIA 4OKHA 3IQQA 1J7PA 1TCOB 1C7VA 1PSBA 2LUXA 1AHRA 5D69A 3LCPC 2M7NA 1K9UA 1JFJA 1LXFC 1C7WA 1F4OA 2LC5A 2F3ZA 2WCEA 3EK8A 1F71A 1CDMA 2LHLA 3NSKA 2E30A 4YI9A 5AEQA 3SG3A 4PE4A 3M0WA 4GGFC 5DKRA 1JFKA 2KHNA 3PSRA 3KO0A 5ER5A 2PMYA 3EK4A 3MSEB 4PCWA 2BBMA 1TTXA 2M1UA 3I5FC 1SR6B 2SCPA 1F4QA 1R6PA 1YUUA 4ZCUA 1PULA 1CFPA 2CBLA 1IJ5A 3KPXA 2PALA 5TNCA 1BR1B 1OSAA 1QS7A 3EVUA 2OS8C 1KQVA 1MF8B 2JNXA 3LL8B 4D1EA 4GGFA 2BCAA 2A4JA 2ISDA 4YRUA 1CDLA 1NCXA 2GV5A 1IWQA 1ZMZA 4M2PA 1BU3A 1K9KA 1TNWA 5I2OA 3I5IC 1JUOA 2WCFA 1YX7A 3JVTB 1NYAA 4MRYA 1DGVA 2AMIA 1SCMB 1CM4A 1NUBA 1E8AA 1PVAA 2EHBA 1F55A 3WNXB 1CLBA 1CLMA 1MQ1A 3I5HC 2KNEA 5HLVA 3BUOB 2PSRA 4MZJA 2QACA 2K2AA 3PLFB 1QV1A 1B8RA 2KI6C 1SL9A 2KGBC 1RWYA 1XK4C 3BYAA 3I5FB 3GOFA 2CXJA 2P6BB 2LVVA 4JQ0D 1BOCA 1JBAA 1YVHA 2ZN8A 4BY5A 1BLQA 1UHNA 4FTGA 2D8NA 3OP0A 1M31A 3AKBA 3SG4A 3VRQA 1FI6A 2JU0A 1S5GY 3CWGA 4HRHA 1CDNA 2JZIA 1Q80A 4GGNA 2NCOA 3F45A 1TOPA 4CPVA 5I2LA 1QVIY 3FS7A 1TIZA 1XFZO 4P2YB 3C1VA 3SIAA 2QPTA 2BL0C 2DOQA 1DTLA 1A75A 2Y4QA 2R2IA 2O5GA 1G4YR 5FYXA 1UUSA 1PK0D 2COLB 5AXIA 1Y1AA 1M46A 1IJ6A 1ZACA 3NSIA 2I7AA 4C0JA 2NZ0A 3NSLA 2EC6C 1CM1A 2F3YA 1KFUS 2LMVA 4USLA 3JTDC 1J1DA 3CR2A 1QV0A 1A75B 1QXPA 4I5LB 1OMDA 4NDDA 1NCYA 4OCIA 1IKUA 2ZNDA 1ZFSA 1CFDA 4YGDB 4JPZB 3DVEA 4JWQA 3PATA 2M7LA 2BECA 4ICBA 2JT0A 1J7OA 4N5XA 1BG1A 5GQQC 4NDBA 2KAVA 4WQ2A 1KFUL 2Y5IA 1A2XA 2PVBA 3ZWHA 3TUYB 2LV7A 2LUCA 4AQJA 3I5GB 3DVJA 2K7OA 3BUNB 1SNLA 1SR6C 1JWDA 2L5XB 3DF0B 3WXAA 2Y1MA 2IS9A 2KFFA 3CR4X 4GPLB 4OVNF 1G33A 1ZOTB 3OB2B 1OOJA 1QX7A 2EC6B 1K93D 1NIWA 2AAOA 4GUKA 2JNFA 3JTDB 4YGAA 3D10A 1B4CA 1WDCB 2OTGC 1SRAA 2K8MB 2BE4A 2KI4B 2KQYA 1B8CA 1B47A 4CFRA 3JVTC 4UPGA 3BUXB 1BODA 4I5KA 1SCMC 2M3WA 1HT9A 5AANA 1RJVA 1BT6A 2HQ8A 4MSPA 1KK7Y 2CNPA 5HKYA 3VRRA 3K21A 2KFGA 1YR5A 3TDUA 1DVIA 1IH0A 1ODBA 1ZUZA 2KAXA 1IRJA 2Q91A 1EG3A 3RLZA 1CB1A 1N2DA 3SG2A 3SG5A 2MHHA 5HKZA 1KFXS 3QRXA 4PHMA 2LVIA 1KSOA 1OZSA 2KFHA 3CLNA 4PE1A 5DKNA 1ALWA 1K94A 2M9GA 3VRNA 2LMUA 1QJTA 1S6CA 1D1OA 1S26D 2G2BA 1NX3A
chains in the Genus database with same CATH superfamily
2WC6A 1RROA 1QLSA 2HPSA 4I5JA 2L0PA 2KAYA 4MRXA 5DKQA 2NLNA 5AFPA 1EG4A 3PALA 5HL1A 1SCVA 2ZRSA 4IL1A 4M2OA 1F8HA 3ZNIA 2OTGB 1X02A 1TN4A 2O60A 4PHKA 1KFXL 5CSJA 3KHEA 2JPOA 2KDHA 1AP4A 2LNKA 2PQLA 2H8VA 4OV2A 3A8RA 4HREE 4GBAA 1SKTA 5JJGA 2KLEA 1LINA 1JF0A 1UHKA 1SY9A 3VGOA 4GAOA 5BPJA 2FJYA 2GTEA 1K9PA 3EKHA 2E6WA 2MLEC 1DJWA 3SJSA 3CR5X 3DD4A 4CLNA 1CMFA 1MXLC 2M29A 1DJZA 1C3YA 1LS8A 1MR8A 3O4YA 5F6TA 5IBWA 4XJKA 1K96A 2HF5A 4MVFA 3GK4X 3S0DA 3IQOA 1N0YA 1FPWA 4BY4A 3PJIA 4PE0A 2WCBA 2SASA 4QJ5B 2Y1NA 3E3RA 1A4PA 2KBIA 4M2QA 4OZDA 1C07A 1S6IA 4A4CA 4MBEA 3S0FA 1PRWA 1QIWA 1QATA 3O2PA 4ORCB 4HSZA 2KYFA 1QLKA 3TUYC 3AKAA 1YUTA 4XJKB 4YI8A 2CT9A 3I5GC 1ALVA 2CTNA 4MLWA 5FI7A 3NSOA 5CSFA 3D76A 1OE9B 2WC8A 3BQ3A 3FE6A 2I18A 2JRFA 2K2FA 4ZCVA 1IIOA 3CABA 4WQ3A 4F0ZB 1UHIA 1M63B 4PALA 4PHNA 3TDIA 1CFCA 3WHTB 1N65A 1YVLA 2JQ6A 2V53A 1LA0A 3TZ1A 2BKHB 2M97A 4YGCB 1NX1A 3PFVA 1XVJA 3O4XA 2WCJA 4MZKA 1WDCC 1CNPA 3KEVA 3OX5A 4MN0A 2KI4C 3D73A 3CS1A 5ER4X 3DF0A 1B9AA 5KU1A 1DJGA 1XFXO 1WRZA 2AUCA 3CGAA 5G08A 1PSRA 2BNXA 2F2PA 4ORAB 5J3XA 4AQIA 5KSZA 1W9ZA 2BBNA 3BOWA 2JTTA 2MAZA 2JXCA 3KF9A 1QIVA 1UWOA 3SS5A 3RZSA 1WRKA 3VROA 1AK8A 2ZNEA 4PE7A 2BCBA 1BMOA 2LVJA 2ZKMX 3EG5B 4DCKA 1WLMA 1KK7Z 3D0YB 3S0AA 2BE6A 3EK7A 5AERA 1KK8B 2MJWB 4CFQA 2HETA 2K0JA 3DYEA 1J7QA 1SL7A 2OPOA 1UP5A 2LM5A 1U5IA 2WCLA 1V1FA 3DY9A 4U8DA 1XFRA 2LVKA 3LK1A 1GGZA 1K2HA 3GK2A 1DJHA 1RK9A 1W7IB 2JTZA 1YRUB 3EVRA 1IGVA 4C0KA 2H2KA 3BOWB 5EL2A 1AJ4A 1K8UA 4PT1A 3CDNA 4PDZA 1RECA 4OR9B 1F70A 1WY9A 2ERBA 2KBMA 3BJHA 1YRTB 2VRGA 2QEBA 3DVKA 4FQOA 5PALA 2KSPA 1LA3A 2Q4UA 1NWDA 3BUMB 2JC2A 1U5IB 2L2CA 3PN7C 1TNXA 1NP8A 2MLFC 1J55A 2K7CA 3OX6A 5B8IB 1OOGA 1LKJA 2G9BA 1RFJA 2WC5A 3FIAA 3Q8IA 2RGIA 2NXQA 1EJ3A 1R2UA 3LK0A 1G8IA 1XFYO 2FOTA 5HKWA 1EXRA 1NCZA 4R1EA 3SS4A 5KTYA 1KQMC 1DMOA 4DS7A 3NGVA 2ZRTA 5I2QA 1DQEA 1QTXA 1B7TY 1DJXA 1P28A 1TCFA 3BUWB 3PM2A 3FWCA 2L98A 1GQMA 2LMTA 4FQTA 2LAPA 3DVMA 1SYMA 1L2OB 3BFHA 1Y1XA 2F8PA 4YGEB 2JOJA 1LVCD 2L51A 5I94A 1YX8A 2LP3A 1MWNA 2NCPA 2LCPA 2HQWA 1S6JA 1Y1UA 2PRUA 1NX2A 3A4UB 3GK1A 5CPVA 2K61A 3TDZA 4QJ3B 1IQ3A 1NSHA 1DF0A 3TS5B 1XFVO 1M39A 3ICBA 1S5GZ 3PN7B 1DEKA 2FCEA 2M0RA 4GNKB 2GGMA 2F2OA 2ZN9A 3D78A 1QVIZ 2L4IA 1WLZA 2LANA 2YGUA 3RM1A 3OB1B 4E68A 1J1EA 2WOSA 4I5NB 1SW8A 1KWOB 4GFTA 3S0BA 2L5YA 1MHOA 1KQMB 1TNPA 3R1VA 1OMVA 2BCXA 1MXEA 2KOTA 4ORBB 3VB1A 1JC2A 1DGUA 1L7ZA 3FWBA 4C0LA 1H4BA 4Q04A 1DF0B 1FF1A 2L4HA 2KYCA 3SG6A 1BJFA 2K60A 2K7DA 3PM8A 1CLLA 4L9MA 1XYDA 3HX4A 4ETOA 2LLUA 5I8NA 1CDPA 3H4SE 3SG7A 2M8UA 2M1KB 4MEWA 2M49B 2FJUB 4A4BA 1IG5A 1CTRA 2LLTA 2EGDA 1H8BA 4JD9A 3SIBA 2I2RE 1FBVA 2TN4A 4YGBB 3SS3A 1CMGA 1KCYA 2ZFDA 4KYNA 3CTNA 1QX2A 1F54A 1KK8C 1TNQA 3BFBA 4PHJA 1J7RA 2GGZA 1FW4A 2PASA 4HRGA 2OS8B 2I94A 1Y6WA 2JXLA 4CIDA 2BAPA 1SPYA 2P70A 1QASA 1UHHA 1HQVA 1Y0VH 2MRDA 1NPQA 1VRKA 1EH2A 2WORA 1XK4A 5D3OA 5K89A 2FCDA 1DJIA 1IQ5A 3D0YA 3I5IB 4DRWA 1K95A 3AAKA 2H61C 1PVBA 2B1UA 1NX0A 1V1GA 4NDCA 1A03A 3D74A 1AJ5A 1M45A 1YURA 2JULA 3NHTA 1UURA 1A29A 4WRIA 1OQPA 4DUQA 3I5HB 2LP2A 4TNCA 1C3ZA 3BXKA 2P71A 1XFWO 1XFUO 2F33A 3CZTX 4N1FA 1FI5A 5CSNA 1CFFA 5HYDA 1TRFA 1DJYA 3HCMA 1TWOA 2H61A 3OBVA 1B1GA 1DT7B 3EKJA 3L47A 1MUXA 3OHMB 1OW4A 4YBHB 2JT3A 3B87A 5D7FA 1S1EA 2LHIA 1EL4A 3AAJA 4AOMA 1L2OC 2LE9B 4XYNA 1KSMA 1PALA 1SBJA 3WHUB 1CKKA 1B7TZ 2KPHA 2WCKA 4P5OE 1WRLA 1XA5A 1QX5B 1AVSA 1GJYA 2JWWA 1GM0A 5JOLA 3R72A 1JF2A 1S3PA 2JPTA 2K7BA 1SSEB 1XO5A 2BL0B 1AUIB 2L2EA 4QJ4B 4NQGA 1OMRA 4DIRA 3B6XA 1K90D 3TS5C 2BKIB 2KQ6A 3CZ2A 3NXAA 2CCMA 1YUSA 3IF7A 1W7JB 3O6BA 1GGWA 2L50A 1YTZC 2MBXA 1RTP1 2QEOA 1S36A 2WNDA 1BR4B 5HLOA 2KGRA 1JSAA 3VRPA 3V2LA 1SK6D 2LLSA 3EVVA 2MA2A 4MZLA 1KWOC 1SMGA 2JT8A 1B8LA 1OZOA 1BF5A 1SL8A 2KI6D 3O78A 3LLEA 4N1GA 1UHJA 5CSIA 4OKHA 1DELA 3IQQA 1J7PA 1TCOB 3D75A 1C7VA 1PSBA 2LUXA 1AHRA 5D69A 3LCPC 2M7NA 1K9UA 1JFJA 3OGNA 1LXFC 1C7WA 1F4OA 3R1OA 1OOIX 2LC5A 2F3ZA 2WCEA 3EK8A 1F71A 1CDMA 3DXLA 2LHLA 3NSKA 2E30A 4YI9A 5AEQA 3SG3A 4PE4A 3M0WA 4GGFC 5DKRA 1JFKA 2KHNA 3PSRA 3KO0A 5ER5A 2PMYA 3EK4A 3MSEB 4PCWA 2BBMA 3R1PA 1TTXA 2M1UA 3S0EA 3I5FC 1SR6B 2SCPA 1F4QA 1R6PA 1YUUA 4ZCUA 3CYZA 3UNWA 1PULA 4F7FA 2CBLA 1IJ5A 3KPXA 1CFPA 2PALA 5DICA 5TNCA 1BR1B 3BFAA 1OSAA 1QS7A 3EVUA 1DC1A 2OS8C 3N7HA 1KQVA 1MF8B 2JNXA 3LL8B 4D1EA 4GGFA 2BCAA 2A4JA 2WCHA 2ISDA 1CDLA 4YRUA 1NCXA 2GV5A 1IWQA 1TUZA 1ZMZA 4M2PA 1BU3A 1K9KA 1TNWA 5I2OA 3I5IC 1JUOA 2WCFA 1YX7A 3JVTB 1NYAA 4MRYA 1DGVA 3K1EA 2AMIA 1SCMB 1CM4A 5FI6A 1NUBA 1E8AA 1PVAA 2EHBA 3DZTA 1F55A 3WNXB 1CLBA 1CLMA 1MQ1A 3I5HC 2KNEA 4JKTA 3BUOB 5HLVA 2PSRA 4MZJA 2QACA 2K2AA 3PLFB 1QV1A 1B8RA 2KI6C 2WCMA 1SL9A 2KGBC 1RWYA 1XK4C 3BYAA 3FE9A 1Z2CB 3I5FB 1OOHA 3GOFA 2CXJA 5FI2A 2P6BB 2LVVA 4JQ0D 1BOCA 1JBAA 1YVHA 2ZN8A 4BY5A 1OOFA 1BLQA 1UHNA 4FTGA 2D8NA 3OP0A 1M31A 3QMEA 3AKBA 3SG4A 3VRQA 3NHIA 2QDIA 1FI6A 2JU0A 1S5GY 3CWGA 4HRHA 1CDNA 2JZIA 1Q80A 4GGNA 2NCOA 3F45A 1TOPA 4CPVA 5I2LA 1QVIY 3FS7A 1TIZA 1XFZO 3L4LA 4P2YB 3B88A 3C1VA 3SIAA 2QPTA 2BL0C 2DOQA 1DTLA 1A75A 2Y4QA 2R2IA 2O5GA 1G4YR 5FYXA 1T14A 1UUSA 1PK0D 2COLB 5AXIA 1Y1AA 2QEVA 1M46A 1IJ6A 1ZACA 3NSIA 2I7AA 3L4AA 4C0JA 2NZ0A 4INWA 3NSLA 2EC6C 1CM1A 4IJ7A 2F3YA 1KFUS 2KLDA 2LMVA 4USLA 3JTDC 3D77A 1J1DA 3CR2A 1QV0A 1A75B 1QXPA 4I5LB 3FE8A 1OMDA 4NDDA 1NCYA 4OCIA 1IKUA 2ZNDA 1ZFSA 1CFDA 2QEHA 4YGDB 4JPZB 3IVTA 3DVEA 4JWQA 3PATA 2M7LA 2BECA 4ICBA 2JT0A 3CZ1A 1J7OA 4N5XA 1BG1A 2PYQA 5GQQC 4NDBA 2KAVA 4WQ2A 1KFUL 2Y5IA 1A2XA 2PVBA 3ZWHA 3TUYB 2LV7A 2LUCA 4AQJA 3I5GB 3B86A 3DVJA 2K7OA 3BUNB 1SNLA 1SR6C 3CZ0A 1JWDA 2L5XB 3DF0B 3WXAA 2Y1MA 1TUJA 2IS9A 2KFFA 3CR4X 4GPLB 4OVNF 1G33A 1ZOTB 3OB2B 1OOJA 1Z4HA 1QX7A 3B7AA 2EC6B 1ORGA 1K93D 1NIWA 2AAOA 1QWVA 4GUKA 2JNFA 3JTDB 4YGAA 3D10A 1B4CA 1WDCB 2OTGC 1SRAA 2K8MB 2BE4A 2KI4B 2KQYA 1B8CA 1B47A 4CFRA 3JVTC 3S0GA 4UPGA 3BUXB 1BODA 4I5KA 1SCMC 2M3WA 1HT9A 5AANA 1RJVA 1BT6A 2HQ8A 4MSPA 1KK7Y 2CNPA 5HKYA 3VRRA 3K21A 2KFGA 1YR5A 3TDUA 1DVIA 1IH0A 1ODBA 1ZUZA 2KAXA 1IRJA 2Q91A 1EG3A 3RLZA 1CB1A 1N2DA 3SG2A 3SG5A 2MHHA 5HKZA 1KFXS 3QRXA 4PHMA 2LVIA 1KSOA 1OZSA 2KFHA 3CLNA 4PE1A 5DKNA 1ALWA 1K94A 2M9GA 4INXA 2LMUA 3VRNA 1QJTA 1S6CA 1D1OA 1S26D 2G2BA 3UO9A 1NX3A
chains in the Genus database with same CATH topology
1RROA 1QLSA 2HPSA 4I5JA 2L0PA 2KAYA 4MRXA 5DKQA 2NLNA 5AFPA 1EG4A 3PALA 1SCVA 2ZRSA 4IL1A 4M2OA 1F8HA 3ZNIA 2OTGB 1X02A 1TN4A 2O60A 4PHKA 1KFXL 5CSJA 3KHEA 2KDHA 1AP4A 2LNKA 4OV2A 3A8RA 4HREE 4GBAA 1SKTA 5JJGA 1LINA 1JF0A 1UHKA 1SY9A 3VGOA 4GAOA 5BPJA 1K9PA 3EKHA 2E6WA 2MLEC 1DJWA 3SJSA 3CR5X 3DD4A 4CLNA 1CMFA 1MXLC 2M29A 1DJZA 1MR8A 3O4YA 5F6TA 5IBWA 4XJKA 1K96A 2HF5A 4MVFA 3GK4X 3IQOA 1N0YA 1FPWA 4BY4A 4PE0A 2WCBA 2SASA 4QJ5B 2Y1NA 3E3RA 1A4PA 2KBIA 4M2QA 1C07A 1S6IA 4A4CA 4MBEA 1PRWA 1QIWA 1QATA 3O2PA 4ORCB 4HSZA 2KYFA 1QLKA 3TUYC 3AKAA 1YUTA 4XJKB 4YI8A 2CT9A 3I5GC 1ALVA 2CTNA 4MLWA 3NSOA 5CSFA 1OE9B 2WC8A 3BQ3A 2I18A 2JRFA 2K2FA 4ZCVA 4F0ZB 4WQ3A 1UHIA 1M63B 4PALA 4PHNA 3TDIA 1CFCA 3WHTB 1N65A 1YVLA 2JQ6A 2V53A 1LA0A 3TZ1A 2BKHB 2M97A 4YGCB 1NX1A 3PFVA 1XVJA 4MZKA 1WDCC 1CNPA 3KEVA 3OX5A 4MN0A 2KI4C 3CS1A 5ER4X 3DF0A 1B9AA 5KU1A 1DJGA 1XFXO 1WRZA 2AUCA 3CGAA 5G08A 1PSRA 4ORAB 2F2PA 5J3XA 4AQIA 5KSZA 3BOWA 2BBNA 2JTTA 2MAZA 2JXCA 3KF9A 1QIVA 1UWOA 1WRKA 3VROA 1AK8A 2ZNEA 4PE7A 2BCBA 1BMOA 2LVJA 2ZKMX 4DCKA 1WLMA 1KK7Z 3D0YB 2BE6A 3EK7A 5AERA 1KK8B 2MJWB 4CFQA 2HETA 2K0JA 1J7QA 1SL7A 2OPOA 1UP5A 2LM5A 1U5IA 1V1FA 4U8DA 2LVKA 3LK1A 1GGZA 1K2HA 3GK2A 1DJHA 1RK9A 1W7IB 2JTZA 1YRUB 3EVRA 1IGVA 4C0KA 2H2KA 3BOWB 1AJ4A 1K8UA 4PDZA 1RECA 4OR9B 1F70A 1WY9A 2KBMA 1YRTB 2VRGA 3DVKA 4FQOA 5PALA 2KSPA 1LA3A 2Q4UA 1NWDA 3BUMB 2JC2A 1U5IB 3PN7C 1TNXA 1NP8A 2MLFC 1J55A 2K7CA 3OX6A 5B8IB 1LKJA 2G9BA 1RFJA 3FIAA 2RGIA 2NXQA 1EJ3A 1R2UA 3LK0A 1G8IA 1XFYO 2FOTA 5HKWA 1EXRA 1NCZA 4R1EA 5KTYA 1KQMC 1DMOA 4DS7A 2ZRTA 5I2QA 1QTXA 1B7TY 1DJXA 1TCFA 3BUWB 3FWCA 2L98A 1GQMA 2LMTA 2LAPA 3DVMA 1SYMA 1L2OB 1Y1XA 2F8PA 4YGEB 2JOJA 1LVCD 2L51A 1YX8A 2LP3A 1MWNA 2NCPA 2LCPA 2HQWA 1S6JA 1Y1UA 2PRUA 1NX2A 3A4UB 3GK1A 5CPVA 2K61A 3TDZA 4QJ3B 1IQ3A 1NSHA 1DF0A 3TS5B 1XFVO 1M39A 3ICBA 1S5GZ 3PN7B 2FCEA 2M0RA 4GNKB 2GGMA 2F2OA 2ZN9A 1QVIZ 2L4IA 1WLZA 2LANA 3RM1A 3OB1B 4E68A 1J1EA 2WOSA 4I5NB 1SW8A 1KWOB 4GFTA 1MHOA 1KQMB 1TNPA 1OMVA 2BCXA 1MXEA 2KOTA 4ORBB 1JC2A 1DGUA 1L7ZA 3FWBA 4C0LA 1H4BA 4Q04A 1DF0B 1FF1A 2L4HA 2KYCA 3SG6A 1BJFA 2K7DA 3PM8A 1CLLA 4L9MA 1XYDA 3HX4A 4ETOA 2LLUA 5I8NA 1CDPA 3H4SE 3SG7A 2M8UA 2M1KB 4MEWA 2M49B 2FJUB 4A4BA 1IG5A 1CTRA 2LLTA 2EGDA 1H8BA 3SIBA 2I2RE 1FBVA 2TN4A 4YGBB 1CMGA 1KCYA 2ZFDA 3CTNA 1QX2A 1F54A 1KK8C 1TNQA 4PHJA 1J7RA 2GGZA 1FW4A 2PASA 4HRGA 2OS8B 2I94A 1Y6WA 2JXLA 4CIDA 1SPYA 1QASA 1UHHA 1HQVA 1Y0VH 2MRDA 1NPQA 1VRKA 1EH2A 2WORA 1XK4A 5K89A 2FCDA 1DJIA 1IQ5A 3D0YA 3I5IB 4DRWA 1K95A 3AAKA 2H61C 1PVBA 2B1UA 1NX0A 1V1GA 4NDCA 1A03A 1AJ5A 1M45A 1YURA 2JULA 1UURA 1A29A 4WRIA 1OQPA 4DUQA 3I5HB 2LP2A 4TNCA 3BXKA 1XFWO 1XFUO 2F33A 3CZTX 4N1FA 1FI5A 5CSNA 1CFFA 5HYDA 1TRFA 1DJYA 3HCMA 2H61A 1B1GA 1DT7B 3EKJA 1MUXA 3OHMB 4YBHB 2JT3A 5D7FA 1S1EA 2LHIA 1EL4A 3AAJA 4AOMA 1L2OC 2LE9B 4XYNA 1KSMA 1PALA 1SBJA 3WHUB 1CKKA 1B7TZ 4P5OE 1WRLA 1XA5A 1QX5B 1AVSA 1GJYA 2JWWA 5JOLA 1JF2A 1S3PA 2JPTA 2K7BA 1XO5A 2BL0B 1AUIB 2L2EA 4QJ4B 4NQGA 1OMRA 4DIRA 1K90D 3TS5C 2BKIB 2KQ6A 3NXAA 2CCMA 1YUSA 3IF7A 1W7JB 3O6BA 1GGWA 2L50A 1YTZC 2MBXA 1RTP1 1S36A 2WNDA 1BR4B 5HLOA 2KGRA 1JSAA 3VRPA 1SK6D 2LLSA 3EVVA 2MA2A 4MZLA 1KWOC 1SMGA 2JT8A 1B8LA 1OZOA 1BF5A 1SL8A 2KI6D 3O78A 3LLEA 4N1GA 1UHJA 5CSIA 4OKHA 3IQQA 1J7PA 1TCOB 1C7VA 1PSBA 2LUXA 1AHRA 5D69A 3LCPC 2M7NA 1K9UA 1JFJA 1LXFC 1C7WA 1F4OA 2LC5A 2F3ZA 2WCEA 3EK8A 1F71A 1CDMA 2LHLA 3NSKA 2E30A 4YI9A 5AEQA 3SG3A 4PE4A 3M0WA 4GGFC 5DKRA 1JFKA 2KHNA 3PSRA 3KO0A 5ER5A 2PMYA 3EK4A 3MSEB 4PCWA 2BBMA 1TTXA 2M1UA 3I5FC 1SR6B 2SCPA 1F4QA 1R6PA 1YUUA 4ZCUA 1PULA 1CFPA 2CBLA 1IJ5A 3KPXA 2PALA 5TNCA 1BR1B 1OSAA 1QS7A 3EVUA 2OS8C 1KQVA 1MF8B 2JNXA 3LL8B 4D1EA 4GGFA 2BCAA 2A4JA 2ISDA 4YRUA 1CDLA 1NCXA 2GV5A 1IWQA 1ZMZA 4M2PA 1BU3A 1K9KA 1TNWA 5I2OA 3I5IC 1JUOA 2WCFA 1YX7A 3JVTB 1NYAA 4MRYA 1DGVA 2AMIA 1SCMB 1CM4A 1NUBA 1E8AA 1PVAA 2EHBA 1F55A 3WNXB 1CLBA 1CLMA 1MQ1A 3I5HC 2KNEA 5HLVA 3BUOB 2PSRA 4MZJA 2QACA 2K2AA 3PLFB 1QV1A 1B8RA 2KI6C 1SL9A 2KGBC 1RWYA 1XK4C 3BYAA 3I5FB 3GOFA 2CXJA 2P6BB 2LVVA 4JQ0D 1BOCA 1JBAA 1YVHA 2ZN8A 4BY5A 1BLQA 1UHNA 4FTGA 2D8NA 3OP0A 1M31A 3AKBA 3SG4A 3VRQA 1FI6A 2JU0A 1S5GY 3CWGA 4HRHA 1CDNA 2JZIA 1Q80A 4GGNA 2NCOA 3F45A 1TOPA 4CPVA 5I2LA 1QVIY 3FS7A 1TIZA 1XFZO 4P2YB 3C1VA 3SIAA 2QPTA 2BL0C 2DOQA 1DTLA 1A75A 2Y4QA 2R2IA 2O5GA 1G4YR 5FYXA 1UUSA 1PK0D 2COLB 5AXIA 1Y1AA 1M46A 1IJ6A 1ZACA 3NSIA 2I7AA 4C0JA 2NZ0A 3NSLA 2EC6C 1CM1A 2F3YA 1KFUS 2LMVA 4USLA 3JTDC 1J1DA 3CR2A 1QV0A 1A75B 1QXPA 4I5LB 1OMDA 4NDDA 1NCYA 4OCIA 1IKUA 2ZNDA 1ZFSA 1CFDA 4YGDB 4JPZB 3DVEA 4JWQA 3PATA 2M7LA 2BECA 4ICBA 2JT0A 1J7OA 4N5XA 1BG1A 5GQQC 4NDBA 2KAVA 4WQ2A 1KFUL 2Y5IA 1A2XA 2PVBA 3ZWHA 3TUYB 2LV7A 2LUCA 4AQJA 3I5GB 3DVJA 2K7OA 3BUNB 1SNLA 1SR6C 1JWDA 2L5XB 3DF0B 3WXAA 2Y1MA 2IS9A 2KFFA 3CR4X 4GPLB 4OVNF 1G33A 1ZOTB 3OB2B 1OOJA 1QX7A 2EC6B 1K93D 1NIWA 2AAOA 4GUKA 2JNFA 3JTDB 4YGAA 3D10A 1B4CA 1WDCB 2OTGC 1SRAA 2K8MB 2BE4A 2KI4B 2KQYA 1B8CA 1B47A 4CFRA 3JVTC 4UPGA 3BUXB 1BODA 4I5KA 1SCMC 2M3WA 1HT9A 5AANA 1RJVA 1BT6A 2HQ8A 4MSPA 1KK7Y 2CNPA 5HKYA 3VRRA 3K21A 2KFGA 1YR5A 3TDUA 1DVIA 1IH0A 1ODBA 1ZUZA 2KAXA 1IRJA 2Q91A 1EG3A 3RLZA 1CB1A 1N2DA 3SG2A 3SG5A 2MHHA 5HKZA 1KFXS 3QRXA 4PHMA 2LVIA 1KSOA 1OZSA 2KFHA 3CLNA 4PE1A 5DKNA 1ALWA 1K94A 2M9GA 3VRNA 2LMUA 1QJTA 1S6CA 1D1OA 1S26D 2G2BA 1NX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRO A;  1QLS A;  2HPS A;  4I5J A;  2L0P A;  2KAY A;  4MRX A;  5DKQ A;  2NLN A;  5AFP A;  1EG4 A;  3PAL A;  1SCV A;  2ZRS A;  4IL1 A;  4M2O A;  1F8H A;  3ZNI A;  2OTG B;  1X02 A;  1TN4 A;  2O60 A;  4PHK A;  1KFX L;  5CSJ A;  3KHE A;  2KDH A;  1AP4 A;  2LNK A;  4OV2 A;  3A8R A;  4HRE E;  4GBA A;  1SKT A;  5JJG A;  1LIN A;  1JF0 A;  1UHK A;  1SY9 A;  3VGO A;  4GAO A;  5BPJ A;  1K9P A;  3EKH A;  2E6W A;  2MLE C;  1DJW A;  3SJS A;  3CR5 X;  3DD4 A;  4CLN A;  1CMF A;  1MXL C;  2M29 A;  1DJZ A;  1MR8 A;  3O4Y A;  5F6T A;  5IBW A;  4XJK A;  1K96 A;  2HF5 A;  4MVF A;  3GK4 X;  3IQO A;  1N0Y A;  1FPW A;  4BY4 A;  4PE0 A;  2WCB A;  2SAS A;  4QJ5 B;  2Y1N A;  3E3R A;  1A4P A;  2KBI A;  4M2Q A;  1C07 A;  1S6I A;  4A4C A;  4MBE A;  1PRW A;  1QIW A;  1QAT A;  3O2P A;  4ORC B;  4HSZ A;  2KYF A;  1QLK A;  3TUY C;  3AKA A;  1YUT A;  4XJK B;  4YI8 A;  2CT9 A;  3I5G C;  1ALV A;  2CTN A;  4MLW A;  3NSO A;  5CSF A;  1OE9 B;  2WC8 A;  3BQ3 A;  2I18 A;  2JRF A;  2K2F A;  4ZCV A;  4F0Z B;  4WQ3 A;  1UHI A;  1M63 B;  4PAL A;  4PHN A;  3TDI A;  1CFC A;  3WHT B;  1N65 A;  1YVL A;  2JQ6 A;  2V53 A;  1LA0 A;  3TZ1 A;  2BKH B;  2M97 A;  4YGC B;  1NX1 A;  3PFV A;  1XVJ A;  4MZK A;  1WDC C;  1CNP A;  3KEV A;  3OX5 A;  4MN0 A;  2KI4 C;  3CS1 A;  5ER4 X;  3DF0 A;  1B9A A;  5KU1 A;  1DJG A;  1XFX O;  1WRZ A;  2AUC A;  3CGA A;  5G08 A;  1PSR A;  4ORA B;  2F2P A;  5J3X A;  4AQI A;  5KSZ A;  3BOW A;  2BBN A;  2JTT A;  2MAZ A;  2JXC A;  3KF9 A;  1QIV A;  1UWO A;  1WRK A;  3VRO A;  1AK8 A;  2ZNE A;  4PE7 A;  2BCB A;  1BMO A;  2LVJ A;  2ZKM X;  4DCK A;  1WLM A;  1KK7 Z;  3D0Y B;  2BE6 A;  3EK7 A;  5AER A;  1KK8 B;  2MJW B;  4CFQ A;  2HET A;  2K0J A;  1J7Q A;  1SL7 A;  2OPO A;  1UP5 A;  2LM5 A;  1U5I A;  1V1F A;  4U8D A;  2LVK A;  3LK1 A;  1GGZ A;  1K2H A;  3GK2 A;  1DJH A;  1RK9 A;  1W7I B;  2JTZ A;  1YRU B;  3EVR A;  1IGV A;  4C0K A;  2H2K A;  3BOW B;  1AJ4 A;  1K8U A;  4PDZ A;  1REC A;  4OR9 B;  1F70 A;  1WY9 A;  2KBM A;  1YRT B;  2VRG A;  3DVK A;  4FQO A;  5PAL A;  2KSP A;  1LA3 A;  2Q4U A;  1NWD A;  3BUM B;  2JC2 A;  1U5I B;  3PN7 C;  1TNX A;  1NP8 A;  2MLF C;  1J55 A;  2K7C A;  3OX6 A;  5B8I B;  1LKJ A;  2G9B A;  1RFJ A;  3FIA A;  2RGI A;  2NXQ A;  1EJ3 A;  1R2U A;  3LK0 A;  1G8I A;  1XFY O;  2FOT A;  5HKW A;  1EXR A;  1NCZ A;  4R1E A;  5KTY A;  1KQM C;  1DMO A;  4DS7 A;  2ZRT A;  5I2Q A;  1QTX A;  1B7T Y;  1DJX A;  1TCF A;  3BUW B;  3FWC A;  2L98 A;  1GQM A;  2LMT A;  2LAP A;  3DVM A;  1SYM A;  1L2O B;  1Y1X A;  2F8P A;  4YGE B;  2JOJ A;  1LVC D;  2L51 A;  1YX8 A;  2LP3 A;  1MWN A;  2NCP A;  2LCP A;  2HQW A;  1S6J A;  1Y1U A;  2PRU A;  1NX2 A;  3A4U B;  3GK1 A;  5CPV A;  2K61 A;  3TDZ A;  4QJ3 B;  1IQ3 A;  1NSH A;  1DF0 A;  3TS5 B;  1XFV O;  1M39 A;  3ICB A;  1S5G Z;  3PN7 B;  2FCE A;  2M0R A;  4GNK B;  2GGM A;  2F2O A;  2ZN9 A;  1QVI Z;  2L4I A;  1WLZ A;  2LAN A;  3RM1 A;  3OB1 B;  4E68 A;  1J1E A;  2WOS A;  4I5N B;  1SW8 A;  1KWO B;  4GFT A;  1MHO A;  1KQM B;  1TNP A;  1OMV A;  2BCX A;  1MXE A;  2KOT A;  4ORB B;  1JC2 A;  1DGU A;  1L7Z A;  3FWB A;  4C0L A;  1H4B A;  4Q04 A;  1DF0 B;  1FF1 A;  2L4H A;  2KYC A;  3SG6 A;  1BJF A;  2K7D A;  3PM8 A;  1CLL A;  4L9M A;  1XYD A;  3HX4 A;  4ETO A;  2LLU A;  5I8N A;  1CDP A;  3H4S E;  3SG7 A;  2M8U A;  2M1K B;  4MEW A;  2M49 B;  2FJU B;  4A4B A;  1IG5 A;  1CTR A;  2LLT A;  2EGD A;  1H8B A;  3SIB A;  2I2R E;  1FBV A;  2TN4 A;  4YGB B;  1CMG A;  1KCY A;  2ZFD A;  3CTN A;  1QX2 A;  1F54 A;  1KK8 C;  1TNQ A;  4PHJ A;  1J7R A;  2GGZ A;  1FW4 A;  2PAS A;  4HRG A;  2OS8 B;  2I94 A;  1Y6W A;  2JXL A;  4CID A;  1SPY A;  1QAS A;  1UHH A;  1HQV A;  1Y0V H;  2MRD A;  1NPQ A;  1VRK A;  1EH2 A;  2WOR A;  1XK4 A;  5K89 A;  2FCD A;  1DJI A;  1IQ5 A;  3D0Y A;  3I5I B;  4DRW A;  1K95 A;  3AAK A;  2H61 C;  1PVB A;  2B1U A;  1NX0 A;  1V1G A;  4NDC A;  1A03 A;  1AJ5 A;  1M45 A;  1YUR A;  2JUL A;  1UUR A;  1A29 A;  4WRI A;  1OQP A;  4DUQ A;  3I5H B;  2LP2 A;  4TNC A;  3BXK A;  1XFW O;  1XFU O;  2F33 A;  3CZT X;  4N1F A;  1FI5 A;  5CSN A;  1CFF A;  5HYD A;  1TRF A;  1DJY A;  3HCM A;  2H61 A;  1B1G A;  1DT7 B;  3EKJ A;  1MUX A;  3OHM B;  4YBH B;  2JT3 A;  5D7F A;  1S1E A;  2LHI A;  1EL4 A;  3AAJ A;  4AOM A;  1L2O C;  2LE9 B;  4XYN A;  1KSM A;  1PAL A;  1SBJ A;  3WHU B;  1CKK A;  1B7T Z;  4P5O E;  1WRL A;  1XA5 A;  1QX5 B;  1AVS A;  1GJY A;  2JWW A;  5JOL A;  1JF2 A;  1S3P A;  2JPT A;  2K7B A;  1XO5 A;  2BL0 B;  1AUI B;  2L2E A;  4QJ4 B;  4NQG A;  1OMR A;  4DIR A;  1K90 D;  3TS5 C;  2BKI B;  2KQ6 A;  3NXA A;  2CCM A;  1YUS A;  3IF7 A;  1W7J B;  3O6B A;  1GGW A;  2L50 A;  1YTZ C;  2MBX A;  1RTP 1;  1S36 A;  2WND A;  1BR4 B;  5HLO A;  2KGR A;  1JSA A;  3VRP A;  1SK6 D;  2LLS A;  3EVV A;  2MA2 A;  4MZL A;  1KWO C;  1SMG A;  2JT8 A;  1B8L A;  1OZO A;  1BF5 A;  1SL8 A;  2KI6 D;  3O78 A;  3LLE A;  4N1G A;  1UHJ A;  5CSI A;  4OKH A;  3IQQ A;  1J7P A;  1TCO B;  1C7V A;  1PSB A;  2LUX A;  1AHR A;  5D69 A;  3LCP C;  2M7N A;  1K9U A;  1JFJ A;  1LXF C;  1C7W A;  1F4O A;  2LC5 A;  2F3Z A;  2WCE A;  3EK8 A;  1F71 A;  1CDM A;  2LHL A;  3NSK A;  2E30 A;  4YI9 A;  5AEQ A;  3SG3 A;  4PE4 A;  3M0W A;  4GGF C;  5DKR A;  1JFK A;  2KHN A;  3PSR A;  3KO0 A;  5ER5 A;  2PMY A;  3EK4 A;  3MSE B;  4PCW A;  2BBM A;  1TTX A;  2M1U A;  3I5F C;  1SR6 B;  2SCP A;  1F4Q A;  1R6P A;  1YUU A;  4ZCU A;  1PUL A;  1CFP A;  2CBL A;  1IJ5 A;  3KPX A;  2PAL A;  5TNC A;  1BR1 B;  1OSA A;  1QS7 A;  3EVU A;  2OS8 C;  1KQV A;  1MF8 B;  2JNX A;  3LL8 B;  4D1E A;  4GGF A;  2BCA A;  2A4J A;  2ISD A;  4YRU A;  1CDL A;  1NCX A;  2GV5 A;  1IWQ A;  1ZMZ A;  4M2P A;  1BU3 A;  1K9K A;  1TNW A;  5I2O A;  3I5I C;  1JUO A;  2WCF A;  1YX7 A;  3JVT B;  1NYA A;  4MRY A;  1DGV A;  2AMI A;  1SCM B;  1CM4 A;  1NUB A;  1E8A A;  1PVA A;  2EHB A;  1F55 A;  3WNX B;  1CLB A;  1CLM A;  1MQ1 A;  3I5H C;  2KNE A;  5HLV A;  3BUO B;  2PSR A;  4MZJ A;  2QAC A;  2K2A A;  3PLF B;  1QV1 A;  1B8R A;  2KI6 C;  1SL9 A;  2KGB C;  1RWY A;  1XK4 C;  3BYA A;  3I5F B;  3GOF A;  2CXJ A;  2P6B B;  2LVV A;  4JQ0 D;  1BOC A;  1JBA A;  1YVH A;  2ZN8 A;  4BY5 A;  1BLQ A;  1UHN A;  4FTG A;  2D8N A;  3OP0 A;  1M31 A;  3AKB A;  3SG4 A;  3VRQ A;  1FI6 A;  2JU0 A;  1S5G Y;  3CWG A;  4HRH A;  1CDN A;  2JZI A;  1Q80 A;  4GGN A;  2NCO A;  3F45 A;  1TOP A;  4CPV A;  5I2L A;  1QVI Y;  3FS7 A;  1TIZ A;  1XFZ O;  4P2Y B;  3C1V A;  3SIA A;  2QPT A;  2BL0 C;  2DOQ A;  1DTL A;  1A75 A;  2Y4Q A;  2R2I A;  2O5G A;  1G4Y R;  5FYX A;  1UUS A;  1PK0 D;  2COL B;  5AXI A;  1Y1A A;  1M46 A;  1IJ6 A;  1ZAC A;  3NSI A;  2I7A A;  4C0J A;  2NZ0 A;  3NSL A;  2EC6 C;  1CM1 A;  2F3Y A;  1KFU S;  2LMV A;  4USL A;  3JTD C;  1J1D A;  3CR2 A;  1QV0 A;  1A75 B;  1QXP A;  4I5L B;  1OMD A;  4NDD A;  1NCY A;  4OCI A;  1IKU A;  2ZND A;  1ZFS A;  1CFD A;  4YGD B;  4JPZ B;  3DVE A;  4JWQ A;  3PAT A;  2M7L A;  2BEC A;  4ICB A;  2JT0 A;  1J7O A;  4N5X A;  1BG1 A;  5GQQ C;  4NDB A;  2KAV A;  4WQ2 A;  1KFU L;  2Y5I A;  1A2X A;  2PVB A;  3ZWH A;  3TUY B;  2LV7 A;  2LUC A;  4AQJ A;  3I5G B;  3DVJ A;  2K7O A;  3BUN B;  1SNL A;  1SR6 C;  1JWD A;  2L5X B;  3DF0 B;  3WXA A;  2Y1M A;  2IS9 A;  2KFF A;  3CR4 X;  4GPL B;  4OVN F;  1G33 A;  1ZOT B;  3OB2 B;  1OOJ A;  1QX7 A;  2EC6 B;  1K93 D;  1NIW A;  2AAO A;  4GUK A;  2JNF A;  3JTD B;  4YGA A;  3D10 A;  1B4C A;  1WDC B;  2OTG C;  1SRA A;  2K8M B;  2BE4 A;  2KI4 B;  2KQY A;  1B8C A;  1B47 A;  4CFR A;  3JVT C;  4UPG A;  3BUX B;  1BOD A;  4I5K A;  1SCM C;  2M3W A;  1HT9 A;  5AAN A;  1RJV A;  1BT6 A;  2HQ8 A;  4MSP A;  1KK7 Y;  2CNP A;  5HKY A;  3VRR A;  3K21 A;  2KFG A;  1YR5 A;  3TDU A;  1DVI A;  1IH0 A;  1ODB A;  1ZUZ A;  2KAX A;  1IRJ A;  2Q91 A;  1EG3 A;  3RLZ A;  1CB1 A;  1N2D A;  3SG2 A;  3SG5 A;  2MHH A;  5HKZ A;  1KFX S;  3QRX A;  4PHM A;  2LVI A;  1KSO A;  1OZS A;  2KFH A;  3CLN A;  4PE1 A;  5DKN A;  1ALW A;  1K94 A;  2M9G A;  3VRN A;  2LMU A;  1QJT A;  1S6C A;  1D1O A;  1S26 D;  2G2B A;  1NX3 A; 
#chains in the Genus database with same CATH topology
 2WC6 A;  1RRO A;  1QLS A;  2HPS A;  4I5J A;  2L0P A;  2KAY A;  4MRX A;  5DKQ A;  2NLN A;  5AFP A;  1EG4 A;  3PAL A;  5HL1 A;  1SCV A;  2ZRS A;  4IL1 A;  4M2O A;  1F8H A;  3ZNI A;  2OTG B;  1X02 A;  1TN4 A;  2O60 A;  4PHK A;  1KFX L;  5CSJ A;  3KHE A;  2JPO A;  2KDH A;  1AP4 A;  2LNK A;  2PQL A;  2H8V A;  4OV2 A;  3A8R A;  4HRE E;  4GBA A;  1SKT A;  5JJG A;  2KLE A;  1LIN A;  1JF0 A;  1UHK A;  1SY9 A;  3VGO A;  4GAO A;  5BPJ A;  2FJY A;  2GTE A;  1K9P A;  3EKH A;  2E6W A;  2MLE C;  1DJW A;  3SJS A;  3CR5 X;  3DD4 A;  4CLN A;  1CMF A;  1MXL C;  2M29 A;  1DJZ A;  1C3Y A;  1LS8 A;  1MR8 A;  3O4Y A;  5F6T A;  5IBW A;  4XJK A;  1K96 A;  2HF5 A;  4MVF A;  3GK4 X;  3S0D A;  3IQO A;  1N0Y A;  1FPW A;  4BY4 A;  3PJI A;  4PE0 A;  2WCB A;  2SAS A;  4QJ5 B;  2Y1N A;  3E3R A;  1A4P A;  2KBI A;  4M2Q A;  4OZD A;  1C07 A;  1S6I A;  4A4C A;  4MBE A;  3S0F A;  1PRW A;  1QIW A;  1QAT A;  3O2P A;  4ORC B;  4HSZ A;  2KYF A;  1QLK A;  3TUY C;  3AKA A;  1YUT A;  4XJK B;  4YI8 A;  2CT9 A;  3I5G C;  1ALV A;  2CTN A;  4MLW A;  5FI7 A;  3NSO A;  5CSF A;  3D76 A;  1OE9 B;  2WC8 A;  3BQ3 A;  3FE6 A;  2I18 A;  2JRF A;  2K2F A;  4ZCV A;  1IIO A;  3CAB A;  4WQ3 A;  4F0Z B;  1UHI A;  1M63 B;  4PAL A;  4PHN A;  3TDI A;  1CFC A;  3WHT B;  1N65 A;  1YVL A;  2JQ6 A;  2V53 A;  1LA0 A;  3TZ1 A;  2BKH B;  2M97 A;  4YGC B;  1NX1 A;  3PFV A;  1XVJ A;  3O4X A;  2WCJ A;  4MZK A;  1WDC C;  1CNP A;  3KEV A;  3OX5 A;  4MN0 A;  2KI4 C;  3D73 A;  3CS1 A;  5ER4 X;  3DF0 A;  1B9A A;  5KU1 A;  1DJG A;  1XFX O;  1WRZ A;  2AUC A;  3CGA A;  5G08 A;  1PSR A;  2BNX A;  2F2P A;  4ORA B;  5J3X A;  4AQI A;  5KSZ A;  1W9Z A;  2BBN A;  3BOW A;  2JTT A;  2MAZ A;  2JXC A;  3KF9 A;  1QIV A;  1UWO A;  3SS5 A;  3RZS A;  1WRK A;  3VRO A;  1AK8 A;  2ZNE A;  4PE7 A;  2BCB A;  1BMO A;  2LVJ A;  2ZKM X;  3EG5 B;  4DCK A;  1WLM A;  1KK7 Z;  3D0Y B;  3S0A A;  2BE6 A;  3EK7 A;  5AER A;  1KK8 B;  2MJW B;  4CFQ A;  2HET A;  2K0J A;  3DYE A;  1J7Q A;  1SL7 A;  2OPO A;  1UP5 A;  2LM5 A;  1U5I A;  2WCL A;  1V1F A;  3DY9 A;  4U8D A;  1XFR A;  2LVK A;  3LK1 A;  1GGZ A;  1K2H A;  3GK2 A;  1DJH A;  1RK9 A;  1W7I B;  2JTZ A;  1YRU B;  3EVR A;  1IGV A;  4C0K A;  2H2K A;  3BOW B;  5EL2 A;  1AJ4 A;  1K8U A;  4PT1 A;  3CDN A;  4PDZ A;  1REC A;  4OR9 B;  1F70 A;  1WY9 A;  2ERB A;  2KBM A;  3BJH A;  1YRT B;  2VRG A;  2QEB A;  3DVK A;  4FQO A;  5PAL A;  2KSP A;  1LA3 A;  2Q4U A;  1NWD A;  3BUM B;  2JC2 A;  1U5I B;  2L2C A;  3PN7 C;  1TNX A;  1NP8 A;  2MLF C;  1J55 A;  2K7C A;  3OX6 A;  5B8I B;  1OOG A;  1LKJ A;  2G9B A;  1RFJ A;  2WC5 A;  3FIA A;  3Q8I A;  2RGI A;  2NXQ A;  1EJ3 A;  1R2U A;  3LK0 A;  1G8I A;  1XFY O;  2FOT A;  5HKW A;  1EXR A;  1NCZ A;  4R1E A;  3SS4 A;  5KTY A;  1KQM C;  1DMO A;  4DS7 A;  3NGV A;  2ZRT A;  5I2Q A;  1DQE A;  1QTX A;  1B7T Y;  1DJX A;  1P28 A;  1TCF A;  3BUW B;  3PM2 A;  3FWC A;  2L98 A;  1GQM A;  2LMT A;  4FQT A;  2LAP A;  3DVM A;  1SYM A;  1L2O B;  3BFH A;  1Y1X A;  2F8P A;  4YGE B;  2JOJ A;  1LVC D;  2L51 A;  5I94 A;  1YX8 A;  2LP3 A;  1MWN A;  2NCP A;  2LCP A;  2HQW A;  1S6J A;  1Y1U A;  2PRU A;  1NX2 A;  3A4U B;  3GK1 A;  5CPV A;  2K61 A;  3TDZ A;  4QJ3 B;  1IQ3 A;  1NSH A;  1DF0 A;  3TS5 B;  1XFV O;  1M39 A;  3ICB A;  1S5G Z;  3PN7 B;  1DEK A;  2FCE A;  2M0R A;  4GNK B;  2GGM A;  2F2O A;  2ZN9 A;  3D78 A;  1QVI Z;  2L4I A;  1WLZ A;  2LAN A;  2YGU A;  3RM1 A;  3OB1 B;  4E68 A;  1J1E A;  2WOS A;  4I5N B;  1SW8 A;  1KWO B;  4GFT A;  3S0B A;  2L5Y A;  1MHO A;  1KQM B;  1TNP A;  3R1V A;  1OMV A;  2BCX A;  1MXE A;  2KOT A;  4ORB B;  3VB1 A;  1JC2 A;  1DGU A;  1L7Z A;  3FWB A;  4C0L A;  1H4B A;  4Q04 A;  1DF0 B;  1FF1 A;  2L4H A;  2KYC A;  3SG6 A;  1BJF A;  2K60 A;  2K7D A;  3PM8 A;  1CLL A;  4L9M A;  1XYD A;  3HX4 A;  4ETO A;  2LLU A;  5I8N A;  1CDP A;  3H4S E;  3SG7 A;  2M8U A;  2M1K B;  4MEW A;  2M49 B;  2FJU B;  4A4B A;  1IG5 A;  1CTR A;  2LLT A;  2EGD A;  1H8B A;  4JD9 A;  3SIB A;  2I2R E;  1FBV A;  2TN4 A;  4YGB B;  3SS3 A;  1CMG A;  1KCY A;  2ZFD A;  4KYN A;  3CTN A;  1QX2 A;  1F54 A;  1KK8 C;  1TNQ A;  3BFB A;  4PHJ A;  1J7R A;  2GGZ A;  1FW4 A;  2PAS A;  4HRG A;  2OS8 B;  2I94 A;  1Y6W A;  2JXL A;  4CID A;  2BAP A;  1SPY A;  2P70 A;  1QAS A;  1UHH A;  1HQV A;  1Y0V H;  2MRD A;  1NPQ A;  1VRK A;  1EH2 A;  2WOR A;  1XK4 A;  5D3O A;  5K89 A;  2FCD A;  1DJI A;  1IQ5 A;  3D0Y A;  3I5I B;  4DRW A;  1K95 A;  3AAK A;  2H61 C;  1PVB A;  2B1U A;  1NX0 A;  1V1G A;  4NDC A;  1A03 A;  3D74 A;  1AJ5 A;  1M45 A;  1YUR A;  2JUL A;  3NHT A;  1UUR A;  1A29 A;  4WRI A;  1OQP A;  4DUQ A;  3I5H B;  2LP2 A;  4TNC A;  1C3Z A;  3BXK A;  2P71 A;  1XFW O;  1XFU O;  2F33 A;  3CZT X;  4N1F A;  1FI5 A;  5CSN A;  1CFF A;  5HYD A;  1TRF A;  1DJY A;  3HCM A;  1TWO A;  2H61 A;  3OBV A;  1B1G A;  1DT7 B;  3EKJ A;  3L47 A;  1MUX A;  3OHM B;  1OW4 A;  4YBH B;  2JT3 A;  3B87 A;  5D7F A;  1S1E A;  2LHI A;  1EL4 A;  3AAJ A;  4AOM A;  1L2O C;  2LE9 B;  4XYN A;  1KSM A;  1PAL A;  1SBJ A;  3WHU B;  1CKK A;  1B7T Z;  2KPH A;  2WCK A;  4P5O E;  1WRL A;  1XA5 A;  1QX5 B;  1AVS A;  1GJY A;  2JWW A;  1GM0 A;  5JOL A;  3R72 A;  1JF2 A;  1S3P A;  2JPT A;  2K7B A;  1SSE B;  1XO5 A;  2BL0 B;  1AUI B;  2L2E A;  4QJ4 B;  4NQG A;  1OMR A;  4DIR A;  3B6X A;  1K90 D;  3TS5 C;  2BKI B;  2KQ6 A;  3CZ2 A;  3NXA A;  2CCM A;  1YUS A;  3IF7 A;  1W7J B;  3O6B A;  1GGW A;  2L50 A;  1YTZ C;  2MBX A;  1RTP 1;  2QEO A;  1S36 A;  2WND A;  1BR4 B;  5HLO A;  2KGR A;  1JSA A;  3VRP A;  3V2L A;  1SK6 D;  2LLS A;  3EVV A;  2MA2 A;  4MZL A;  1KWO C;  1SMG A;  2JT8 A;  1B8L A;  1OZO A;  1BF5 A;  1SL8 A;  2KI6 D;  3O78 A;  3LLE A;  4N1G A;  1UHJ A;  5CSI A;  4OKH A;  1DEL A;  3IQQ A;  1J7P A;  1TCO B;  3D75 A;  1C7V A;  1PSB A;  2LUX A;  1AHR A;  5D69 A;  3LCP C;  2M7N A;  1K9U A;  1JFJ A;  3OGN A;  1LXF C;  1C7W A;  1F4O A;  3R1O A;  1OOI X;  2LC5 A;  2F3Z A;  2WCE A;  3EK8 A;  1F71 A;  1CDM A;  3DXL A;  2LHL A;  3NSK A;  2E30 A;  4YI9 A;  5AEQ A;  3SG3 A;  4PE4 A;  3M0W A;  4GGF C;  5DKR A;  1JFK A;  2KHN A;  3PSR A;  3KO0 A;  5ER5 A;  2PMY A;  3EK4 A;  3MSE B;  4PCW A;  2BBM A;  3R1P A;  1TTX A;  2M1U A;  3S0E A;  3I5F C;  1SR6 B;  2SCP A;  1F4Q A;  1R6P A;  1YUU A;  4ZCU A;  3CYZ A;  3UNW A;  1PUL A;  4F7F A;  2CBL A;  1IJ5 A;  3KPX A;  1CFP A;  2PAL A;  5DIC A;  5TNC A;  1BR1 B;  3BFA A;  1OSA A;  1QS7 A;  3EVU A;  1DC1 A;  2OS8 C;  3N7H A;  1KQV A;  1MF8 B;  2JNX A;  3LL8 B;  4D1E A;  4GGF A;  2BCA A;  2A4J A;  2WCH A;  2ISD A;  1CDL A;  4YRU A;  1NCX A;  2GV5 A;  1IWQ A;  1TUZ A;  1ZMZ A;  4M2P A;  1BU3 A;  1K9K A;  1TNW A;  5I2O A;  3I5I C;  1JUO A;  2WCF A;  1YX7 A;  3JVT B;  1NYA A;  4MRY A;  1DGV A;  3K1E A;  2AMI A;  1SCM B;  1CM4 A;  5FI6 A;  1NUB A;  1E8A A;  1PVA A;  2EHB A;  3DZT A;  1F55 A;  3WNX B;  1CLB A;  1CLM A;  1MQ1 A;  3I5H C;  2KNE A;  4JKT A;  3BUO B;  5HLV A;  2PSR A;  4MZJ A;  2QAC A;  2K2A A;  3PLF B;  1QV1 A;  1B8R A;  2KI6 C;  2WCM A;  1SL9 A;  2KGB C;  1RWY A;  1XK4 C;  3BYA A;  3FE9 A;  1Z2C B;  3I5F B;  1OOH A;  3GOF A;  2CXJ A;  5FI2 A;  2P6B B;  2LVV A;  4JQ0 D;  1BOC A;  1JBA A;  1YVH A;  2ZN8 A;  4BY5 A;  1OOF A;  1BLQ A;  1UHN A;  4FTG A;  2D8N A;  3OP0 A;  1M31 A;  3QME A;  3AKB A;  3SG4 A;  3VRQ A;  3NHI A;  2QDI A;  1FI6 A;  2JU0 A;  1S5G Y;  3CWG A;  4HRH A;  1CDN A;  2JZI A;  1Q80 A;  4GGN A;  2NCO A;  3F45 A;  1TOP A;  4CPV A;  5I2L A;  1QVI Y;  3FS7 A;  1TIZ A;  1XFZ O;  3L4L A;  4P2Y B;  3B88 A;  3C1V A;  3SIA A;  2QPT A;  2BL0 C;  2DOQ A;  1DTL A;  1A75 A;  2Y4Q A;  2R2I A;  2O5G A;  1G4Y R;  5FYX A;  1T14 A;  1UUS A;  1PK0 D;  2COL B;  5AXI A;  1Y1A A;  2QEV A;  1M46 A;  1IJ6 A;  1ZAC A;  3NSI A;  2I7A A;  3L4A A;  4C0J A;  2NZ0 A;  4INW A;  3NSL A;  2EC6 C;  1CM1 A;  4IJ7 A;  2F3Y A;  1KFU S;  2KLD A;  2LMV A;  4USL A;  3JTD C;  3D77 A;  1J1D A;  3CR2 A;  1QV0 A;  1A75 B;  1QXP A;  4I5L B;  3FE8 A;  1OMD A;  4NDD A;  1NCY A;  4OCI A;  1IKU A;  2ZND A;  1ZFS A;  1CFD A;  2QEH A;  4YGD B;  4JPZ B;  3IVT A;  3DVE A;  4JWQ A;  3PAT A;  2M7L A;  2BEC A;  4ICB A;  2JT0 A;  3CZ1 A;  1J7O A;  4N5X A;  1BG1 A;  2PYQ A;  5GQQ C;  4NDB A;  2KAV A;  4WQ2 A;  1KFU L;  2Y5I A;  1A2X A;  2PVB A;  3ZWH A;  3TUY B;  2LV7 A;  2LUC A;  4AQJ A;  3I5G B;  3B86 A;  3DVJ A;  2K7O A;  3BUN B;  1SNL A;  1SR6 C;  3CZ0 A;  1JWD A;  2L5X B;  3DF0 B;  3WXA A;  2Y1M A;  1TUJ A;  2IS9 A;  2KFF A;  3CR4 X;  4GPL B;  4OVN F;  1G33 A;  1ZOT B;  3OB2 B;  1OOJ A;  1Z4H A;  1QX7 A;  3B7A A;  2EC6 B;  1ORG A;  1K93 D;  1NIW A;  2AAO A;  1QWV A;  4GUK A;  2JNF A;  3JTD B;  4YGA A;  3D10 A;  1B4C A;  1WDC B;  2OTG C;  1SRA A;  2K8M B;  2BE4 A;  2KI4 B;  2KQY A;  1B8C A;  1B47 A;  4CFR A;  3JVT C;  3S0G A;  4UPG A;  3BUX B;  1BOD A;  4I5K A;  1SCM C;  2M3W A;  1HT9 A;  5AAN A;  1RJV A;  1BT6 A;  2HQ8 A;  4MSP A;  1KK7 Y;  2CNP A;  5HKY A;  3VRR A;  3K21 A;  2KFG A;  1YR5 A;  3TDU A;  1DVI A;  1IH0 A;  1ODB A;  1ZUZ A;  2KAX A;  1IRJ A;  2Q91 A;  1EG3 A;  3RLZ A;  1CB1 A;  1N2D A;  3SG2 A;  3SG5 A;  2MHH A;  5HKZ A;  1KFX S;  3QRX A;  4PHM A;  2LVI A;  1KSO A;  1OZS A;  2KFH A;  3CLN A;  4PE1 A;  5DKN A;  1ALW A;  1K94 A;  2M9G A;  4INX A;  2LMU A;  3VRN A;  1QJT A;  1S6C A;  1D1O A;  1S26 D;  2G2B A;  3UO9 A;  1NX3 A; 
#chains in the Genus database with same CATH homology
 1RRO A;  1QLS A;  2HPS A;  4I5J A;  2L0P A;  2KAY A;  4MRX A;  5DKQ A;  2NLN A;  5AFP A;  1EG4 A;  3PAL A;  1SCV A;  2ZRS A;  4IL1 A;  4M2O A;  1F8H A;  3ZNI A;  2OTG B;  1X02 A;  1TN4 A;  2O60 A;  4PHK A;  1KFX L;  5CSJ A;  3KHE A;  2KDH A;  1AP4 A;  2LNK A;  4OV2 A;  3A8R A;  4HRE E;  4GBA A;  1SKT A;  5JJG A;  1LIN A;  1JF0 A;  1UHK A;  1SY9 A;  3VGO A;  4GAO A;  5BPJ A;  1K9P A;  3EKH A;  2E6W A;  2MLE C;  1DJW A;  3SJS A;  3CR5 X;  3DD4 A;  4CLN A;  1CMF A;  1MXL C;  2M29 A;  1DJZ A;  1MR8 A;  3O4Y A;  5F6T A;  5IBW A;  4XJK A;  1K96 A;  2HF5 A;  4MVF A;  3GK4 X;  3IQO A;  1N0Y A;  1FPW A;  4BY4 A;  4PE0 A;  2WCB A;  2SAS A;  4QJ5 B;  2Y1N A;  3E3R A;  1A4P A;  2KBI A;  4M2Q A;  1C07 A;  1S6I A;  4A4C A;  4MBE A;  1PRW A;  1QIW A;  1QAT A;  3O2P A;  4ORC B;  4HSZ A;  2KYF A;  1QLK A;  3TUY C;  3AKA A;  1YUT A;  4XJK B;  4YI8 A;  2CT9 A;  3I5G C;  1ALV A;  2CTN A;  4MLW A;  3NSO A;  5CSF A;  1OE9 B;  2WC8 A;  3BQ3 A;  2I18 A;  2JRF A;  2K2F A;  4ZCV A;  4F0Z B;  4WQ3 A;  1UHI A;  1M63 B;  4PAL A;  4PHN A;  3TDI A;  1CFC A;  3WHT B;  1N65 A;  1YVL A;  2JQ6 A;  2V53 A;  1LA0 A;  3TZ1 A;  2BKH B;  2M97 A;  4YGC B;  1NX1 A;  3PFV A;  1XVJ A;  4MZK A;  1WDC C;  1CNP A;  3KEV A;  3OX5 A;  4MN0 A;  2KI4 C;  3CS1 A;  5ER4 X;  3DF0 A;  1B9A A;  5KU1 A;  1DJG A;  1XFX O;  1WRZ A;  2AUC A;  3CGA A;  5G08 A;  1PSR A;  4ORA B;  2F2P A;  5J3X A;  4AQI A;  5KSZ A;  3BOW A;  2BBN A;  2JTT A;  2MAZ A;  2JXC A;  3KF9 A;  1QIV A;  1UWO A;  1WRK A;  3VRO A;  1AK8 A;  2ZNE A;  4PE7 A;  2BCB A;  1BMO A;  2LVJ A;  2ZKM X;  4DCK A;  1WLM A;  1KK7 Z;  3D0Y B;  2BE6 A;  3EK7 A;  5AER A;  1KK8 B;  2MJW B;  4CFQ A;  2HET A;  2K0J A;  1J7Q A;  1SL7 A;  2OPO A;  1UP5 A;  2LM5 A;  1U5I A;  1V1F A;  4U8D A;  2LVK A;  3LK1 A;  1GGZ A;  1K2H A;  3GK2 A;  1DJH A;  1RK9 A;  1W7I B;  2JTZ A;  1YRU B;  3EVR A;  1IGV A;  4C0K A;  2H2K A;  3BOW B;  1AJ4 A;  1K8U A;  4PDZ A;  1REC A;  4OR9 B;  1F70 A;  1WY9 A;  2KBM A;  1YRT B;  2VRG A;  3DVK A;  4FQO A;  5PAL A;  2KSP A;  1LA3 A;  2Q4U A;  1NWD A;  3BUM B;  2JC2 A;  1U5I B;  3PN7 C;  1TNX A;  1NP8 A;  2MLF C;  1J55 A;  2K7C A;  3OX6 A;  5B8I B;  1LKJ A;  2G9B A;  1RFJ A;  3FIA A;  2RGI A;  2NXQ A;  1EJ3 A;  1R2U A;  3LK0 A;  1G8I A;  1XFY O;  2FOT A;  5HKW A;  1EXR A;  1NCZ A;  4R1E A;  5KTY A;  1KQM C;  1DMO A;  4DS7 A;  2ZRT A;  5I2Q A;  1QTX A;  1B7T Y;  1DJX A;  1TCF A;  3BUW B;  3FWC A;  2L98 A;  1GQM A;  2LMT A;  2LAP A;  3DVM A;  1SYM A;  1L2O B;  1Y1X A;  2F8P A;  4YGE B;  2JOJ A;  1LVC D;  2L51 A;  1YX8 A;  2LP3 A;  1MWN A;  2NCP A;  2LCP A;  2HQW A;  1S6J A;  1Y1U A;  2PRU A;  1NX2 A;  3A4U B;  3GK1 A;  5CPV A;  2K61 A;  3TDZ A;  4QJ3 B;  1IQ3 A;  1NSH A;  1DF0 A;  3TS5 B;  1XFV O;  1M39 A;  3ICB A;  1S5G Z;  3PN7 B;  2FCE A;  2M0R A;  4GNK B;  2GGM A;  2F2O A;  2ZN9 A;  1QVI Z;  2L4I A;  1WLZ A;  2LAN A;  3RM1 A;  3OB1 B;  4E68 A;  1J1E A;  2WOS A;  4I5N B;  1SW8 A;  1KWO B;  4GFT A;  1MHO A;  1KQM B;  1TNP A;  1OMV A;  2BCX A;  1MXE A;  2KOT A;  4ORB B;  1JC2 A;  1DGU A;  1L7Z A;  3FWB A;  4C0L A;  1H4B A;  4Q04 A;  1DF0 B;  1FF1 A;  2L4H A;  2KYC A;  3SG6 A;  1BJF A;  2K7D A;  3PM8 A;  1CLL A;  4L9M A;  1XYD A;  3HX4 A;  4ETO A;  2LLU A;  5I8N A;  1CDP A;  3H4S E;  3SG7 A;  2M8U A;  2M1K B;  4MEW A;  2M49 B;  2FJU B;  4A4B A;  1IG5 A;  1CTR A;  2LLT A;  2EGD A;  1H8B A;  3SIB A;  2I2R E;  1FBV A;  2TN4 A;  4YGB B;  1CMG A;  1KCY A;  2ZFD A;  3CTN A;  1QX2 A;  1F54 A;  1KK8 C;  1TNQ A;  4PHJ A;  1J7R A;  2GGZ A;  1FW4 A;  2PAS A;  4HRG A;  2OS8 B;  2I94 A;  1Y6W A;  2JXL A;  4CID A;  1SPY A;  1QAS A;  1UHH A;  1HQV A;  1Y0V H;  2MRD A;  1NPQ A;  1VRK A;  1EH2 A;  2WOR A;  1XK4 A;  5K89 A;  2FCD A;  1DJI A;  1IQ5 A;  3D0Y A;  3I5I B;  4DRW A;  1K95 A;  3AAK A;  2H61 C;  1PVB A;  2B1U A;  1NX0 A;  1V1G A;  4NDC A;  1A03 A;  1AJ5 A;  1M45 A;  1YUR A;  2JUL A;  1UUR A;  1A29 A;  4WRI A;  1OQP A;  4DUQ A;  3I5H B;  2LP2 A;  4TNC A;  3BXK A;  1XFW O;  1XFU O;  2F33 A;  3CZT X;  4N1F A;  1FI5 A;  5CSN A;  1CFF A;  5HYD A;  1TRF A;  1DJY A;  3HCM A;  2H61 A;  1B1G A;  1DT7 B;  3EKJ A;  1MUX A;  3OHM B;  4YBH B;  2JT3 A;  5D7F A;  1S1E A;  2LHI A;  1EL4 A;  3AAJ A;  4AOM A;  1L2O C;  2LE9 B;  4XYN A;  1KSM A;  1PAL A;  1SBJ A;  3WHU B;  1CKK A;  1B7T Z;  4P5O E;  1WRL A;  1XA5 A;  1QX5 B;  1AVS A;  1GJY A;  2JWW A;  5JOL A;  1JF2 A;  1S3P A;  2JPT A;  2K7B A;  1XO5 A;  2BL0 B;  1AUI B;  2L2E A;  4QJ4 B;  4NQG A;  1OMR A;  4DIR A;  1K90 D;  3TS5 C;  2BKI B;  2KQ6 A;  3NXA A;  2CCM A;  1YUS A;  3IF7 A;  1W7J B;  3O6B A;  1GGW A;  2L50 A;  1YTZ C;  2MBX A;  1RTP 1;  1S36 A;  2WND A;  1BR4 B;  5HLO A;  2KGR A;  1JSA A;  3VRP A;  1SK6 D;  2LLS A;  3EVV A;  2MA2 A;  4MZL A;  1KWO C;  1SMG A;  2JT8 A;  1B8L A;  1OZO A;  1BF5 A;  1SL8 A;  2KI6 D;  3O78 A;  3LLE A;  4N1G A;  1UHJ A;  5CSI A;  4OKH A;  3IQQ A;  1J7P A;  1TCO B;  1C7V A;  1PSB A;  2LUX A;  1AHR A;  5D69 A;  3LCP C;  2M7N A;  1K9U A;  1JFJ A;  1LXF C;  1C7W A;  1F4O A;  2LC5 A;  2F3Z A;  2WCE A;  3EK8 A;  1F71 A;  1CDM A;  2LHL A;  3NSK A;  2E30 A;  4YI9 A;  5AEQ A;  3SG3 A;  4PE4 A;  3M0W A;  4GGF C;  5DKR A;  1JFK A;  2KHN A;  3PSR A;  3KO0 A;  5ER5 A;  2PMY A;  3EK4 A;  3MSE B;  4PCW A;  2BBM A;  1TTX A;  2M1U A;  3I5F C;  1SR6 B;  2SCP A;  1F4Q A;  1R6P A;  1YUU A;  4ZCU A;  1PUL A;  1CFP A;  2CBL A;  1IJ5 A;  3KPX A;  2PAL A;  5TNC A;  1BR1 B;  1OSA A;  1QS7 A;  3EVU A;  2OS8 C;  1KQV A;  1MF8 B;  2JNX A;  3LL8 B;  4D1E A;  4GGF A;  2BCA A;  2A4J A;  2ISD A;  4YRU A;  1CDL A;  1NCX A;  2GV5 A;  1IWQ A;  1ZMZ A;  4M2P A;  1BU3 A;  1K9K A;  1TNW A;  5I2O A;  3I5I C;  1JUO A;  2WCF A;  1YX7 A;  3JVT B;  1NYA A;  4MRY A;  1DGV A;  2AMI A;  1SCM B;  1CM4 A;  1NUB A;  1E8A A;  1PVA A;  2EHB A;  1F55 A;  3WNX B;  1CLB A;  1CLM A;  1MQ1 A;  3I5H C;  2KNE A;  5HLV A;  3BUO B;  2PSR A;  4MZJ A;  2QAC A;  2K2A A;  3PLF B;  1QV1 A;  1B8R A;  2KI6 C;  1SL9 A;  2KGB C;  1RWY A;  1XK4 C;  3BYA A;  3I5F B;  3GOF A;  2CXJ A;  2P6B B;  2LVV A;  4JQ0 D;  1BOC A;  1JBA A;  1YVH A;  2ZN8 A;  4BY5 A;  1BLQ A;  1UHN A;  4FTG A;  2D8N A;  3OP0 A;  1M31 A;  3AKB A;  3SG4 A;  3VRQ A;  1FI6 A;  2JU0 A;  1S5G Y;  3CWG A;  4HRH A;  1CDN A;  2JZI A;  1Q80 A;  4GGN A;  2NCO A;  3F45 A;  1TOP A;  4CPV A;  5I2L A;  1QVI Y;  3FS7 A;  1TIZ A;  1XFZ O;  4P2Y B;  3C1V A;  3SIA A;  2QPT A;  2BL0 C;  2DOQ A;  1DTL A;  1A75 A;  2Y4Q A;  2R2I A;  2O5G A;  1G4Y R;  5FYX A;  1UUS A;  1PK0 D;  2COL B;  5AXI A;  1Y1A A;  1M46 A;  1IJ6 A;  1ZAC A;  3NSI A;  2I7A A;  4C0J A;  2NZ0 A;  3NSL A;  2EC6 C;  1CM1 A;  2F3Y A;  1KFU S;  2LMV A;  4USL A;  3JTD C;  1J1D A;  3CR2 A;  1QV0 A;  1A75 B;  1QXP A;  4I5L B;  1OMD A;  4NDD A;  1NCY A;  4OCI A;  1IKU A;  2ZND A;  1ZFS A;  1CFD A;  4YGD B;  4JPZ B;  3DVE A;  4JWQ A;  3PAT A;  2M7L A;  2BEC A;  4ICB A;  2JT0 A;  1J7O A;  4N5X A;  1BG1 A;  5GQQ C;  4NDB A;  2KAV A;  4WQ2 A;  1KFU L;  2Y5I A;  1A2X A;  2PVB A;  3ZWH A;  3TUY B;  2LV7 A;  2LUC A;  4AQJ A;  3I5G B;  3DVJ A;  2K7O A;  3BUN B;  1SNL A;  1SR6 C;  1JWD A;  2L5X B;  3DF0 B;  3WXA A;  2Y1M A;  2IS9 A;  2KFF A;  3CR4 X;  4GPL B;  4OVN F;  1G33 A;  1ZOT B;  3OB2 B;  1OOJ A;  1QX7 A;  2EC6 B;  1K93 D;  1NIW A;  2AAO A;  4GUK A;  2JNF A;  3JTD B;  4YGA A;  3D10 A;  1B4C A;  1WDC B;  2OTG C;  1SRA A;  2K8M B;  2BE4 A;  2KI4 B;  2KQY A;  1B8C A;  1B47 A;  4CFR A;  3JVT C;  4UPG A;  3BUX B;  1BOD A;  4I5K A;  1SCM C;  2M3W A;  1HT9 A;  5AAN A;  1RJV A;  1BT6 A;  2HQ8 A;  4MSP A;  1KK7 Y;  2CNP A;  5HKY A;  3VRR A;  3K21 A;  2KFG A;  1YR5 A;  3TDU A;  1DVI A;  1IH0 A;  1ODB A;  1ZUZ A;  2KAX A;  1IRJ A;  2Q91 A;  1EG3 A;  3RLZ A;  1CB1 A;  1N2D A;  3SG2 A;  3SG5 A;  2MHH A;  5HKZ A;  1KFX S;  3QRX A;  4PHM A;  2LVI A;  1KSO A;  1OZS A;  2KFH A;  3CLN A;  4PE1 A;  5DKN A;  1ALW A;  1K94 A;  2M9G A;  3VRN A;  2LMU A;  1QJT A;  1S6C A;  1D1O A;  1S26 D;  2G2B A;  1NX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...