3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
3OT9A 1AUKA 1KHLA 5DLWA 4CYRA 4UPIA 5INHA 3TX0A 3UN5A 3DYCA 1ED9A 3MK2A 1URBA 3M7VA 2W5RA 3A52A 4MIVA 5LIAA 3TG0A 1KH7A 1EQJA 4FDIA 5AJ9A 2W5QA 4UPKA 1N2KA 3NVLA 4N7TA 5LRNA 3NKMA 1ELZA 3ED4A 1KH9A 3NKRA 4NWXA 5K4PA 3T02A 4B56A 2GSUA 3E2DA 4CYSA 5DLTA 4TN0A 3UN3A 4QAXA 5DLVA 3MK1A 1Y7AA 2W5TA 4KAYA 1Y6VA 4LR7A 1EJJA 5EGEA 4MHXA 3CMRA 3WAVA 5LRMA 3B5QA 5HRTA 3M8YA 3KD8A 1ALHA 1HQAA 3DPCA 4ZG9A 1AJDA 3IGZB 1EW8A 5L0KA 4FDJA 4LRCA 1ED8A 1EW2A 1E3CP 2GA3A 4CXUA 3BDHA 2IUCA 4LRDA 2XRGA 1KHJA 5C66A 2QZUA 3SZZA 1ANJA 2ANHA 3NKQA 4KJGA 5IJSA 2XR9A 3TWZA 1AJAA 2IUCB 3M8WA 1E1ZP 4LR8A 4NWJA 1KH5A 2W5SA 1HDHA 4YR1A 1B8JA 1URAA 1SHQA 3UNYA 3BDGA 4ZG7A 1AJCA 1N2LA 1KH4A 1ALKA 4GTYA 4ZGAA 2ZKTA 3NKPA 1HJKA 4UOPA 2G9YA 5TJ3A 3BDGB 4CXKA 5EGHA 2W5VA 4UORA 3T01A 2IFYA 5KXAA 1O99A 1E33P 2D1GA 3IGYB 1ELYA 2GSOA 4GTZA 5GOVA 5LQQA 4LREA 3LXQA 1EI6A 1AJBA 1KHKA 3Q3QA 4UPHA 4LRAA 3UO0A 1E2SP 1EW9A 1FSUA 1K7HA 2VQRA 4LQYA 1ALJA 4CXSA 2W5XA 3IDDA 4GTXA 3WAXA 4UOOA 3WAYA 1ANIA 2GSNA 1KHNA 1P49A 3MK0A 2X98A 3M8ZA 1ELXA 3BDFA 5GRRA 4GTWA 1ZEDA 4KAVA 4UPLA 3NKOA 4KM4A 2RH6A 4ZG6A 4LR9A 3NKNA 3SZYA 4KJDA 4LR2A 4MY4A 3WAWA 1ALIA 3WBHA 4LRFA 3T00A 1SHNA 2W5WA 1O98A 1ZEBA 5L0EA 1ZEFA 2GLQA 2W8SA 2W8DA 5IJQA 3UN2A 4LRBA 5L0BA
chains in the Genus database with same CATH superfamily
2HGNA 2PT0A 5A6WA 4DUZF 4H4OA 4ITSA 3HK2A 2VQFJ 2FPHX 4DV3J 2MGZB 1RAAB 3A3OB 3X1LB 4WFNQ 1FDAA 2QLWA 3OL6A 1GXUA 2JNJA 4ANEA 2AF6A 3EUNA 2YXLA 2MY7A 2FLOA 1KLMA 2DR6A 4USHA 2VDHA 1PG5B 2Z2LA 1X9MA 3FUYA 1AFIA 2IIHA 3WIUA 1XIQA 4ZCLA 3N6MA 2ANHA 3NKQA 5GADI 3K58A 2L9WA 2FJEB 4DV0J 4FPRA 4C8ZA 1S6QB 3D2WA 1CULA 2EVZA 3Q0AA 3D1QA 2CQBA 1Y4ZB 5D77A 2NXNA 3B4MA 2W5VA 3W64A 1VBZA 4A8SA 3EPGA 3LP2A 1VIXA 3I5CA 4HR2A 1ULRA 2G0CA 4KHPJ 4W92B 2A1BA 2GX8A 4E0DA 2V4RA 2ROGA 3MD3A 2BBEA 2W9CA 3BSAA 2YX4A 2MY8A 1HNXJ 1RE1B 1BHNA 1IQTA 1N2KA 2VH7A 4QCLA 4F0MA 1UWBB 2QA1A 2GNKA 1SJ1A 4HYKA 4ED0A 4K4SA 3BR8A 3I0RB 4NLVA 2HS3A 2HRUA 2IDEA 4DWIA 3OXGA 4CTAA 4ZG9A 1WOSA 5KFQA 5B0FA 3W2VA 2Z57B 3D3CJ 2VUGA 2LU2A 2GMHA 4MIBA 2Y0SD 3HFKA 2RILA 2E9TA 2VJVA 5EHHA 1N5VA 2KJWA 5HMYA 1NHVA 2CQ2A 1VS3A 5BYRA 2RDJA 1KH4A 3HVTB 5J2MA 1P27B 1JLCB 4YY3F 2MJNA 3VVUA 4V1Ak 5CA5A 4FF1A 3K8VA 2RB7A 3ETMA 3DGVA 5U47A 1RBOB 3VCDA 1PSDA 3THVA 4X4TA 1W25A 4PAAA 2ZVIA 4URQU 2VBYA 3HHNB 2DO0A 1MWZA 2OKQA 3KMQA 1YSJA 1U45A 4GKKF 2DHAA 5K9FA 3PW5A 2MPUA 4X66J 1RKIA 4ZVRB 4B3SF 4DSLA 1FD2A 2J9DA 1UP1A 4JV2A 3PW7A 4DSJA 3C16A 4ED2A 3J7Z5 3SMZA 2HZVA 1Q5VA 3W8GA 2N82B 1U0HB 3DYAB 2X51A 4TU8A 1NPPA 5MAOA 2KT3A 1AJAA 2QE5A 3SV4A 4NWJA 4RUAA 2O1PA 4W98A 3MOZA 2CNOB 1FXRA 1HJKA 4ZMMA 4P73A 3QGIA 3MCMA 1S4FA 2VPWB 1TKTA 5JVHQ 3EGNA 4F3MA 4X4NA 2BA9A 1D9FA 3L7PA 3L7UA 2Q6BA 3HD1A 1HBUB 5IT0A 3MM9A 4OMFG 4K4TA 2DY9A 1D9AA 3R2CJ 4E98A 1FNOA 3TZXA 1XBWA 2N3LA 2CQPA 4V19J 2UXCF 2F65A 1SKRA 2GAGC 1X0PA 2W9BB 5T7LA 3KLVA 4XPEA 2EFNA 1L3SA 4DV1J 3EMTA 5IXUA 3DGPA 3DLBA 3C14B 4O3SA 4ZPAA 2DGWA 1FHTA 3EXCX 4P74A 1QAJA 1X7VA 1LXJA 2O01C 4XO0A 1MG7A 3CCUS 5HBMA 4X4OA 3GJRB 1T95A 3BDGA 1V5VA 4K0KJ 2HPUA 2W2QP 3GSIA 2COLA 5AJ3F 1FFWB 1X4CA 2J7UA 2BKNA 4AXJA 3N9UC 2B0GA 2ZH5A 1FSUA 1RCOB 1N48A 1VJWA 1S77D 1TAQA 3T6JA 1WC4A 5C25A 5SZTA 1FDNA 3KK3B 5HVGA 2H54B 3UVJB 1KLNA 3C6TA 2R7UA 2EK1A 1JLAB 2GMJA 3TJAA 2MKYA 2GC8A 3D6FB 4ECXA 1RT6A 3MM8B 4O0IA 5DLWA 2EC2A 2V67A 1SL0A 3F0NA 2CVEA 2CJQA 2I6WA 3EVMA 2WVEA 2I1RA 1SQFA 2BJDA 1IWGA 2XY6A 1UAWA 3RAXA 4O3RA 3QO9B 4OL8A 3O5TB 4LF7J 1WHVA 2V8VA 4D3HA 2VKZG 1Y5LB 1JLGB 4DV7J 2RQ4A 4ZVUB 1GTEA 3J7YI 3RB4A 1FFSB 2HG4A 4M94A 5I42B 3G6XA 1NJWA 2DGXA 1V3ZA 3QWPA 1XMQJ 1L3TA 3PACA 1NZ8A 5D0RA 4ANDA 2RU9A 1R3NA 3FCHA 4HT5A 1Q86T 3LGHA 3NEKA 2EG1A 3JQKA 3GV8B 3IRXA 4CYUA 2WBMA 2IM2A 4CH0S 1IWAA 2R2SA 4M63A 3A8KA 3MD1A 4LRBA 1FK9B 5B0DA 3ILOA 3GQCA 2VKRA 3F73A 1WJ9A 4LFAJ 1TKXB 2G2OA 3KJVA 2W7OA 4DLEA 1PCAA 5GMDA 1VC6A 3SBMA 4DPXA 4KJIA 2HLUA 5K4PA 1HNZJ 2NPFA 2U1AA 1WELA 2VICA 1VRUB 4OHXA 1VCTA 1AB8A 1IM4A 4ZP7A 3H4BA 4OLOA 2SXLA 3GONA 3OTOJ 3UWTA 3GFXA 4MIAA 4IFVB 1E3CP 4TYAA 4U7CA 3FCVA 2KM8C 1XERA 4F3QA 2ZH2A 1K44A 1EKSA 1NK6A 1E33P 3GMGA 4UPHA 1E2SP 2HVEA 3G6ES 2F3JA 5J2NA 2CG4A 4MK7A 5HO4A 3US5A 1BC6A 1KHVA 2ZZNA 1RI7A 4NLWA 4KBIA 1FJEB 5L0EA 1GMUA 2HQ3A 1NKCA 3CJKB 1F9FA 4NA1A 1DBDA 3EZ5A 3TX0A 3EVWA 1URBA 3DOKB 3QRPA 2Y1RI 2IRXA 2V8GA 3T1HJ 2ZHAA 1RT7A 3ENAA 1X8DA 1TU0B 4IOBA 2YWFA 2QX0A 1NCLA 1NAQA 4OQJA 4DMZA 4KV8B 4LBIA 3CEDA 5LMNF 4ED7A 1NSAA 1WDDA 2RF2A 4UQGA 2E29A 4KY3A 4NCBA 2YX1A 1WHXA 1QAXA 3FVYA 4BDPA 3CDBA 5HLFB 5LJ3Y 1GQEA 3CCTA 2RKIA 5IQ6A 4WTOB 2WONA 1CJTB 1OMSA 2F4VJ 3FFIA 4X4RA 1I6JA 3M9NB 2LXIA 3G82A 5GRRA 1MMNA 2GVDA 1IJEB 2IA6A 4ER8A 3VHQA 1ZEFA 4YDXA 4ID5B 2GO9A 1CLFA 2H4YB 4JV0A 1SPBP 2BQUA 1FKOA 1RLCL 1UVJA 1EP4B 1LWEA 2NZ4A 4AXIA 2DNPA 2XZWA 2ZBCA 1JJ2R 3MEGA 3W2WB 4ZN3A 3TX8A 2BW2A 2MQMA 2PDAA 3LWMA 3CGIA 4QAXA 3OTEA 2MLZA 3NCQA 1XTZA 1YHQS 4MKYA 2L48A 1WNEA 2KN4A 1HWLA 3M8YA 2DK2A 3BB5A 3EDQB 4FBTA 2Z4PA 8AT1B 2QL9B 1WG1A 5J1NA 1YJUA 2GVZB 5B0GA 3AXMA 3GJSB 4Q7AA 3FDSA 1MWYA 2RNEA 1MN9A 3PVXA 3NCPA 1PILA 4RW9B 3LP0B 5HP1A 5LXYA 5KFIA 5M2RA 1FERA 3R5AA 1UFLA 3AA8A 5KG4A 4CLWA 3S1TA 3QGHA 4G1QB 4Y65A 1HI1A 3IWLA 1C1CB 4ED5A 1K73T 4L72B 5ITHA 4OJHA 2ZH4A 4R8UA 1UA1A 2V94A 1DJ0A 3OVSA 3CC2S 1ALIA 3T00A 2CNLB 2YWHA 4USJC 2C2MB 1S99A 2E5GA 1TL7B 5HN0A 3JYTB 1S76D 1IKXB 4CLLA 2N4CA 3MPUB 4NMLA 1U2RA 5IM0B 3MMBA 4I6AA 1EQMA 2ALZA 3BO3A 4UY85 2NR0A 1UJ5A 4QQBA 1KH9A 1LOUA 2QG9B 1FNMA 1UPMB 4LIRA 3THTA 1FRHA 4RWXA 3I82A 3L95X 2BZ2A 2AYBA 3ISZA 3DLEA 1F1BB 3W9JA 4ZPBA 4K4ZA 2VFRA 1Q53A 2EFGA 1UVIA 1OY6A 3UD5A 2UXDF 4LR8A 2DEJA 3W8PA 3DLKA 1FXDA 4M5KA 1DTTB 4DUZJ 4B3TF 4NRTA 3K57A 5L46A 4NEZA 4DOZA 3DU6A 5KT2A 1ZM4A 3VZHA 3CD6S 2DNKA 1WTBA 3ZZUA 4LRAA 2CQ3A 4U9RA 3T6BA 4Y2IA 4NXMF 1CC8A 2NCKL 4RR5A 5DETA 1WF0A 3T5KA 1UZHA 3M9MB 1Q5YA 3ITHA 1W2BR 2YPZA 1VQSA 2F63A 2PMWA 5HAOA 1BXNA 5D4PA 4MYTA 4JBCA 1NK7A 2QC3A 1SL2A 1NH8A 4DQIA 3LTOA 4AE5A 4BLGA 4IG3A 1R8AA 4P7VA 1SB6A 4Q8FA 1HPZB 4LT6A 1CJUB 1TKZA 5FLXU 4QIFA 1AJDA 4TXSA 2E1AA 4ZIVA 3HHLA 2E1RA 4E8UA 2HMIA 1VQNS 2NUHA 4ZP8A 1HYSA 2ASYA 4MYUA 1KSPA 4IH6A 3MXHP 1HDHA 1URAA 1A9NB 2ZKTA 1CBKA 4DPWA 4DR1F 1TMJA 2MZSA 2LFVA 4PQUB 2C3PA 4ZCIA 3QZ8A 3MWBA 1LW0B 4ZLJA 4ZJLA 1GTHA 5EWGA 1ZM9A 3DRPB 4W4MA 1NO8A 2MKSA 2DNZA 1RYSA 1L3KA 1UVMA 1FD8A 5J2PB 2YWWA 3CJTA 3I0SB 4C48A 2A6OA 5LSOA 3DYCA 5K8NA 1WKKA 4WE1A 3HHEA 1OPIA 2HQCA 4DX7A 3M8SA 2XQCA 3R5GA 3CXCR 3ULHA 5EX0A 4YY3J 1GNKA 1EARA 1WC1A 4OX6A 2ZD1A 1DQ9A 3VTIA 3AXKA 3HJFA 4RWWA 3VAFA 1FTCA 1LQ9A 3CC4S 4F2RA 2LU1A 4P2FA 3V6KA 2J0WA 4AD6A 4J5OA 4GVLA 3BEGB 4WFZA 3R7NB 5FJ4A 2ZZTA 3IBFB 4ZVQB 3OBIA 2IUCB 1HFEL 3CO9A 2FC8A 4IKAA 1R27B 1RT1A 3JTOA 1LXNA 4CT8A 4WP8A 3QATA 1M5VC 5L1JA 4GKKJ 2W4PA 3GZ7A 2ZKUA 4P2SA 2HK3A 2H3EB 3H7HB 4L76A 5A0YA 4R0JA 3BGRA 2OEJA 2B4PA 3BN4A 1JKHB 5F8HA 2XMMA 1P6TA 4MJKA 3WC2A 4EBEA 2BVZA 2K2PA 5JVGQ 4N7TA 3O44A 3WHIA 1X4GA 2HFVA 5A8WA 5MLCV 3M2RB 3HSJA 4OI0A 1T03A 2B6AA 3AB4B 4CLYA 2BABA 3NNHA 4MHXA 4XDDA 1R8PA 4JB8B 3NOCA 5KFTA 3PHEA 1ZTTA 4ZPTR 4OFZA 4PWWA 4HACB 5IV3A 4NLUA 4OJ1A 2MKCA 2EEYA 1RLDA 5A76A 3W5XA 5CAAA 4EZ6A 5CQGA 2JEFA 2UXCJ 4NLXA 5KFAA 3LW5C 4QJVA 1T05A 3W5YA 3V4IA 1KQGB 2J9CA 5DLFA 4USIA 5DZ7A 3GIJA 1HBNB 3HKWA 1IKVB 2W8SA 4ZIWA 4DU8A 4P75A 4ZP6A 4WF9Q 3FBCA 3CMQA 3OTDA 2Y0BB 1VQ4S 4OIXA 1H2UX 4Y34A 1HD0A 4H4OB 4DN9A 2QV6A 4A8XA 1N36F 4WBFA 2BE7D 2V2ZA 1NNDA 5AJ3J 3W9IA 1FEHA 1WI6A 3WAVA 3A1YG 1KLMB 1RWWB 2HHPA 1REGX 4DFMA 1YRUA 2GZOA 1U1LA 1UCNA 1NHUA 1HA1A 2GO8A 4UTGA 1Y11A 5GAHU 4QWEA 2KH9A 1GEHA 3C66A 4CH1A 2N4DA 4HH0A 3WAXA 2XLJA 3V2UC 4ZVHA 3GV7B 1UTAA 3SCJE 3LP2B 2E7WA 2JX2A 2DXEA 3NGRA 1J2VA 4USTA 2BV3A 2U2FA 4PKDB 1KFSA 4DL0C 2C2DA 5B0AA 1KQKA 4O3PA 3NCRA 3VWSA 3OL7A 2W9CB 3H5YA 4JI6F 3UDVA 2DNQA 1VMBA 4IR1A 2YKAA 2YQ0A 3PG9A 1RWVB 3T9NA 4GKJF 2DEIA 1TVRA 1UVNA 4GMKA 3I31A 4B56A 3MMCA 3OXFA 2OSRA 3MM7A 1S72S 4OYIA 3D0HE 3NBPA 3NWRA 5GMEA 3B5QA 5G4DA 3HHLC 2MZ1A 1HLWA 3MM6A 2UP1A 1NJXA 2GA3A 3QLHA 4CTAB 2QIFA 2VPZB 1KHJA 3W2VB 3LGMA 2ZDOA 1YDLA 1S10A 4WFYA 2WCXA 2HHVA 1VI7A 2FHKA 1Y5NB 1JK9B 1OQ3A 1U2FA 2BACA 2R8IA 2KM8B 5J2MB 2RUGA 4K50A 2K7JA 1Q8BA 2NQPA 1ELOA 2YKQA 4A48A 2AQ4A 2M0GB 2JSXA 1EZZB 3PFEA 1VQMS 1LWCA 4OZ2A 5F8IA 5AXNA 2XMWA 2BUNA 1N0VC 2K3KA 5KFWA 2HAIA 4UOHA 4YB1P 3KLGA 2CQHA 2OEMA 1C0UA 2R4FA 2IMOA 2AMCB 3GIIA 4DL4A 1VQYA 1XNRF 4CO5A 2VFTA 2VHGA 3TUIC 3CJSA 4IH7A 1PJ7A 2ZHOA 4YR0A 3C16B 2KHDA 4R25A 3DRXA 2CPXA 3FNNA 2ZJPQ 3DRYA 3NGKA 4IR9A 3RRKA 1OWXA 2VD3A 3AH6A 2CJKA 1U6BA 3K5OA 3AODA 2MHEA 4KSEB 2E1MC 1M0SA 2I38A 2ZJQQ 4P72A 3QFHA 3HT3A 3JQMA 3U1LA 2MGZA 2W5XA 1Q16B 2WRMA 4K4WA 2OD6A 3CSKA 1TKTB 1TK5A 4K4VA 4LSLA 4EMDA 4NASA 3IC1A 2CJAA 4NLPA 5IT4A 5K20B 2MQLA 4OX9J 2KVIA 5LMNJ 4CRJA 4G1PA 3MM9B 5I3QA 3UDCA 2NUUG 4TQSA 4UPIA 4OHWA 2ZC3A 4CIOA 3MCNA 1IBCB 1F9EB 2A18A 2KG1A 3PRVA 4IOAQ 5L39A 3SYZA 4I56A 5T7LB 3BM7A 1HWKA 2HNZA 5J1PA 3H20A 2HHHF 3DGPB 1KEKA 1DAXA 2V6AA 3CJRA 1KVJA 4U67Q 4J9QA 4A4JA 1FCAA 1VHFA 3PTWA 1URRA 1T9UA 3IBWA 5HBMB 2PI4A 3BDGB 1GMWA 4PG8A 1S5ZA 5BXIA 2RU3A 4RU2A 2FJVA 1Q81T 3K7RA 1S0NA 2WAQD 3E8OA 5C25B 4IO9Q 4HHUA 3DRSA 1R0AA 2ZH1A 4HI1A 3TVKA 2DVIA 3I0RA 1S1UA 4UZBA 3LAKA 1ROFA 3C6TB 1AUKA 3BYRA 4MH8A 4ELUA 1C4CA 5CXTA 1UJ6A 1RT6B 2RHSB 4ECTA 1FRLA 3RAQA 2WVBA 4BC7A 3G96A 3D5MA 1RHQB 1RCXB 1U1KA 4DSIA 2ZE2A 2LQBA 2XS2A 3E2EA 2CNKB 5DLVA 1S6OA 3BV8A 3OJUA 1T3OA 3TP2A 3GFHA 2R2TA 1KDNA 4A8MP 4OX8A 4LVOP 2HK2A 2VASA 1ED8A 3N4WA 3NS7B 1H7XA 2RDDA 2YKNA 1AUSL 3P45B 2FZGB 1H72C 4KKOA 2N7CA 1F2GA 1M1KT 2ATCB 5CD4H 5HMWA 4CZCA 1NM2A 5KFVA 4QR2A 2FVSA 4I6WA 3TR5A 4C3MA 4DV2F 2C2OB 5HMXA 4IUFA 1WEXA 5KFPA 3KJQB 1GX6A 3WX4A 4F36A 1FRJA 1RTDA 3R3TA 2NS1B 4IDKB 1S1XA 3M05A 3A3PB 5F3TA 3AOAA 1IR0A 3IRXB 4CYUB 5LT5A 3SSRA 1Q82T 5KFLA 5C66A 2A0FB 1KHLA 1F6TA 4FS2A 4OZ3A 2YQ3A 2UXDJ 4F26A 2CPDA 3M4XA 4JI5F 4UW2A 3D6TB 4UUXA 4DSKA 4DR5F 4B3TJ 1VBYA 1DLOA 2QFJA 2GSUA 3M8RA 5E3CA 2RS2A 4OZNA 3RBDA 2FTRA 3DXSX 3QSIA 3PDNA 3GLJA 1JMTA 3IMQJ 4KO0A 4NXMJ 3DPCA 1K1SA 4HH1A 3OR1A 2FY1A 3AD8C 1X5PA 4O4RA 4B3MF 1WI8A 1KH5A 3NWGA 1H73A 1LWFA 2YX7A 4WFXA 4QU6A 3TJ8A 2QL7B 1ZAVA 3TW0A 1SXLA 2VPYB 3CF5Q 4TYBA 2DKOB 3A4TA 4CXSA 3KK1A 1HBOA 5J2NB 1S9FA 2YKMA 2XS5A 3L7OA 4NLDA 2CPJA 3IM9A 2LEBA 5DG9A 1WC0A 3N5FA 5C24A 4NCAA 3K17A 3KK2A 3U1MA 3FK4A 4DR1J 5DLTA 1RT7B 5HROA 1KRPA 2MB0B 4DXLA 3CMRA 1JNZB 2DD8S 4AQYF 1R6VA 2UUAF 3A8JA 3BN7A 3LANA 5KFRA 3WQPA 1OSDA 3MR2A 2RF2B 5IQQA 2W4CA 3Q24A 2VA2A 4M95A 1PO6A 3HI9A 1IM6A 2F8EX 2IC3A 3TQ1A 3CCSS 4MK8A 3Q8YA 3EX7B 1N32J 1HL6A 2XULA 2RKIB 2YH1A 3JTNA 2WONB 3NGSA 5F0UA 3FFIB 4DSFA 4OYZA 4F25A 5LSLA 1EX8A 2RD5C 3G82B 1OYDA 5K8MA 2GVDB 2VV5A 2F40A 4OHZA 4DN0A 3MR5A 4DR2F 2YPYA 3MI7X 1UFKA 5L0BA 1SCJB 3KHGA 3LWLA 1IKWA 4CLKA 1ED9A 3MK2A 2BEFA 2FD2A 1FKOB 2G13A 5F0WA 1LWEB 4LFCF 3MEGB 2JHEA 1KOHA 1OSCA 2DISA 1XC9A 3AHPA 3J7ZT 3BQ0A 4QU7A 2AD9A 1HW9A 3U1NA 3PYFA 5KT7A 3JB9k 4C6AA 4ZVEA 1PGZA 2HBZB 2OFHX 3MR6A 2UXBF 3NS6A 1R8BA 3L9ZA 2XRGA 3EM1A 3PKYA 1P1TA 1RHUB 1CJVA 3DHXA 2ACYA 2VU5A 4J9SA 4B9NA 4F4KA 3R7SB 5B0BA 2V63A 3QT5A 2FQQB 1S9EA 1KQSR 5HP1B 4QR1A 3U7JA 1SKUB 1AA1B 3HHDA 1VQPS 1U1QA 1CQNA 1YJ9S 1RUSA 1N6QA 2HFOA 1PKUA 4CT9A 2LXFA 4R8UB 3KHLA 2OGUA 1SKWA 2ALYB 3UR3C 1U48A 1SKSA 4Y6IA 4NA2A 2UUBF 2KZMA 3MMBB 3QT8A 2BYCA 3UQSA 4CLPA 5JXSA 2DNOA 2ZH3A 1F2HA 1RT4A 3HMJG 1Y7AA 3QZ7A 4NRUA 4ZP9A 1Y6VA 5GMKa 4ZS6A 2BM1A 1HNIA 3JQJA 3DOLA 3DLEB 3M8PA 2H65B 1RAIB 1FRXA 2XNQA 2KKHA 3VR1A 1NPKA 4ZITA 2CKWA 2UV8A 5L9XA 5L9NA 4C8OA 1G1XA 3DLKB 2QMUB 3DI6A 1FWKA 3T19A 4OZ5A 1N36J 2VQRA 2G9OA 5E3AA 1QUVA 2W7PA 3NKOA 4DL7A 4JOUA 4U7UD 2I5JA 1ZA2B 1OYEA 3UPFA 1T11A 2D9PA 3L4BC 3EJMA 1TV6A 3ITHB 3MPVA 3V6JA 3T3FA 3H40A 4YN3B 5LIAA 1RAEB 2XO6A 1PC5A 1QSLA 4H54A 4RKUC 4CH7A 2O66A 4L73A 4Y3CA 2V5HG 3SDEB 2XSFA 3SFGA 3S8SA 3K59A 1EQ0A 2F1FA 3TEHB 4IG3B 3TNVA 2MZTA 5E3PA 2JJ4D 2XMKA 1N4LA 3HHLB 5IJSA 1U8WA 4J9RA 2ILZA 2HMIB 1HYSB 2LXUA 4GTYA 4JI6J 1NHKL 1WORA 1GMVA 4X4UA 2ZWPA 1CJKA 3PHTA 5T41A 4UOCA 4Q8EA 3VV2B 4GKJJ 2R8HA 5IZHA 5DDPC 2DJWA 4K4YA 3W61A 2GJ2A 3CIZA 2AEFA 4ZCMA 2C2ZB 1VRTA 5KFHA 2AV5A 3KKFA 3J81Y 3DFEA 4A8QA 1XMOF 4DPOA 5KFMA 3R6GB 2LYVA 2HVIA 2OPSA 5KOXA 3OSPA 1WTFA 1K0TA 2X7IA 2ZVSA 3FEZA 2H4WB 1WEYA 4WE1B 2XSJA 5KG1A 1BGXT 1HMVA 1Z2ZA 1HARA 1RHJB 4MT1A 2LKZA 4JI1F 5HL7Q 2YTCA 2JEGA 2ZD1B 1HNVA 2PA8D 5D0EA 1EKRA 1FESA 3D66A 5I3PA 4K5RA 2BDPA 3G8SA 2HIYA 3OVBA 4FF2A 4LRDA 1SH2A 3HZGA 4P7TA 4ZLLA 2M2BA 3R27A 2FVRA 7AT1B 5C2CA 1L3UA 1KS2A 4DF8A 2JEIA 1DHMA 4J9VA 1RT1B 4EBDA 2V4JA 4IOCQ 2V8HA 1K7HA 2HSEB 3GCWP 2N7YA 1MU2A 2UUTA 1SHNA 5A0YB 3BGRB 3QFWA 3CCVS 4QIGA 4BBYA 2DTJA 2P6SA 3KMSA 2RSQA 1C2PA 1NPRA 2MMYA 2NXEA 2LA6A 3CJ5A 1YI2S 2AX0A 4QOTA 4F02A 4WKYA 1DARA 3GU0A 5A8WB 1K8AT 4CLSA 3CULA 3CMES 8RUCA 2B9EA 3MUTP 4J37A 1T03B 2B6AB 2Z2YB 4YOEA 1Y3JA 5KG7A 1S97A 2LA4A 3QGPA 4RW4A 1KN6A 3GCXP 1TUWA 4NPOA 4AL7A 1JQGA 1WHYA 1Z4UA 2CNNB 3BR9A 3O8WA 2M88A 1N2LA 3FEYB 2HHSA 1SI9A 2DIVA 4OYXA 2C2KB 1IKYA 1VQKS 1SH0A 4KQZA 3QBCA 3BDEA 2CPYA 3DCAA 1ZPVA 3W63A 4ED8A 1T05B 3QIPA 1H2TZ 4BC9A 4KJDA 4MY4A 5AXLA 4KRWA 4DBQA 1K9MT 3V4IB 2CPZA 2M9KA 1HPZA 2HHHJ 4XPCA 4CO0A 4NLTA 3Q83A 1SJRA 3GYXB 4NLSA 1PIEA 1TMMA 4LSZB 1Y7PA 2DNNA 3NVLA 1H0HB 3QT6A 3OV7A 2X1GA 1S0OA 4ZJOA 1VQ5S 1W2IA 1HBMA 3WDOA 2P9CA 3WZ0A 2P9EA 2J9EA 1RTJA 3OFGA 1HQAA 1WF1A 1Y10A 1R0CB 1F60B 2XMAA 2YKOA 2MKKA 1PYTA 3LH2S 3MEDA 3U27A 4WZMA 1JLQA 4F4XA 2GMLA 3VQTA 1JX4A 4TN2A 1NK8A 1ZAXA 1S1WA 2DHSA 3Q89A 1QVFR 2GSNA 3NGTA 2PC6A 4NLQA 1MSWD 4ALZA 3HHKA 2W7AA 1WSRA 3SZYA 3F41A 1S6UA 4CLZA 3TVYA 3B8HA 2R42A 4KFBA 3I56S 2Q79A 1XK8A 4CWBA 3ENQA 3FKBA 2YY3A 2HVHA 4UY8T 3WC0A 2UU9F 3QPIA 4QZVB 4G1IA 1JIHA 2R8JA 2HNDA 2OPPA 5L1KA 2FLPA 4ED4A 4HDHA 2ZH9A 4DV2J 4UUWA 3RR7A 1TVRB 5GAGI 3MMCB 2I8EA 2LMIA 3MM7B 1P9YA 2ABYA 5E7OB 3NBPB 2HRYA 2Z8QA 4CP5A 1U4BA 5KOWA 3MM6B 1AYEA 5HJXA 2QZUA 4Z2XA 5AE2A 4EWTA 2GQQA 2AEJA 1JLBA 3QLHB 3R5BA 1SC4B 4Y28C 2ZZMA 5ETVA 2Y1LB 4L75A 4V19X 2RAQA 1N52B 1NK0A 2VZ9A 2QMWA 1Q1KA 3J81U 3Q3QA 4DJBA 3WBZA 1Q7LB 2VFSA 4PCQA 4MKAA 3NKNA 3EWGA 3RU0A 1KKHA 2JFKA 1NSQA 2MSTA 4EBCA 1U25A 1SL1A 1QTNB 4UOGA 2GQCA 1LWCB 4NZ7A 3PX6A 4B3MJ 2J6SA 3WIVA 5E0OA 2P8IA 5ETTA 3BBFA 5LRNA 3KLGB 5ETSA 1LK7A 4LF2A 1C0UB 1NSPA 4JI2F 4JYAF 4DG1A 3BGOP 4LR7A 4ZVOB 5DDOC 4C3LA 2P5VA 2HHTA 3D28A 4DV6F 1NJIT 3I5AA 4EU0A 5KFYA 4DL5A 4ENOA 4LF6J 4ECWA 2VJUA 4URSA 4DZDA 4X4PA 2W01A 2ZM6F 4AFFA 3UCGA 4DL6A 4B9UA 2ACMA 1RTIA 1X4EA 4ID8A 4WU2A 3GSDA 3MR7A 1S7IA 3B6BA 1HNWF 2W2PP 4ZHRA 3OTCA 2MYFA 2OFGX 5LSRA 1NXIA 3BKTA 3KLIA 1YRXA 1JLFA 1XJWB 4LSLB 1FWLA 4AQYJ 2UUAJ 2W8DA 1AZSA 5CH7B 3KOAA 2WBRA 4O23A 1B0PA 2W8LA 3BDPA 2PMZD 1VDHA 5RUBA 4USKA 1R7IA 3CO0P 2FJXA 2I2YA 4NWXA 3VAGA 3RUBL 3IR7B 4U96A 3CVKA 3HSZA 4Q0BA 3MK1A 4DV4F 2GV1A 2HNZB 3S7RA 1VYAA 3IGZB 3T9ZA 1RQ0A 4H4KA 1YQHA 3Q22A 3NGDA 2BQ3A 2WSCC 1OY9A 4DR2J 1DZ5A 3RW7A 1KQFB 5DO2A 3SXLA 4M5DA 3H8YA 3EDRB 2D3OR 2Y3YA 5GAEU 3CJ0A 4UORA 2VQEF 3MOJB 1ELYA 1QSYA 1YJ7A 4LFCJ 4LFBJ 2IHR1 2HFZA 2Q1LA 4M1KA 1NDPA 5F9NA 1RWUA 1OIAA 5KFCA 3AOCA 4A47A 1PJ5A 2RS8A 4M8LA 1HQUA 2V69A 1YGYA 3DRSB 4WIQA 1R0AB 1G7CB 4DLGA 1U8SA 4I69A 1J5EF 2UXBJ 1J27A 3CJQA 3L09A 1S1UB 3DMJA 4FBUA 4B3OA 1YWXA 4KAIA 2L3MA 4FDIA 2LEPA 1Q0NA 4BCAA 3DRRA 2W5QA 6FDRA 1M5SA 4WYWA 2UV8G 3DC2A 3AJ1A 4LQ3A 5DG8A 1BQNA 1HI0P 1H38A 4I1TA 2ZE2B 5M2UA 1U49A 2QTWA 1K0VA 2J5AA 3FBEA 1XN9A 3KFWX 3KJNB 4HTIA 2XHCA 3AA9A 1VIOA 5J1EA 2YKNB 1GT8A 4KKOB 2JDJA 4GO7X 2DCLA 4MKBA 4J9OA 4UZCA 3HHLD 3UD4P 2IFYA 2CZVC 2UUBJ 4NZ6A 4A8KA 5D4OA 3PO5A 4CLFA 1ICEB 4ZVFA 5CYMA 3ENVA 1RTDB 1S1XB 5AE3A 4C97A 3W1YC 4LRFA 4IYQA 2GLQA 3R5JB 2X1AA 2HFSA 1WC3A 4NEYA 3MTJA 4NE9C 1NK5A 3LOUA 4NMXA 3DHWC 2EFPA 1RAOA 4ZOSA 5DDQC 3EGVA 1UJ4A 2DB1A 1WOOA 2OP5A 3I32A 2XEXA 4FF4A 2XMUA 1DLOB 3M1VA 1NK9A 2KB2A 4NZ0A 2H48B 1TR0A 4CLTA 3KWMA 1OQ6A 4IFYA 2E9ZA 4KO0B 3DNCA 3NMRA 6FD1A 5C5JA 1M5PC 4QYZK 4QW8A 3GIMA 3OR1B 3N6LA 4FXDA 2HFNA 3UFCX 3G6VA 4YFUA 2WK4A 2VG6A 2BJ9A 4R5PA 1LWFB 1T7PA 5H9EJ 5KG2A 5GADU 3QWUA 4LF5F 3PX0A 2NXJA 1V3RA 3IS9A 8ATCB 3PJXA 1NDLA 3TAMA 5DG7A 3R9LA 3NOGA 3TEGA 1RT3B 1EHWA 4FXVA 5F9LA 5G0RA 3KK1B 2WVDA 3P96A 1HBOB 2IDLA 4JUZA 5E41A 1B3TA 2BJEA 3BYPA 1YBTA 2YKMB 3KUEA 2CADA 2IJRA 1C4AA 2ZH7A 4ES3A 5A8KA 1S9GA 2YBVA 4CM2A 1ZM2A 5A8RA 3ZZTA 5C24B 5DS7A 3R97A 1UEUA 3JS9A 3KK2B 4IRKA 5FDLB 3AQPA 4ELTA 5HROB 2ROEA 2FZKB 5L1IA 5IV4A 5IS2A 4DSEA 4ILLA 3CDUA 4CNYA 5JMNA 3HSDA 4WP3A 2CUYA 3K0JA 1XMOJ 2BKPA 1HI8A 4ZPVR 2I9SA 4I64A 2IC3B 2NPIA 1QJHA 4YQWA 2JZ5A 4B9SA 2UUCF 1FKPA 4HLBA 2W8KA 1KHNA 1RTHA 2RT3A 4PXBA 4JI1J 3H4DA 2WHOA 1NJYA 4X66F 2B9WA 1RJJA 2LP4A 1UWAA 2BR0A 5C42A 4ERDA 4XAKA 5INHA 1Q8IA 1U26A 2CXEA 3A52A 1D8YA 1IKWB 4KIAA 4WPAA 4P2MA 3JSMA 1HQ2A 4F0KA 4GO5X 1A0OB 2C2EA 1KVKA 2RRAA 2J0QD 1L3VA 4H4KC 2AZ1A 3RB6A 2OTJS 2W1BA 1GXTA 5J2QA 4IDKA 2Z2MA 4UF4A 1LFPA 4ILRA 3EVOA 4MTPA 3QNWB 3PIOQ 2AYEA 1JLEA 3EZOA 5H9FK 5EDWA 1B0VA 1CJVB 1R43A 2RUSA 2AYMA 2R7XA 4P9SA 2BJ8A 1XNQJ 4YEAA 4CXKA 1FA0A 3J7AN 4O3QA 1LV5A 1S9EB 3CJ4A 1H74A 2D74B 1I51B 1SIWB 1M90T 3BGFA 4OI6A 3P5TL 2F8MA 3SCKE 4EUVA 1N6QB 4NLYA 2AEMA 4ED3A 1HIYA 4TY8A 1APSA 2AJFE 5AXMA 2FJBB 1KTVA 1PJ6A 5I3UA 4C8LA 2HWHA 1V9OA 3A8EA 1BWVA 3R7BB 1ZTWA 4O44A 4Q2LA 2OSQA 4FP9A 1Q78A 2VC0A 4IH5A 5ETRA 5H1SV 1RT4B 3HVRA 2XZTB 1W7WA 3HULA 5FLXY 3D9BA 1OS5A 1TFWA 1U6FA 1LW2A 4L3KA 1JB0C 1HWIA 1HNIB 3NRBA 2ERRA 3DOLB 2MTLA 1SQGA 4YDDB 1S0VA 3TUPA 3M8PB 2DR8A 2BM0A 3ETOA 1U0SA 4FPIA 1KWMA 2QLBB 3C6UA 1RZMA 1YVFA 1LEOA 2HBRB 2KHCA 4NYOA 1D8ZA 3DI6B 4N5SA 4CQ1A 2YNIA 4P71A 4FZVA 1C0TA 2Q43A 4H4MA 1T9WA 3Q8PB 3ZZPA 3H25A 3QT7A 1HQEA 2I5JB 4KGZB 2HW3A 1KHWA 4LF7F 1AFJA 5CCLA 2KO1A 4USVA 2KFZA 1RU2A 4FN5A 1TV6B 2FJDB 3MR3A 4WIIA 1I5OB 3QMQA 2FY8A 2GIRA 1QVGR 1RK8A 3FMBA 3RRHA 4TKTA 2NXCA 1IBLF 1IR2A 2WOMA 3CNQP 3VVTA 4DR4F 4JP8A 3H2LA 4L74A 4K2JA 4RJVA 2ZNZA 3U02A 1IBKF 1SC1B 2DRDA 4DPUA 2IRUA 2DGOA 3HM9A 2ASLA 1NDKA 2YKPA 1KOOA 4KTQA 3PRDA 3IAM9 4L3NA 3UNYA 3TUJC 1Q95G 2RDIA 1SIZA 4I6YA 2QLJB 5F8LA 4RW8A 2VG5A 1PYSB 2QSFA 3AAWB 3J7YU 3Q8VA 3CPWR 1SC3B 3C2PA 1CJKB 4HDGA 4U8YA 1BE4A 1JNRB 2OIHA 3TA1A 4MKVA 4DI6A 3DLGA 5KFZA 3SSQA 4WCEQ 4RL1A 2Z58B 3OT9A 1N5YA 3IFEA 1VRTB 2VB6A 3VGUA 4WU3A 4K4UA 3SQOP 5KFJA 2NREA 3C46A 2G1DA 3C15A 4DCJB 4XIUA 2OPSB 2E1CA 4NYPA 1GH8A 2RRNA 4LSNA 4ECSA 4RU9A 1QLNA 4F0HA 4TY9A 2XSJB 3D1OA 2VG7A 1HMVB 1YBUA 5HMZA 1X4HA 5HI7A 3HFVA 1HNVB 2M5YA 4RW6A 4X65F 4C8YA 4X2BA 3SSSA 2XI3A 1EJ7L 3IN5A 2ZOGA 4CM0A 2QEXS 5LJ5Y 3HLUA 3JSRA 2F9JA 3Q23A 3UE2A 1AJCA 5A2QY 3K5NA 4XDCA 2CFXA 2N3OA 3HZEA 2JVRA 2ZHBA 4M5NA 1HHSA 1WWHA 5ETKA 3TYTA 4DEZA 1YBAA 3AY0A 1NLKL 3NXZA 2GQ2A 4USMA 5KT4A 3ENWA 5DQIA 5D0HA 2BX6A 4AUKA 3R6LB 2V4JB 4JI2J 4JYAJ 3ZZYA 3GYNA 2RQCA 5KFXA 5D15A 1MU2B 4X64J 1PAEX 4DV6J 4LF8F 1TK8A 2EFOA 2DGUA 2L9DA 3D4JA 1E6YA 1RABB 2FLLA 2QYCA 4R0EA 4ECQA 2VBWA 4NXNF 1N5SA 5BJRA 3PCOB 2ZM6J 2CA9A 2BJ7A 1SH3A 3M2VB 5CHCB 2HZAA 2IVMA 4GC6A 1JJHA 3FBBA 4DHVA 3MAQA 4DR3F 1WOPA 1ZYQA 1HNWJ 1TTHB 4PYDA 4TU9A 2IM3A 3KG1A 3OQ2A 4YR2A 2DR5A 2PE8A 7FD1A 3CD7A 4RW4B 4Z7CA 4ZJQA 3SI8A 2O3DA 3NAIA 3DDNA 4EO6A 2FUG9 2F7VA 2BXJA 1RWPB 2IRYA 2AIRB 2KT2A 2PFDA 1RBAA 2RQKA 3I9V9 1TUVA 1IKYB 3MECA 4KH1B 3GWCA 2GIQA 1P49A 3ELHA 1FJ7A 3W65A 3SDEA 4CO3A 4DV4J 3T5JA 1Q8LA 2WB4A 3QIPB 1YITS 2JVOA 3AJ2A 2AJQA 2CQGA 3VAKA 2JLFA 4LF4F 4DR6F 1X4FA 3CJ3A 1Y9OA 3GG1A 1RWMB 2XWYA 1N88A 3PYEA 4ATNA 4YR3A 3PYGA 3ZZZA 1YZ7A 3B54A 3E2DA 5D0GA 1FVQA 4DS5A 2VQEJ 4PPZA 4C7QA 3LF0A 2MLXA 1HBMB 2HGLA 1UFWA 1VRQC 2J9DE 2NLWA 4ZCKA 2V4QA 1IVZA 2FJWA 1RTJB 1TAUA 1M5HA 3SZZA 1DURA 1YJRA 2R8KA 4C2MA 4PWDA 4UT4A 3ZC4A 1XR5A 3PV8A 3HDSA 1J5EJ 3TZYA 2FGOA 2JC1A 2ZDPA 2ZBQA 4WJBA 5DGAA 3MEDB 2V2KA 2C42A 2GCFA 2XCPA 2ADBA 3K5PA 1JLQB 4Y00A 1AJBA 1B64A 4QIEA 2YNHB 1S4EA 4LQYA 4D3GA 3SQGA 3IDDA 3MUMP 3KHRA 4ZPCA 4EYHB 2MKJA 4DL3A 1RAFB 1S1WB 2UVVA 1KTQA 4ZVTB 1YJNS 2EWHA 2MZRA 2D1CA 5F8NA 1TK0A 1N34F 5KAKA 4LVNP 2D3O1 1D0EA 2ATLA 1MROA 4KFBB 1PC4A 2R9LA 5I4MA 3IG1A 3BO4A 4EEYA 1O0PA 2HNDB 2OPPB 1CPZA 3VGSA 3BO2A 1QTMA 1S6PA 1YTYA 3CCES 1B7YB 2HQGA 1T9VA 3BZQA 1Z2LA 2ZITA 4DF4A 2RRBA 2AP6A 4WFBQ 3ILLA 4B3SJ 2XB2D 2E7XA 3QYYA 4ETZA 1JLBB 3ILIA 1MNEA 3ZTSA 2CPIA 2K06A 2M7SA 1V5IB 4N41A 4L6V3 1Q8KA 1EI6A 4Y0FA 2ZOMA 4U7UK 4RBVA 5KFBA 3LUYA 3IWXA 4J9NA 1WC6A 4O4GB 3WAWA 2RH3A 3MZIA 4QYRA 4YS2A 2F9DA 4I68A 1RSCA 4OV1A 1X60A 1V3SA 2W5RA 3M2UA 4G65A 5GVQA 1F9HA 3NKRA 1B7FA 5KFSA 1WSVA 1YG0A 4KB7A 4JI8F 4LF5J 3V6HA 3N5BA 2FHMA 5A2QU 4DG1B 4NOHA 4RNFA 3GE9A 1WKJA 3E01A 1X9SA 3ZNJ1 3OHAA 4HHHA 4Y2KA 4AT1B 4C3KA 1U1NA 2VFVA 4I0WA 3ONQA 3PW4A 1ALKA 2MEWA 3NKPA 3CD5A 1XEZA 4F4AA 2FJAB 3B82A 4GVBA 1RTIB 2G0IA 3HVAA 1G4CA 2W25A 3QIDA 3W5ZA 2E5HA 3LO3A 3ISNC 4CCHA 5D4NA 4N76A 2FHOB 3I5BA 4ZHRB 3M6UA 3EPIA 2LLZA 1REVA 2CZ4A 2MLYA 4HVZA 3KLIB 5D78A 1JLFB 5KFGA 2ZBRA 3DLHA 1TQLA 4WZQA 1AZSB 4I2QA 3W9HA 4DFJA 3FJ2A 3M8QA 4PYAA 1WEZA 2B7BB 3W3SA 1S7HA 1R31A 3TOQA 1N0UA 2H9ZA 3C3LA 3THPA 2YWGA 4DQPA 1RA6A 2UUCJ 4Q0BB 3V6DB 5HRTA 2PGCA 3HSGA 1NJZA 5L0KA 2ROPA 4LRCA 1T9TA 3VF0B 3CCQS 2J76E 3G8TA 1WD6A 1IR1A 3MAAA 1T9YA 2XHWA 3I96A 1K47A 2KFNA 3OTBA 4QWAA 2QLFB 4NWBA 4M5DB 2FDNA 2DY1A 3PEHA 3PO4A 1JXVA 1AW0A 2VONA 4O0NA 2Y8WA 2BE9B 1XWLA 1HR0F 3BBCA 1IXKA 2Z30B 3MK0A 2XBPA 2XLKA 4NI2A 4RO0A 2F8HA 3MM5A 2V34A 3G71S 2LQJA 1T8EA 1A6LA 1QD1A 4RZRA 1RP5A 2R7TA 3G2XA 4WTYA 1WACA 1HQUB 4AL5A 5IC4B 1DTQA 4F4YA 1YLXA 2HKEA 3DMJB 2MKIA 4B3OB 3RBXA 2ZUGA 2VODA 3DRRB 2DPJA 4WYLA 3PRBA 2QA4S 3PFOA 3EICA 2ZJRQ 3POTA 5K5MA 2HRTA 3GILA 3KDOA 3PW0A 1BQNB 2PSZA 2PEHA 4PG4A 2DBBA 3IAS9 2VOPA 4M5GA 4QPXA 1F3VA 4F4ZA 1U1PA 3KLFA 2YH0A 2E66A 5J1EB 3UCZP 3VAJA 2JFDA 4Y2CA 4J7CA 1FI4A 2MQQA 1AT1B 2JL9A 1CG2A 1RB0A 3RG6A 3DOMA 2IMWP 4ICLA 3PW2A 4U6PA 4ZLNA 1U02A 3D6MB 4LR9A 5CYMB 2HNYA 4PQAA 4FYXB 4Q45A 3FSIA 2DNYA 4N77A 3VGVA 4QW9A 3HPOA 1X31C 2XMTA 5B0EA 1UZDA 3H2VE 1ZBTA 4ZVPB 2V2QA 3CUNA 1U1RA 5BYSA 1UEVA 2YNFA 4O3NA 2XMJA 3FSYA 3JSYA 5ETMA 4LF9F 3UN3A 1UPPA 5LL6d 3MF5A 1N56A 4LIWA 2KI2A 3UDEA 4C11A 3M1VB 2M3DA 1YJTA 1M5OC 2DCUB 2AYGA 2MDAA 1R8HA 2R7WA 1RWOB 4QBUA 2D3UA 5IT9Y 4IFYB 1S57A 1HHQA 1VJQA 4RLEA 3PY8A 1FE0A 2GAHC 5E3RA 3V4MA 4BWJA 2DH8A 2DXFA 3T5HA 2E9RX 1ITPA 3OR2A 2VG6B 2V9KA 3LP1B 4R5PB 2X3GA 5DGBA 1I94F 2MQ8A 4FKYA 3BH7B 4XTTA 2MHNA 1ZEDA 1IBLJ 3IS9B 3K89A 3TAMB 4DR4J 3WBHA 2YNGA 3KHHA 5G0RB 2BANB 2XC9A 4I7FA 4X4SA 2R8GA 2IAJA 1IBKJ 3D1HA 3MMAA 3V81A 3GR1A 5F8JA 1H2VZ 2HHQA 4MFBA 5A8KB 4OHVA 1S9GB 4RBTA 2OTLS 4B9LA 4LUBA 5A8RB 2EPIA 2VIHA 2DRAA 2Y1JA 5CYJA 1MN7A 1XMBA 3P49B 1Q79A 2L08A 2NSBA 2W9AA 3NG8A 1LKZA 1RA7A 4LJMA 1SC6A 3W62A 1KC8T 2W5SA 1NEEA 2KRBA 3AFGA 3H0PA 2LCWA 2YVSA 1RDRA 3M6WA 1N5TA 1TL4A 3KUHA 4YUDA 2M8DB 3C8YA 2DNHA 1J5OA 3GYGA 3FBFA 1YJVA 2KVQE 1S0MA 4IRDA 1GFWB 3I4HX 3Q2TC 2D3ZA 2JLGA 1FKPB 4HTJA 5JUMA 1RTHB 5K8OA 3VZIA 3BKUA 2ZWOA 3MPYA 4NX9A 4FNIA 5DZ6A 4BHQA 1Y00A 2DYAA 5C42B 4X65J 3QSYB 1S1TB 3E51A 2OAUA 4UQTA 1UKUA 1O5JA 2V9WA 1FVSA 2BJ1A 5LOQA 1VQ6S 4PR6A 4ES1A 3DU5A 2UZAA 3M30A 1GK8A 4I2PA 3JSMB 3SV3A 2W2MP 1FJGF 3CIMA 4PABA 4F7VA 1ALHA 4WXWA 1RADB 1T3NA 1EW2A 3FCWA 4A8FA 3EE3A 3R5DA 2XY5A 1BLUA 2CJXB 2DH7A 4LF8J 4QIWD 2XYGB 2XS7A 5J2QB 2V0NA 2CQDA 3HO1A 1FDDA 1SHQA 1T9XA 1NKBA 2HQDA 2R7SA 1V6HA 4OX9F 1HD1A 4RX6A 3S6EA 3PIPQ 4HKQA 1JLEB 4RNMA 3MPDA 4X84A 4NXNJ 2CQ4A 4LREA 4DPYA 3UO0A 2MZJA 2HS4A 3DLLQ 2Y1IA 2OLWA 1H7WA 5F8GA 4TVAB 4DR3J 2OUGA 1X4BA 2WZ1A 2V8DA 2DH9A 1F0XA 5BR8F 1RT5A 3NL0A 3T41A 4O3OA 3UCUP 4TNOA 5LMUF 4ETXA 1RYRA 3CDAA 1G3OA 3PNIA 3R2DJ 1MW7A 3AT1B 4TY8B 4AYBD 2DGSA 1SJQA 2QO3A 4KC5A 1QDUB 3IA0A 4TLRA 5I3UB 3ED4A 2QFIA 3SFUA 3RB0A 3N79A 3CW2C 2APOA 4OZ0A 3TZWA 4IG0A 2NYIA 4EI2A 3GFYA 4O44B 4CO4A 3P5BP 4KT0C 3Q8UA 2KG0A 2I0XA 3DM2B 3CWJA 4KHMA 4NLOA 1H6KX 2G2YA 2OPRA 2D41A 1LW2B 1RT3A 2POKA 1X4AA 1TL1A 1FX4A 5IWAF 3PZPA 4ECVA 4LF4J 4DR6J 3B78A 3DDKA 3BH6B 1RHKB 3I4PA 3A12A 4URGA 3GV5B 1SUQA 4F50A 3C6UB 3AD7C 2R7RA 4KAVA 1BMQB 1CS4A 4A8WA 2YNIB 3BJYA 2AJ1A 1C0TB 2C3OA 4H4MB 5FDLA 2MQOA 3QRRA 3O6QA 4OJ3A 4P10A 1HQEB 3KYLA 1EB0A 3QGGA 3C19A 4DQRA 4ECYA 3K5LA 3KTQA 2A10A 2AJ4A 5IT9U 1UW4A 3M9OB 3OJSA 4N8OA 2FIUA 1FJCA 2CJYB 3D54A 2WOMB 2M52A 2DT9A 5ADZA 4PG7A 3FC9A 2FHJD 1X5SA 2ASJA 3QQCD 4X4QA 1ZZNA 1VK3A 4PXEA 4DV5F 5ETPA 3OVAA 4YP3A 2DHHA 2RMLA 2KJVA 1OPZA 2DO4A 2Q6CA 2B4UA 1N34J 1NK4A 3CJ2A 4MK9A 3PEJA 2CQ1A 3BSOA 1U1OA 3BGLA 5EGHA 3LGNA 1JXEA 4RW8B 1B4SA 2VG5B 4C8NA 2C1EB 2B8QA 4PEOA 5F8MA 2HS0A 2ZOFA 1ELXA 3UNGC 2HQFA 2J0XA 2RH6A 3G9CA 2CVIA 2QMXA 2ZC4A 1ZEBA 5D6GA 3IP0A 2Q3PA 2MKHA 3Q86A 4PG6A 2AJ0A 5C2GA 3MFHA 1FFGB 3DLGB 4ZN1A 4P6QA 3ZXWA 4FNHA 2VBXA 1N5YB 3UW1A 3AD9C 1OO0B 3ADAC 1RACB 3C15B 4U8VA 6AT1B 3K2YA 5E3QA 1VLYA 4WK1A 4LSNB 2JC0A 1RHRB 3IGVA 2EI5A 5LRMA 4FS1A 5HJYA 4CNZA 4DQQA 2VG7B 2ZH8A 5DQGA 2HHWA 2Y9HA 4X4VA 1RT2A 2OMOA 4RW6B 1FRKA 4ZDNA 4RUBA 1YK9A 4CLUA 2HBQB 4TLQA 2ZBPA 3ZZOA 2QLXA 2QRRA 3TRGA 2XZDB 5D3GA 1EIYB 3X3UA 2IM0A 3RBZA 3K5MA 5KFFA 4FYDA 2HIQA 1RXOB 4GTXA 5CABA 3MDFA 4J9MA 2XO7A 4JI8J 2W24A 1BWEA 4K2XA 3ZFVA 5L38A 1YZ6A 3TANA 4DU7A 3KNAA 3NKYA 2OPQB 2EW9A 2VFUA 3FRYA 4E2FB 1I1GA 4I67A 2J6TA 1R8CA 1E6YB 2NZCA 2HWTA 4GRSA 2CQIA 2Y8YA 3HD2A 5CYQA 4B3RF 3JTPA 2WW8A 1TL3A 3HVWA 3ICLA 4W90B 3LALA 4YHHF 1N32F 3MFIA 3FZBA 5H9EK 4Q43A 5GAHI 1IN0A 3TWZA 3RGIA 4EFAC 1Q4RA 1XQIA 1N54B 4NA3A 2PD1A 1KP6A 2R7QA 3H2UB 4S0MA 2WVCA 1RAHB 2M70A 3IBCB 3OHBA 3LPYA 1C1BA 1HWUA 1VBXA 3WAYA 3I6PA 1AUDA 3R1HA 3DXBA 4K5SA 1O6XA 4UPLA 3MECB 2ADCA 1DFDA 3IM8A 3EZUA 1S1VA 1VOMA 1BQMA 4IQXA 2VPXB 3PJWA 1WF2A 1DQAA 2DR9A 3VGTA 1UL3A 4QWDA 4LBPA 1WHWA 3EGZA 2XLIA 3J81j 2EBGA 1VC5A 2GHVC 2P9GA 1KR4A 3D68A 2BE2A 5EN1A 2HQIA 3L3CA 1FWPA 4B02A 2GW8A 2CQCA 2CG8A 3KNGA 1HR0J 4YB5A 2R7OA 4OI2A 2CPHA 4M5JA 2AGPA 1SBRA 4OZLA 2CDRB 4B9TA 2XTJP 3H90A 4JV5F 4FVMA 2PEBA 4PWDB 1OY8A 4ZK7M 4WFAQ 4OYPA 2RVJA 1DQ8A 2CAJA 1D09B 4G6VB 1E6VA 1F5CA 4LQ9A 1R6YA 4UOOA 3TARA 2X98A 1GAOA 3NS5A 4JI3F 4OJGA 3SQGB 1N33F 2J8AA 1P8GA 1VC0A 3M32A 3VAHA 4KYZA 3CE8A 1QE1A 1D3WA 2K1RA 3FGVA 1IJFB 4QYZJ 3PJ9A 4DCOB 4ELVA 1MROB 4KPCA 4ANCA 3AQOA 4J9LA 1S48A 3IG1B 2PN6A 4OI1A 2LEAA 3N0VA 5ETOA 3W60A 1U24A 2JLEA 2W5TA 2J7KA 2XG8A 2K7KA 1S6PB 3QJPA 3A3NB 5E5NA 2W2NP 1ZM3A 2QA2A 3MMJA 4BS2A 4KR0B 3BSNA 2ZBIA 1XNRJ 4FYYB 2UVWA 2C3UA 3UI3A 1B8JA 2OHDA 2IY5B 2B43A 3PKMA 2QYGA 1IBMF 3RR8A 3EGWB 3OL8A 1RGVA 4B08A 1MLAA 5ETLA 1YIJS 1T94A 1X5OA 3TAPA 5IFMA 2B4VA 4OV6A 3HJVA 1GX5A 3PX4A 5L8RC 4YMEA 4LF9J 1UVLA 2C22A 5HANA 4ZG6A 2DNLA 2J6UA 3M2VA 3H5XA 2HZCA 3SIPB 2WVFA 1VQ9S 3PR5B 1CULB 4WK3A 4NL5A 1VFJA 5KFEA 4QWBA 4RW7A 2EK6A 1M1GA 3G6YA 1UEKA 3N01A 4DR7F 2QA4G 2G1HA 5L1LA 4HEA9 2OMLA 3T1AA 1FF2A 1QM9A 4F8RA 3M2UB 4Q5VA 1WDTA 3TI0A 3MEEA 3KG0A 4DL2A 1S12A 4KAYA 3LQVA 1URNA 1I94J 1U1MA 2PI5A 4JI4F 2B7CB 4ZLPA 5E2QA 4ZKAA 3E01B 2BMBA 3OUYA 3WX8A 4KHRA 2FVQA 3BS9A 2DXDA 4ZG7A 2E5LF 2EC0A 3G4SS 4RNNA 5K8PA 4DX6A 5KG5A 1Y3KA 2KU7A 5ETNA 3T01A 1JJ4A 1SV5A 2O67A 2KTQA 4GVBB 4OI4A 3OW2R 4X62F 3BQ1A 4PUOA 2P6TA 2GGPA 2QZ8A 1REVB 1VGYA 2YWKA 2IVFB 5HVHA 3BGUA 4C0OC 2GA7A 2DIUA 2KXNB 4MIVA 4I2QB 9RUBA 2F5GA 4USUA 5H9FJ 3GFZA 3ET6A 2PIIA 1GXLA 3M8QB 3T02A 3MCSA 2KRRA 2B5JA 3Q8RB 3O1LA 3KLEA 4ECRA 4PZVA 5K14A 1EETA 1WG5A 3ZTRA 1TUGB 3SCIE 3QAEA 4KPYA 3HFZB 4EYIB 4N8NA 2EKYA 2YNHA 3BDHA 2DPIA 4NCGA 4U95A 4KJGA 3CCMS 4DUYF 4YR1A 3G8QA 3H59A 3KLHA 1ZPWX 2QN6B 3MAAB 2ASDA 2NXUA 2HYIB 1U6ZA 3JXOA 1VQOS 2BKOA 2OELA 3NNAA 2D1GA 5GOVA 7FDRA 3SEOA 2FYXA 2WSEC 1NB7A 4ED6A 2FVCA 1FEEA 4DPTA 1FJGJ 5AT1B 4NI2B 4FVCA 3DN9A 3MM5B 1S79A 2DITA 4Z7YA 1FO1A 3QJLA 2CQ0A 1U47A 4CYRA 3ZTQA 3UN5A 3HP6A 1FRMA 1K1QA 4N56A 1F3FA 1DTQB 3OPKA 5KG0A 2EG2A 1EAYC 3I9ZA 4MMOA 2RE1A 2B9XA 4CYSA 2HLTA 1F5AA 1R89A 4TQRA 2C2RA 2HHUA 1IUJA 1YX2A 3POTB 2IA0A 1VLOA 4JI5J 4JI0F 2HAFA 3OL9A 5BR8J 2R7VA 2QJ3A 3N6NA 2IJFA 4DR5J 3PR4A 2PFFB 3OLBA 1S6QA 2F4FA 3NLCA 4O4GA 1FKAF 4DDFA 2IBKA 2UVRA 5LMUJ 2B8PA 1M1HA 2LQ8A 3KLFB 4JI7F 2E5JA 1FRIA 1HWJA 3CTRA 3V5RA 5KG3A 3CDWA 2AU0A 2LECA 3DOMB 4ICLB 4ZPDA 2L41A 1ZA1B 4J91A 4QWCA 2UUWA 2L9NA 2Z56B 4M5LA 5HQMA 3SCLE 2HNYB 1X4DA 5EX3A 4BWMA 3BQ2A 3FMWA 2PA3A 2W2OP 1MMLA 1U09A 4DCPB 4ZVGA 2HVZA 2MXYA 3O3LA 2ZH6A 1UWBA 3LPEA 2IJNA 5IWAJ 4KE5A 3CMAS 4IRCA 3T1YF 2YNFB 5BYQA 2RIJA 5LXRA 2VC1A 2R2RA 2BQRA 3BPDA 2IYGA 3GPAA 2HVDA 4C4WA 1MMDA 3BF4A 2QT7A 2D9OA 4M5IA 4C11B 4CXUA 2Z2ZA 3R5CA 1BD6A 1VR6A 3DKDA 3CCWA 3HVTA 3MUVP 2AW0A 5CCMA 1JLCA 3TQEA 5D8HB 9ATCB 1HW8A 2KL8A 4C0HA 2XYPB 2EFVA 3IWNC 2G9YA 4UOPA 2JRSA 2DRBA 2W4DA 4OX7A 4KGXB 1LNQA 3LXQA 1KHKA 1EW9A 3OR2B 5T14A 5JJBA 1QUPA 1CEZA 4QPTA 2XGQA 3P4UB 1FNXH 2KDOA 5M2PA 1RTZA 1Q7YT 1O98A 1G2EA 4J9PA 3TA2A 2YNGB 3UN2A 4QR0A 3V6DA 1KD1T 4I7FB 3OXLA 3F56A 2AGQA 2IAJB 1CQMA 1LWXA 4DV5J 3MMAB 1ZS6A 3V81B 3E3XA 3ISND 3GR0A 4IO1A 3GTYX 3AB2B 2CWXA 4EO8A 3A8IA 4MFBB 2E7VA 2FGCA 4ECUA 4PWUA 3FSXA 1EJJA 4OYOA 2O5DA 3T5LA 5AE1A 2AJ2A 1T0TV 1U0HA 3DYAA 3UD3P 1HKAA 3KJVB 1PBUA 5GAGU 2ZEJA 3NP5A 2J7WA 3M8WA 4NLGA 4J90A 5IOLA 2BRKA 3PYDA 4FDFA 3DDIA 1XR7A 2DNRA 4PG5A 4ZGAA 3KJFB 1AROP 3RZAA 1SJ3P 4OZJA 2YQ1A 3MHYA 3O2IA 1OJ4A 1N8RT 1TP7A 1JWWA 1BY9A 2PMHA 4B9MA 3RJMB 5LQQA 3GP9A 1SJFA 3CD0A 3HX9A 4PXCA 1ALJA 2MQNA 1J5OB 1HBUA 3IGNA 3M8ZA 2DGQA 4KGKA 2FLNA 1TFYA 5EWFA 2CYYA 5HATA 2X1BA 1FX2A 3GG0A 2FZCB 1IQZA 3LAMA 5B7WA 3M7VA 3CCZA 2HHXA 1F5BA 1FXLA 2W9BA 4C8KA 3Q2SC 4LF6F 3B4DA 5EWEA 3D0GE 5KG6A 5HK4A 2D69A 4K8RA 3VAMA 1S49A 3C14A 3M30B 5EGEA 2G4BA 4I2PB 2C3MA 2H5EA 3CDEA 2WW4A 2CPFA 3FEXB 1UETA 3BBBA 4RUCA 3AJDA 1EW8A 1UMJA 3VQSA 2X3DA 2GJFA 2VQFF 4DV3F 4K59A 4C8MA 2DHGA 1RWKB 3IO1A 2WSFC 3H98A 3ZTOA 1Z1ZA 4M5HA 2ZUAA 4GTZA 1JXLA 3KK3A 3RW6A 1WC5A 4B3RJ 3UVJA 5KT5A 1JLAA 2DHXA 3VALA 1ZAWA 1RAJA 4YHHJ 3PM9A 3MM8A 1PAUB 1RT5B 4DV0F 1VBKA 4Z37A 3G87A 2BOAA 4DFKA 4UPKA 1AXQA 1A7GE 3QO9A 2KXFA 4ZPWR 5HQ8A 3IRWP 4TN0A 3EYZA 4KHPF 4I4BA 1JLGA 4IG0B 3NGUA 2EXUA 3P3DA 4QIVA 2DNMA 3LP1A 2AKWB 1TELA 5SUHA 1TZ0A 2JEJA 4LFBF 5I42A 2HEKA 4DZ6A 2XR9A 2XGPA 4OHYA 2OPRB 3KXDA 1HNXF 2HBYB 1ZH5A 4OYBA 1TL1B 3D0IE 2EKNA 2BANA 2M4MA 3UDLA 5KFDA 3OSNA 4PPDA 3NMAA 4ILMA 5E33A 2VOOA 1O99A 2GSOA 1SUQB 4IQMA 2QGFB 4C98A 2VDIA 4P52A 1VQ8S 2HGMA 3MPWA 1LFWA 1CS4B 1FK9A 4F04B 2WB1D 5IJQA 2GHPA 1TKXA 3IGYB 4A8OA 3QJJA 2OD4A 3MCOA 2IFXA 4G3IA 1SQEA 3G86A 5AJ9A 1D9DA 1YRTA 4JV5J 1ELZA 3OLAA 2H51B 3ZTPA 2IYIA 3J80Y 1VRUA 5B0CA 2CPEA 1VQLS 3RB3A 4CO1A 2B3TB 2OJ3A 4RNOA 2RHQB 2AT1B 4P2XA 3JAMY 1RU1A 4IFVA 5FD1A 3HCXA 1YKWA 4JI3J 1RISA 2CWKA 3HT0A 1N33J 5DLGA 3M6XA 3FZ2A 1Y0HA 5CD4A 3RTVA 1N5QA 3GIKA 4WXOA 3AOBA 2DGTA 1QAYA 2H5JB 4HHJA 2AZ3A 2BOPA 4DQSA 4PXDA 1S1TA 3SZ2A 2AWZA 5KXAA 4RUHA 3KUGA 2ILYA 1KVIA 2CDQA 4F4WA 5KFOA 5A6PA 4ZA1A 2FVPA 2G0JA 1D1UA 3TJ9A 3R1LA 3CJKA 4LMZA 4OYAA 3NNCA 2K8GA 4LF1A 2AGOA 2Z0GA 3DOKA 1B99A 2HWIA 1H98A 4USWA 2NSCA 2QSWA 3W7BA 3RYLA 2KFYA 1IBMJ 2B9YA 4KV8A 1FDBA 4F67A 2XM3A 4WWSA 2QL5B 5KT3A 4B9VA 1PYOB 2IPOB 3M6VA 2GJIA 3CCRS 2LQ9A 5KFUA 1RT2B 4AL6A 4DFPA 4ZVSB 2JOQA 2X1FA 5HLFA 2GHWA 1MWQA 3UR0A 2XCAA 3N28A 4RNHA 4OI3A 2G2ZA 1RAGB 4EZ9A 4EK2A 1CJTA 5CZXA 2IBOA 3ZO7A 4DR7J 2OI2A 1TKZB 5D3GB 4DV1F 2MJUA 4DUTA 4MIWA 3CB4A 4ID5A 1YJWS 2WTFA 4JI4J 1VQ7S 5KFKA 5B08A 4KH0B 3JSBA 1EP4A 2NYHA 4JV1A 4K0KF 2KZZA 4CDIA 1ZOTA 3W2WA 3DM2A 1TL5A 2XNRA 1X9WA 3A13A 5DJBA 1NUEA 2E5LJ 1H3DA 2UVUA 2KYXA 3BREA 3BPSP 5THWA 4EGLA 3CJ8A 1KFDA 5B09A 5CYQB 1SVDA 3TZZA 2VA3A 1NMEB 4Q2MA 1KBRA 2HFUA 1TL3B 1UW9A 2BRLA 2RJZA 4K4XA 2AX1A 2GVZA 3HF5A 3MURP 4X62J 2D7SA 3TUZC 2XI2A 1UA0A 1KNZA 1FTRA 3CCLS 3FRZA 4PRFA 4RW9A 1BQXA 3LP0A 5DDRC 2IM1A 5DRKA 2CIMA 3I55S 3ZZRA 4G1QA 2KT5A 3ZZ0A 1WKLA 1C1CA 5KTQA 3TA0A 2E1PA 1RWNB 2B51A 2BW7A 3OFHA 2XY7A 1C1BB 4GTWA 4DV7F 3D3BJ 4WP9A 4LR2A 1TL7A 4UOFA 1RKJA 3NAHA 3JYTA 3QRQA 2R2UA 5KFNA 2GIFA 1CC7A 1IKXA 4RPFA 2LQ5A 1S1VB 2LDYA 2J8SA 1BQMB 5IM0A 3Q8QB 1XMQF 4ED1A 2J0SD 4DUYJ 5DM7Q 1EQJA 1SJ4P 2AHOB 1P9QC 4KGVB 2C2NA 3HKZD 1UVKA 2BE2B 5IC6B 3K8WA 3DLJA 2MQPA 1DY3A 2PO4A 1XNQF 2BJ3A 2FC9A 2UU9J 2DNGA 1RBLA 4C0BA 2C3YA 4LFAF 5AXKA 2LVWA 5F3ZA 3S01A 1DTTA 2XYHB 3W66A 2EFQA 1U2CA 4HI2A 1G6BA 3CC7S 1HNZF 2E5IA 3RBEA 5KT6A 4TU7A 2CZ9A 1XR6A 4XK8C 1E6VB 4Y2MA 3OTOF 5HVFA 1DRZA 4KGMA 2B4OA 4K7QA 2OO4A 3GIRA 4J9KA 3J80U 3TO8A 1KONA 3M32B 1NH7A 4JI0J 3H42A 2V68A 3IR6B 2IVYA 1QE1B 4RBUA 3JAMU 5DQHA 2K1RB 1WG4A 4N47A 4M5MA 1T02A 4HL9A 4F2SA 1KH7A 2K3IA 2KXHA 4FXWA 4JI7J 4CO2A 1NKEA 2H1YA 3EXYA 1CJUA 2H5IB 2A2DA 4ECZA 1PBAA 3RRGA 4FDJA 4FF3A 1ANJA 2ZNYA 3ZNUA 1B70B 1P1LA 2GS8A 3FQKA 3MAHA 3T1HF 1NB2A 2OPQA 4PQUA 1LK5A 1GMWD 1HHTP 1RWXB 2XWXA 2V8PA 4OZ1A 4MAKA 2LDIA 4Y2AA 5TJ3A 3T1YJ 1LW0A 3TVZA 1ANIA 2A3JA 3CT9A 3OD2A 3HXMA 3BDFA 1NU4A 1FE4A 3DRPA 4KM4A 5EGYA 2EBEA 2V50A 1RHMB 2A6MA 2W5WA 5J2PA 5ETQA 3I0SA 1QY7A 3TAQA 3OFFA 2JWNA 1NBEB 3MTKA 1CSJA 5EUHA 5LM7E 2OH2A 3FQLA 3ILJA 4YB6A 2CJBA 1ZZFA 3P8BB 1NSKL 1NDCA 2VF3A 2F4VF 4RW7B 1X0FA 1VHIA 2RQMA 4ES2A 4A8YA 3D6HB 1WUUA 2HURA 1VISA 5C7PA 1QAIA 4Q44A 1S59A 3GJQB 2ZFHA 3Q8SB 3MEEB 4A46A 5FIIA 3KD8A 3RAMA 3R8YA 2YWEA 3GJTB 3MGJA 4OYWA 4J9UE 2IUCA 3CCJS 2CRLA 5GAEI 3BKFA 4LBHA 2OEKA 2C28A 3H5UA 4NLRA 3D67A 1E1ZP 3OUYB 3QAUA 1VK8A 1I3OB 5D4LA 3I87A 3P6YC 2DGVA 3IXQA 4OYMA 5DM6Q 1ACMB 4FYVB 2VBZA 2XMVA 3IR5B 1B0TA 1O8BA 1SV5B 3LA0A 1O51A 3VAIA 2DR7A 1CVJA 1JKHA 5HSPA 1QSSA 2KYZA 4PUOB 2GGPB 1JJCB 2B56A 2FB0A 2E44A 3PXGa 1L5UA 3BSCA 2M8HA 1M5KC 3TG0A 4F3OA 2JH3A 3M2RA 3NKMA 1NRKA 2GFFA 3J7A1 2R3VA 4WKRA 3ET6B 2V2VA 4CI0B 3GB0A 1W26A 3OFEA 2B5JB 5F41A 3KLEB 5K14B 1EETB 4HACA 1ZETA 4FYWB 2FHJA 1U7LA 3KG4A 1NZAA 4HT7A 2P2CB 4YB7A 1FT8A 4NCGB 1R0BG 3MEKA 1BUXA 4X64F 1Y5IB 2VL1A 3KLHB 2MSSA 4OLPA 3F44A 5CZVA 2A2CA 4C9DA 4B17A 3H5SA 2MZQA 1X5TA 3NY0A 4DS4A 2Q66A 4FKXA 3KDNA 1TKDA 2CJ9A 1HBNA 5HQLA 1IKVA 4NYZA 3D7SB 4DX8H 4DX5A 4GC7A
chains in the Genus database with same CATH topology
3OT9A 1AUKA 1KHLA 5DLWA 4CYRA 4UPIA 5INHA 3TX0A 3UN5A 3DYCA 1ED9A 3MK2A 1URBA 3M7VA 2W5RA 3A52A 4MIVA 5LIAA 3TG0A 1KH7A 1EQJA 4FDIA 5AJ9A 2W5QA 4UPKA 1N2KA 3NVLA 4N7TA 5LRNA 3NKMA 1ELZA 3ED4A 1KH9A 3NKRA 4NWXA 5K4PA 3T02A 4B56A 2GSUA 3E2DA 4CYSA 5DLTA 4TN0A 3UN3A 4QAXA 5DLVA 3MK1A 1Y7AA 2W5TA 4KAYA 1Y6VA 4LR7A 1EJJA 5EGEA 4MHXA 3CMRA 3WAVA 5LRMA 3B5QA 5HRTA 3M8YA 3KD8A 1ALHA 1HQAA 3DPCA 4ZG9A 1AJDA 3IGZB 1EW8A 5L0KA 4FDJA 4LRCA 1ED8A 1EW2A 1E3CP 2GA3A 4CXUA 3BDHA 2IUCA 4LRDA 2XRGA 1KHJA 5C66A 2QZUA 3SZZA 1ANJA 2ANHA 3NKQA 4KJGA 5IJSA 2XR9A 3TWZA 1AJAA 2IUCB 3M8WA 1E1ZP 4LR8A 4NWJA 1KH5A 2W5SA 1HDHA 4YR1A 1B8JA 1URAA 1SHQA 3UNYA 3BDGA 4ZG7A 1AJCA 1N2LA 1KH4A 1ALKA 4GTYA 4ZGAA 2ZKTA 3NKPA 1HJKA 4UOPA 2G9YA 5TJ3A 3BDGB 4CXKA 5EGHA 2W5VA 4UORA 3T01A 2IFYA 5KXAA 1O99A 1E33P 2D1GA 3IGYB 1ELYA 2GSOA 4GTZA 5GOVA 5LQQA 4LREA 3LXQA 1EI6A 1AJBA 1KHKA 3Q3QA 4UPHA 4LRAA 3UO0A 1E2SP 1EW9A 1FSUA 1K7HA 2VQRA 4LQYA 1ALJA 4CXSA 2W5XA 3IDDA 4GTXA 3WAXA 4UOOA 3WAYA 1ANIA 2GSNA 1KHNA 1P49A 3MK0A 2X98A 3M8ZA 1ELXA 3BDFA 5GRRA 4GTWA 1ZEDA 4KAVA 4UPLA 3NKOA 4KM4A 2RH6A 4ZG6A 4LR9A 3NKNA 3SZYA 4KJDA 4LR2A 4MY4A 3WAWA 1ALIA 3WBHA 4LRFA 3T00A 1SHNA 2W5WA 1O98A 1ZEBA 5L0EA 1ZEFA 2GLQA 2W8SA 2W8DA 5IJQA 3UN2A 4LRBA 5L0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT9 A;  1AUK A;  1KHL A;  5DLW A;  4CYR A;  4UPI A;  5INH A;  3TX0 A;  3UN5 A;  3DYC A;  1ED9 A;  3MK2 A;  1URB A;  3M7V A;  2W5R A;  3A52 A;  4MIV A;  5LIA A;  3TG0 A;  1KH7 A;  1EQJ A;  4FDI A;  5AJ9 A;  2W5Q A;  4UPK A;  1N2K A;  3NVL A;  4N7T A;  5LRN A;  3NKM A;  1ELZ A;  3ED4 A;  1KH9 A;  3NKR A;  4NWX A;  5K4P A;  3T02 A;  4B56 A;  2GSU A;  3E2D A;  4CYS A;  5DLT A;  4TN0 A;  3UN3 A;  4QAX A;  5DLV A;  3MK1 A;  1Y7A A;  2W5T A;  4KAY A;  1Y6V A;  4LR7 A;  1EJJ A;  5EGE A;  4MHX A;  3CMR A;  3WAV A;  5LRM A;  3B5Q A;  5HRT A;  3M8Y A;  3KD8 A;  1ALH A;  1HQA A;  3DPC A;  4ZG9 A;  1AJD A;  3IGZ B;  1EW8 A;  5L0K A;  4FDJ A;  4LRC A;  1ED8 A;  1EW2 A;  1E3C P;  2GA3 A;  4CXU A;  3BDH A;  2IUC A;  4LRD A;  2XRG A;  1KHJ A;  5C66 A;  2QZU A;  3SZZ A;  1ANJ A;  2ANH A;  3NKQ A;  4KJG A;  5IJS A;  2XR9 A;  3TWZ A;  1AJA A;  2IUC B;  3M8W A;  1E1Z P;  4LR8 A;  4NWJ A;  1KH5 A;  2W5S A;  1HDH A;  4YR1 A;  1B8J A;  1URA A;  1SHQ A;  3UNY A;  3BDG A;  4ZG7 A;  1AJC A;  1N2L A;  1KH4 A;  1ALK A;  4GTY A;  4ZGA A;  2ZKT A;  3NKP A;  1HJK A;  4UOP A;  2G9Y A;  5TJ3 A;  3BDG B;  4CXK A;  5EGH A;  2W5V A;  4UOR A;  3T01 A;  2IFY A;  5KXA A;  1O99 A;  1E33 P;  2D1G A;  3IGY B;  1ELY A;  2GSO A;  4GTZ A;  5GOV A;  5LQQ A;  4LRE A;  3LXQ A;  1EI6 A;  1AJB A;  1KHK A;  3Q3Q A;  4UPH A;  4LRA A;  3UO0 A;  1E2S P;  1EW9 A;  1FSU A;  1K7H A;  2VQR A;  4LQY A;  1ALJ A;  4CXS A;  2W5X A;  3IDD A;  4GTX A;  3WAX A;  4UOO A;  3WAY A;  1ANI A;  2GSN A;  1KHN A;  1P49 A;  3MK0 A;  2X98 A;  3M8Z A;  1ELX A;  3BDF A;  5GRR A;  4GTW A;  1ZED A;  4KAV A;  4UPL A;  3NKO A;  4KM4 A;  2RH6 A;  4ZG6 A;  4LR9 A;  3NKN A;  3SZY A;  4KJD A;  4LR2 A;  4MY4 A;  3WAW A;  1ALI A;  3WBH A;  4LRF A;  3T00 A;  1SHN A;  2W5W A;  1O98 A;  1ZEB A;  5L0E A;  1ZEF A;  2GLQ A;  2W8S A;  2W8D A;  5IJQ A;  3UN2 A;  4LRB A;  5L0B A; 
#chains in the Genus database with same CATH topology
 2HGN A;  2PT0 A;  5A6W A;  4DUZ F;  4H4O A;  4ITS A;  3HK2 A;  2VQF J;  2FPH X;  4DV3 J;  2MGZ B;  1RAA B;  3A3O B;  3X1L B;  4WFN Q;  1FDA A;  2QLW A;  3OL6 A;  1GXU A;  2JNJ A;  4ANE A;  2AF6 A;  3EUN A;  2YXL A;  2MY7 A;  2FLO A;  1KLM A;  2DR6 A;  4USH A;  2VDH A;  1PG5 B;  2Z2L A;  1X9M A;  3FUY A;  1AFI A;  2IIH A;  3WIU A;  1XIQ A;  4ZCL A;  3N6M A;  2ANH A;  3NKQ A;  5GAD I;  3K58 A;  2L9W A;  2FJE B;  4DV0 J;  4FPR A;  4C8Z A;  1S6Q B;  3D2W A;  1CUL A;  2EVZ A;  3Q0A A;  3D1Q A;  2CQB A;  1Y4Z B;  5D77 A;  2NXN A;  3B4M A;  2W5V A;  3W64 A;  1VBZ A;  4A8S A;  3EPG A;  3LP2 A;  1VIX A;  3I5C A;  4HR2 A;  1ULR A;  2G0C A;  4KHP J;  4W92 B;  2A1B A;  2GX8 A;  4E0D A;  2V4R A;  2ROG A;  3MD3 A;  2BBE A;  2W9C A;  3BSA A;  2YX4 A;  2MY8 A;  1HNX J;  1RE1 B;  1BHN A;  1IQT A;  1N2K A;  2VH7 A;  4QCL A;  4F0M A;  1UWB B;  2QA1 A;  2GNK A;  1SJ1 A;  4HYK A;  4ED0 A;  4K4S A;  3BR8 A;  3I0R B;  4NLV A;  2HS3 A;  2HRU A;  2IDE A;  4DWI A;  3OXG A;  4CTA A;  4ZG9 A;  1WOS A;  5KFQ A;  5B0F A;  3W2V A;  2Z57 B;  3D3C J;  2VUG A;  2LU2 A;  2GMH A;  4MIB A;  2Y0S D;  3HFK A;  2RIL A;  2E9T A;  2VJV A;  5EHH A;  1N5V A;  2KJW A;  5HMY A;  1NHV A;  2CQ2 A;  1VS3 A;  5BYR A;  2RDJ A;  1KH4 A;  3HVT B;  5J2M A;  1P27 B;  1JLC B;  4YY3 F;  2MJN A;  3VVU A;  4V1A k;  5CA5 A;  4FF1 A;  3K8V A;  2RB7 A;  3ETM A;  3DGV A;  5U47 A;  1RBO B;  3VCD A;  1PSD A;  3THV A;  4X4T A;  1W25 A;  4PAA A;  2ZVI A;  4URQ U;  2VBY A;  3HHN B;  2DO0 A;  1MWZ A;  2OKQ A;  3KMQ A;  1YSJ A;  1U45 A;  4GKK F;  2DHA A;  5K9F A;  3PW5 A;  2MPU A;  4X66 J;  1RKI A;  4ZVR B;  4B3S F;  4DSL A;  1FD2 A;  2J9D A;  1UP1 A;  4JV2 A;  3PW7 A;  4DSJ A;  3C16 A;  4ED2 A;  3J7Z 5;  3SMZ A;  2HZV A;  1Q5V A;  3W8G A;  2N82 B;  1U0H B;  3DYA B;  2X51 A;  4TU8 A;  1NPP A;  5MAO A;  2KT3 A;  1AJA A;  2QE5 A;  3SV4 A;  4NWJ A;  4RUA A;  2O1P A;  4W98 A;  3MOZ A;  2CNO B;  1FXR A;  1HJK A;  4ZMM A;  4P73 A;  3QGI A;  3MCM A;  1S4F A;  2VPW B;  1TKT A;  5JVH Q;  3EGN A;  4F3M A;  4X4N A;  2BA9 A;  1D9F A;  3L7P A;  3L7U A;  2Q6B A;  3HD1 A;  1HBU B;  5IT0 A;  3MM9 A;  4OMF G;  4K4T A;  2DY9 A;  1D9A A;  3R2C J;  4E98 A;  1FNO A;  3TZX A;  1XBW A;  2N3L A;  2CQP A;  4V19 J;  2UXC F;  2F65 A;  1SKR A;  2GAG C;  1X0P A;  2W9B B;  5T7L A;  3KLV A;  4XPE A;  2EFN A;  1L3S A;  4DV1 J;  3EMT A;  5IXU A;  3DGP A;  3DLB A;  3C14 B;  4O3S A;  4ZPA A;  2DGW A;  1FHT A;  3EXC X;  4P74 A;  1QAJ A;  1X7V A;  1LXJ A;  2O01 C;  4XO0 A;  1MG7 A;  3CCU S;  5HBM A;  4X4O A;  3GJR B;  1T95 A;  3BDG A;  1V5V A;  4K0K J;  2HPU A;  2W2Q P;  3GSI A;  2COL A;  5AJ3 F;  1FFW B;  1X4C A;  2J7U A;  2BKN A;  4AXJ A;  3N9U C;  2B0G A;  2ZH5 A;  1FSU A;  1RCO B;  1N48 A;  1VJW A;  1S77 D;  1TAQ A;  3T6J A;  1WC4 A;  5C25 A;  5SZT A;  1FDN A;  3KK3 B;  5HVG A;  2H54 B;  3UVJ B;  1KLN A;  3C6T A;  2R7U A;  2EK1 A;  1JLA B;  2GMJ A;  3TJA A;  2MKY A;  2GC8 A;  3D6F B;  4ECX A;  1RT6 A;  3MM8 B;  4O0I A;  5DLW A;  2EC2 A;  2V67 A;  1SL0 A;  3F0N A;  2CVE A;  2CJQ A;  2I6W A;  3EVM A;  2WVE A;  2I1R A;  1SQF A;  2BJD A;  1IWG A;  2XY6 A;  1UAW A;  3RAX A;  4O3R A;  3QO9 B;  4OL8 A;  3O5T B;  4LF7 J;  1WHV A;  2V8V A;  4D3H A;  2VKZ G;  1Y5L B;  1JLG B;  4DV7 J;  2RQ4 A;  4ZVU B;  1GTE A;  3J7Y I;  3RB4 A;  1FFS B;  2HG4 A;  4M94 A;  5I42 B;  3G6X A;  1NJW A;  2DGX A;  1V3Z A;  3QWP A;  1XMQ J;  1L3T A;  3PAC A;  1NZ8 A;  5D0R A;  4AND A;  2RU9 A;  1R3N A;  3FCH A;  4HT5 A;  1Q86 T;  3LGH A;  3NEK A;  2EG1 A;  3JQK A;  3GV8 B;  3IRX A;  4CYU A;  2WBM A;  2IM2 A;  4CH0 S;  1IWA A;  2R2S A;  4M63 A;  3A8K A;  3MD1 A;  4LRB A;  1FK9 B;  5B0D A;  3ILO A;  3GQC A;  2VKR A;  3F73 A;  1WJ9 A;  4LFA J;  1TKX B;  2G2O A;  3KJV A;  2W7O A;  4DLE A;  1PCA A;  5GMD A;  1VC6 A;  3SBM A;  4DPX A;  4KJI A;  2HLU A;  5K4P A;  1HNZ J;  2NPF A;  2U1A A;  1WEL A;  2VIC A;  1VRU B;  4OHX A;  1VCT A;  1AB8 A;  1IM4 A;  4ZP7 A;  3H4B A;  4OLO A;  2SXL A;  3GON A;  3OTO J;  3UWT A;  3GFX A;  4MIA A;  4IFV B;  1E3C P;  4TYA A;  4U7C A;  3FCV A;  2KM8 C;  1XER A;  4F3Q A;  2ZH2 A;  1K44 A;  1EKS A;  1NK6 A;  1E33 P;  3GMG A;  4UPH A;  1E2S P;  2HVE A;  3G6E S;  2F3J A;  5J2N A;  2CG4 A;  4MK7 A;  5HO4 A;  3US5 A;  1BC6 A;  1KHV A;  2ZZN A;  1RI7 A;  4NLW A;  4KBI A;  1FJE B;  5L0E A;  1GMU A;  2HQ3 A;  1NKC A;  3CJK B;  1F9F A;  4NA1 A;  1DBD A;  3EZ5 A;  3TX0 A;  3EVW A;  1URB A;  3DOK B;  3QRP A;  2Y1R I;  2IRX A;  2V8G A;  3T1H J;  2ZHA A;  1RT7 A;  3ENA A;  1X8D A;  1TU0 B;  4IOB A;  2YWF A;  2QX0 A;  1NCL A;  1NAQ A;  4OQJ A;  4DMZ A;  4KV8 B;  4LBI A;  3CED A;  5LMN F;  4ED7 A;  1NSA A;  1WDD A;  2RF2 A;  4UQG A;  2E29 A;  4KY3 A;  4NCB A;  2YX1 A;  1WHX A;  1QAX A;  3FVY A;  4BDP A;  3CDB A;  5HLF B;  5LJ3 Y;  1GQE A;  3CCT A;  2RKI A;  5IQ6 A;  4WTO B;  2WON A;  1CJT B;  1OMS A;  2F4V J;  3FFI A;  4X4R A;  1I6J A;  3M9N B;  2LXI A;  3G82 A;  5GRR A;  1MMN A;  2GVD A;  1IJE B;  2IA6 A;  4ER8 A;  3VHQ A;  1ZEF A;  4YDX A;  4ID5 B;  2GO9 A;  1CLF A;  2H4Y B;  4JV0 A;  1SPB P;  2BQU A;  1FKO A;  1RLC L;  1UVJ A;  1EP4 B;  1LWE A;  2NZ4 A;  4AXI A;  2DNP A;  2XZW A;  2ZBC A;  1JJ2 R;  3MEG A;  3W2W B;  4ZN3 A;  3TX8 A;  2BW2 A;  2MQM A;  2PDA A;  3LWM A;  3CGI A;  4QAX A;  3OTE A;  2MLZ A;  3NCQ A;  1XTZ A;  1YHQ S;  4MKY A;  2L48 A;  1WNE A;  2KN4 A;  1HWL A;  3M8Y A;  2DK2 A;  3BB5 A;  3EDQ B;  4FBT A;  2Z4P A;  8AT1 B;  2QL9 B;  1WG1 A;  5J1N A;  1YJU A;  2GVZ B;  5B0G A;  3AXM A;  3GJS B;  4Q7A A;  3FDS A;  1MWY A;  2RNE A;  1MN9 A;  3PVX A;  3NCP A;  1PIL A;  4RW9 B;  3LP0 B;  5HP1 A;  5LXY A;  5KFI A;  5M2R A;  1FER A;  3R5A A;  1UFL A;  3AA8 A;  5KG4 A;  4CLW A;  3S1T A;  3QGH A;  4G1Q B;  4Y65 A;  1HI1 A;  3IWL A;  1C1C B;  4ED5 A;  1K73 T;  4L72 B;  5ITH A;  4OJH A;  2ZH4 A;  4R8U A;  1UA1 A;  2V94 A;  1DJ0 A;  3OVS A;  3CC2 S;  1ALI A;  3T00 A;  2CNL B;  2YWH A;  4USJ C;  2C2M B;  1S99 A;  2E5G A;  1TL7 B;  5HN0 A;  3JYT B;  1S76 D;  1IKX B;  4CLL A;  2N4C A;  3MPU B;  4NML A;  1U2R A;  5IM0 B;  3MMB A;  4I6A A;  1EQM A;  2ALZ A;  3BO3 A;  4UY8 5;  2NR0 A;  1UJ5 A;  4QQB A;  1KH9 A;  1LOU A;  2QG9 B;  1FNM A;  1UPM B;  4LIR A;  3THT A;  1FRH A;  4RWX A;  3I82 A;  3L95 X;  2BZ2 A;  2AYB A;  3ISZ A;  3DLE A;  1F1B B;  3W9J A;  4ZPB A;  4K4Z A;  2VFR A;  1Q53 A;  2EFG A;  1UVI A;  1OY6 A;  3UD5 A;  2UXD F;  4LR8 A;  2DEJ A;  3W8P A;  3DLK A;  1FXD A;  4M5K A;  1DTT B;  4DUZ J;  4B3T F;  4NRT A;  3K57 A;  5L46 A;  4NEZ A;  4DOZ A;  3DU6 A;  5KT2 A;  1ZM4 A;  3VZH A;  3CD6 S;  2DNK A;  1WTB A;  3ZZU A;  4LRA A;  2CQ3 A;  4U9R A;  3T6B A;  4Y2I A;  4NXM F;  1CC8 A;  2NCK L;  4RR5 A;  5DET A;  1WF0 A;  3T5K A;  1UZH A;  3M9M B;  1Q5Y A;  3ITH A;  1W2B R;  2YPZ A;  1VQS A;  2F63 A;  2PMW A;  5HAO A;  1BXN A;  5D4P A;  4MYT A;  4JBC A;  1NK7 A;  2QC3 A;  1SL2 A;  1NH8 A;  4DQI A;  3LTO A;  4AE5 A;  4BLG A;  4IG3 A;  1R8A A;  4P7V A;  1SB6 A;  4Q8F A;  1HPZ B;  4LT6 A;  1CJU B;  1TKZ A;  5FLX U;  4QIF A;  1AJD A;  4TXS A;  2E1A A;  4ZIV A;  3HHL A;  2E1R A;  4E8U A;  2HMI A;  1VQN S;  2NUH A;  4ZP8 A;  1HYS A;  2ASY A;  4MYU A;  1KSP A;  4IH6 A;  3MXH P;  1HDH A;  1URA A;  1A9N B;  2ZKT A;  1CBK A;  4DPW A;  4DR1 F;  1TMJ A;  2MZS A;  2LFV A;  4PQU B;  2C3P A;  4ZCI A;  3QZ8 A;  3MWB A;  1LW0 B;  4ZLJ A;  4ZJL A;  1GTH A;  5EWG A;  1ZM9 A;  3DRP B;  4W4M A;  1NO8 A;  2MKS A;  2DNZ A;  1RYS A;  1L3K A;  1UVM A;  1FD8 A;  5J2P B;  2YWW A;  3CJT A;  3I0S B;  4C48 A;  2A6O A;  5LSO A;  3DYC A;  5K8N A;  1WKK A;  4WE1 A;  3HHE A;  1OPI A;  2HQC A;  4DX7 A;  3M8S A;  2XQC A;  3R5G A;  3CXC R;  3ULH A;  5EX0 A;  4YY3 J;  1GNK A;  1EAR A;  1WC1 A;  4OX6 A;  2ZD1 A;  1DQ9 A;  3VTI A;  3AXK A;  3HJF A;  4RWW A;  3VAF A;  1FTC A;  1LQ9 A;  3CC4 S;  4F2R A;  2LU1 A;  4P2F A;  3V6K A;  2J0W A;  4AD6 A;  4J5O A;  4GVL A;  3BEG B;  4WFZ A;  3R7N B;  5FJ4 A;  2ZZT A;  3IBF B;  4ZVQ B;  3OBI A;  2IUC B;  1HFE L;  3CO9 A;  2FC8 A;  4IKA A;  1R27 B;  1RT1 A;  3JTO A;  1LXN A;  4CT8 A;  4WP8 A;  3QAT A;  1M5V C;  5L1J A;  4GKK J;  2W4P A;  3GZ7 A;  2ZKU A;  4P2S A;  2HK3 A;  2H3E B;  3H7H B;  4L76 A;  5A0Y A;  4R0J A;  3BGR A;  2OEJ A;  2B4P A;  3BN4 A;  1JKH B;  5F8H A;  2XMM A;  1P6T A;  4MJK A;  3WC2 A;  4EBE A;  2BVZ A;  2K2P A;  5JVG Q;  4N7T A;  3O44 A;  3WHI A;  1X4G A;  2HFV A;  5A8W A;  5MLC V;  3M2R B;  3HSJ A;  4OI0 A;  1T03 A;  2B6A A;  3AB4 B;  4CLY A;  2BAB A;  3NNH A;  4MHX A;  4XDD A;  1R8P A;  4JB8 B;  3NOC A;  5KFT A;  3PHE A;  1ZTT A;  4ZPT R;  4OFZ A;  4PWW A;  4HAC B;  5IV3 A;  4NLU A;  4OJ1 A;  2MKC A;  2EEY A;  1RLD A;  5A76 A;  3W5X A;  5CAA A;  4EZ6 A;  5CQG A;  2JEF A;  2UXC J;  4NLX A;  5KFA A;  3LW5 C;  4QJV A;  1T05 A;  3W5Y A;  3V4I A;  1KQG B;  2J9C A;  5DLF A;  4USI A;  5DZ7 A;  3GIJ A;  1HBN B;  3HKW A;  1IKV B;  2W8S A;  4ZIW A;  4DU8 A;  4P75 A;  4ZP6 A;  4WF9 Q;  3FBC A;  3CMQ A;  3OTD A;  2Y0B B;  1VQ4 S;  4OIX A;  1H2U X;  4Y34 A;  1HD0 A;  4H4O B;  4DN9 A;  2QV6 A;  4A8X A;  1N36 F;  4WBF A;  2BE7 D;  2V2Z A;  1NND A;  5AJ3 J;  3W9I A;  1FEH A;  1WI6 A;  3WAV A;  3A1Y G;  1KLM B;  1RWW B;  2HHP A;  1REG X;  4DFM A;  1YRU A;  2GZO A;  1U1L A;  1UCN A;  1NHU A;  1HA1 A;  2GO8 A;  4UTG A;  1Y11 A;  5GAH U;  4QWE A;  2KH9 A;  1GEH A;  3C66 A;  4CH1 A;  2N4D A;  4HH0 A;  3WAX A;  2XLJ A;  3V2U C;  4ZVH A;  3GV7 B;  1UTA A;  3SCJ E;  3LP2 B;  2E7W A;  2JX2 A;  2DXE A;  3NGR A;  1J2V A;  4UST A;  2BV3 A;  2U2F A;  4PKD B;  1KFS A;  4DL0 C;  2C2D A;  5B0A A;  1KQK A;  4O3P A;  3NCR A;  3VWS A;  3OL7 A;  2W9C B;  3H5Y A;  4JI6 F;  3UDV A;  2DNQ A;  1VMB A;  4IR1 A;  2YKA A;  2YQ0 A;  3PG9 A;  1RWV B;  3T9N A;  4GKJ F;  2DEI A;  1TVR A;  1UVN A;  4GMK A;  3I31 A;  4B56 A;  3MMC A;  3OXF A;  2OSR A;  3MM7 A;  1S72 S;  4OYI A;  3D0H E;  3NBP A;  3NWR A;  5GME A;  3B5Q A;  5G4D A;  3HHL C;  2MZ1 A;  1HLW A;  3MM6 A;  2UP1 A;  1NJX A;  2GA3 A;  3QLH A;  4CTA B;  2QIF A;  2VPZ B;  1KHJ A;  3W2V B;  3LGM A;  2ZDO A;  1YDL A;  1S10 A;  4WFY A;  2WCX A;  2HHV A;  1VI7 A;  2FHK A;  1Y5N B;  1JK9 B;  1OQ3 A;  1U2F A;  2BAC A;  2R8I A;  2KM8 B;  5J2M B;  2RUG A;  4K50 A;  2K7J A;  1Q8B A;  2NQP A;  1ELO A;  2YKQ A;  4A48 A;  2AQ4 A;  2M0G B;  2JSX A;  1EZZ B;  3PFE A;  1VQM S;  1LWC A;  4OZ2 A;  5F8I A;  5AXN A;  2XMW A;  2BUN A;  1N0V C;  2K3K A;  5KFW A;  2HAI A;  4UOH A;  4YB1 P;  3KLG A;  2CQH A;  2OEM A;  1C0U A;  2R4F A;  2IMO A;  2AMC B;  3GII A;  4DL4 A;  1VQY A;  1XNR F;  4CO5 A;  2VFT A;  2VHG A;  3TUI C;  3CJS A;  4IH7 A;  1PJ7 A;  2ZHO A;  4YR0 A;  3C16 B;  2KHD A;  4R25 A;  3DRX A;  2CPX A;  3FNN A;  2ZJP Q;  3DRY A;  3NGK A;  4IR9 A;  3RRK A;  1OWX A;  2VD3 A;  3AH6 A;  2CJK A;  1U6B A;  3K5O A;  3AOD A;  2MHE A;  4KSE B;  2E1M C;  1M0S A;  2I38 A;  2ZJQ Q;  4P72 A;  3QFH A;  3HT3 A;  3JQM A;  3U1L A;  2MGZ A;  2W5X A;  1Q16 B;  2WRM A;  4K4W A;  2OD6 A;  3CSK A;  1TKT B;  1TK5 A;  4K4V A;  4LSL A;  4EMD A;  4NAS A;  3IC1 A;  2CJA A;  4NLP A;  5IT4 A;  5K20 B;  2MQL A;  4OX9 J;  2KVI A;  5LMN J;  4CRJ A;  4G1P A;  3MM9 B;  5I3Q A;  3UDC A;  2NUU G;  4TQS A;  4UPI A;  4OHW A;  2ZC3 A;  4CIO A;  3MCN A;  1IBC B;  1F9E B;  2A18 A;  2KG1 A;  3PRV A;  4IOA Q;  5L39 A;  3SYZ A;  4I56 A;  5T7L B;  3BM7 A;  1HWK A;  2HNZ A;  5J1P A;  3H20 A;  2HHH F;  3DGP B;  1KEK A;  1DAX A;  2V6A A;  3CJR A;  1KVJ A;  4U67 Q;  4J9Q A;  4A4J A;  1FCA A;  1VHF A;  3PTW A;  1URR A;  1T9U A;  3IBW A;  5HBM B;  2PI4 A;  3BDG B;  1GMW A;  4PG8 A;  1S5Z A;  5BXI A;  2RU3 A;  4RU2 A;  2FJV A;  1Q81 T;  3K7R A;  1S0N A;  2WAQ D;  3E8O A;  5C25 B;  4IO9 Q;  4HHU A;  3DRS A;  1R0A A;  2ZH1 A;  4HI1 A;  3TVK A;  2DVI A;  3I0R A;  1S1U A;  4UZB A;  3LAK A;  1ROF A;  3C6T B;  1AUK A;  3BYR A;  4MH8 A;  4ELU A;  1C4C A;  5CXT A;  1UJ6 A;  1RT6 B;  2RHS B;  4ECT A;  1FRL A;  3RAQ A;  2WVB A;  4BC7 A;  3G96 A;  3D5M A;  1RHQ B;  1RCX B;  1U1K A;  4DSI A;  2ZE2 A;  2LQB A;  2XS2 A;  3E2E A;  2CNK B;  5DLV A;  1S6O A;  3BV8 A;  3OJU A;  1T3O A;  3TP2 A;  3GFH A;  2R2T A;  1KDN A;  4A8M P;  4OX8 A;  4LVO P;  2HK2 A;  2VAS A;  1ED8 A;  3N4W A;  3NS7 B;  1H7X A;  2RDD A;  2YKN A;  1AUS L;  3P45 B;  2FZG B;  1H72 C;  4KKO A;  2N7C A;  1F2G A;  1M1K T;  2ATC B;  5CD4 H;  5HMW A;  4CZC A;  1NM2 A;  5KFV A;  4QR2 A;  2FVS A;  4I6W A;  3TR5 A;  4C3M A;  4DV2 F;  2C2O B;  5HMX A;  4IUF A;  1WEX A;  5KFP A;  3KJQ B;  1GX6 A;  3WX4 A;  4F36 A;  1FRJ A;  1RTD A;  3R3T A;  2NS1 B;  4IDK B;  1S1X A;  3M05 A;  3A3P B;  5F3T A;  3AOA A;  1IR0 A;  3IRX B;  4CYU B;  5LT5 A;  3SSR A;  1Q82 T;  5KFL A;  5C66 A;  2A0F B;  1KHL A;  1F6T A;  4FS2 A;  4OZ3 A;  2YQ3 A;  2UXD J;  4F26 A;  2CPD A;  3M4X A;  4JI5 F;  4UW2 A;  3D6T B;  4UUX A;  4DSK A;  4DR5 F;  4B3T J;  1VBY A;  1DLO A;  2QFJ A;  2GSU A;  3M8R A;  5E3C A;  2RS2 A;  4OZN A;  3RBD A;  2FTR A;  3DXS X;  3QSI A;  3PDN A;  3GLJ A;  1JMT A;  3IMQ J;  4KO0 A;  4NXM J;  3DPC A;  1K1S A;  4HH1 A;  3OR1 A;  2FY1 A;  3AD8 C;  1X5P A;  4O4R A;  4B3M F;  1WI8 A;  1KH5 A;  3NWG A;  1H73 A;  1LWF A;  2YX7 A;  4WFX A;  4QU6 A;  3TJ8 A;  2QL7 B;  1ZAV A;  3TW0 A;  1SXL A;  2VPY B;  3CF5 Q;  4TYB A;  2DKO B;  3A4T A;  4CXS A;  3KK1 A;  1HBO A;  5J2N B;  1S9F A;  2YKM A;  2XS5 A;  3L7O A;  4NLD A;  2CPJ A;  3IM9 A;  2LEB A;  5DG9 A;  1WC0 A;  3N5F A;  5C24 A;  4NCA A;  3K17 A;  3KK2 A;  3U1M A;  3FK4 A;  4DR1 J;  5DLT A;  1RT7 B;  5HRO A;  1KRP A;  2MB0 B;  4DXL A;  3CMR A;  1JNZ B;  2DD8 S;  4AQY F;  1R6V A;  2UUA F;  3A8J A;  3BN7 A;  3LAN A;  5KFR A;  3WQP A;  1OSD A;  3MR2 A;  2RF2 B;  5IQQ A;  2W4C A;  3Q24 A;  2VA2 A;  4M95 A;  1PO6 A;  3HI9 A;  1IM6 A;  2F8E X;  2IC3 A;  3TQ1 A;  3CCS S;  4MK8 A;  3Q8Y A;  3EX7 B;  1N32 J;  1HL6 A;  2XUL A;  2RKI B;  2YH1 A;  3JTN A;  2WON B;  3NGS A;  5F0U A;  3FFI B;  4DSF A;  4OYZ A;  4F25 A;  5LSL A;  1EX8 A;  2RD5 C;  3G82 B;  1OYD A;  5K8M A;  2GVD B;  2VV5 A;  2F40 A;  4OHZ A;  4DN0 A;  3MR5 A;  4DR2 F;  2YPY A;  3MI7 X;  1UFK A;  5L0B A;  1SCJ B;  3KHG A;  3LWL A;  1IKW A;  4CLK A;  1ED9 A;  3MK2 A;  2BEF A;  2FD2 A;  1FKO B;  2G13 A;  5F0W A;  1LWE B;  4LFC F;  3MEG B;  2JHE A;  1KOH A;  1OSC A;  2DIS A;  1XC9 A;  3AHP A;  3J7Z T;  3BQ0 A;  4QU7 A;  2AD9 A;  1HW9 A;  3U1N A;  3PYF A;  5KT7 A;  3JB9 k;  4C6A A;  4ZVE A;  1PGZ A;  2HBZ B;  2OFH X;  3MR6 A;  2UXB F;  3NS6 A;  1R8B A;  3L9Z A;  2XRG A;  3EM1 A;  3PKY A;  1P1T A;  1RHU B;  1CJV A;  3DHX A;  2ACY A;  2VU5 A;  4J9S A;  4B9N A;  4F4K A;  3R7S B;  5B0B A;  2V63 A;  3QT5 A;  2FQQ B;  1S9E A;  1KQS R;  5HP1 B;  4QR1 A;  3U7J A;  1SKU B;  1AA1 B;  3HHD A;  1VQP S;  1U1Q A;  1CQN A;  1YJ9 S;  1RUS A;  1N6Q A;  2HFO A;  1PKU A;  4CT9 A;  2LXF A;  4R8U B;  3KHL A;  2OGU A;  1SKW A;  2ALY B;  3UR3 C;  1U48 A;  1SKS A;  4Y6I A;  4NA2 A;  2UUB F;  2KZM A;  3MMB B;  3QT8 A;  2BYC A;  3UQS A;  4CLP A;  5JXS A;  2DNO A;  2ZH3 A;  1F2H A;  1RT4 A;  3HMJ G;  1Y7A A;  3QZ7 A;  4NRU A;  4ZP9 A;  1Y6V A;  5GMK a;  4ZS6 A;  2BM1 A;  1HNI A;  3JQJ A;  3DOL A;  3DLE B;  3M8P A;  2H65 B;  1RAI B;  1FRX A;  2XNQ A;  2KKH A;  3VR1 A;  1NPK A;  4ZIT A;  2CKW A;  2UV8 A;  5L9X A;  5L9N A;  4C8O A;  1G1X A;  3DLK B;  2QMU B;  3DI6 A;  1FWK A;  3T19 A;  4OZ5 A;  1N36 J;  2VQR A;  2G9O A;  5E3A A;  1QUV A;  2W7P A;  3NKO A;  4DL7 A;  4JOU A;  4U7U D;  2I5J A;  1ZA2 B;  1OYE A;  3UPF A;  1T11 A;  2D9P A;  3L4B C;  3EJM A;  1TV6 A;  3ITH B;  3MPV A;  3V6J A;  3T3F A;  3H40 A;  4YN3 B;  5LIA A;  1RAE B;  2XO6 A;  1PC5 A;  1QSL A;  4H54 A;  4RKU C;  4CH7 A;  2O66 A;  4L73 A;  4Y3C A;  2V5H G;  3SDE B;  2XSF A;  3SFG A;  3S8S A;  3K59 A;  1EQ0 A;  2F1F A;  3TEH B;  4IG3 B;  3TNV A;  2MZT A;  5E3P A;  2JJ4 D;  2XMK A;  1N4L A;  3HHL B;  5IJS A;  1U8W A;  4J9R A;  2ILZ A;  2HMI B;  1HYS B;  2LXU A;  4GTY A;  4JI6 J;  1NHK L;  1WOR A;  1GMV A;  4X4U A;  2ZWP A;  1CJK A;  3PHT A;  5T41 A;  4UOC A;  4Q8E A;  3VV2 B;  4GKJ J;  2R8H A;  5IZH A;  5DDP C;  2DJW A;  4K4Y A;  3W61 A;  2GJ2 A;  3CIZ A;  2AEF A;  4ZCM A;  2C2Z B;  1VRT A;  5KFH A;  2AV5 A;  3KKF A;  3J81 Y;  3DFE A;  4A8Q A;  1XMO F;  4DPO A;  5KFM A;  3R6G B;  2LYV A;  2HVI A;  2OPS A;  5KOX A;  3OSP A;  1WTF A;  1K0T A;  2X7I A;  2ZVS A;  3FEZ A;  2H4W B;  1WEY A;  4WE1 B;  2XSJ A;  5KG1 A;  1BGX T;  1HMV A;  1Z2Z A;  1HAR A;  1RHJ B;  4MT1 A;  2LKZ A;  4JI1 F;  5HL7 Q;  2YTC A;  2JEG A;  2ZD1 B;  1HNV A;  2PA8 D;  5D0E A;  1EKR A;  1FES A;  3D66 A;  5I3P A;  4K5R A;  2BDP A;  3G8S A;  2HIY A;  3OVB A;  4FF2 A;  4LRD A;  1SH2 A;  3HZG A;  4P7T A;  4ZLL A;  2M2B A;  3R27 A;  2FVR A;  7AT1 B;  5C2C A;  1L3U A;  1KS2 A;  4DF8 A;  2JEI A;  1DHM A;  4J9V A;  1RT1 B;  4EBD A;  2V4J A;  4IOC Q;  2V8H A;  1K7H A;  2HSE B;  3GCW P;  2N7Y A;  1MU2 A;  2UUT A;  1SHN A;  5A0Y B;  3BGR B;  3QFW A;  3CCV S;  4QIG A;  4BBY A;  2DTJ A;  2P6S A;  3KMS A;  2RSQ A;  1C2P A;  1NPR A;  2MMY A;  2NXE A;  2LA6 A;  3CJ5 A;  1YI2 S;  2AX0 A;  4QOT A;  4F02 A;  4WKY A;  1DAR A;  3GU0 A;  5A8W B;  1K8A T;  4CLS A;  3CUL A;  3CME S;  8RUC A;  2B9E A;  3MUT P;  4J37 A;  1T03 B;  2B6A B;  2Z2Y B;  4YOE A;  1Y3J A;  5KG7 A;  1S97 A;  2LA4 A;  3QGP A;  4RW4 A;  1KN6 A;  3GCX P;  1TUW A;  4NPO A;  4AL7 A;  1JQG A;  1WHY A;  1Z4U A;  2CNN B;  3BR9 A;  3O8W A;  2M88 A;  1N2L A;  3FEY B;  2HHS A;  1SI9 A;  2DIV A;  4OYX A;  2C2K B;  1IKY A;  1VQK S;  1SH0 A;  4KQZ A;  3QBC A;  3BDE A;  2CPY A;  3DCA A;  1ZPV A;  3W63 A;  4ED8 A;  1T05 B;  3QIP A;  1H2T Z;  4BC9 A;  4KJD A;  4MY4 A;  5AXL A;  4KRW A;  4DBQ A;  1K9M T;  3V4I B;  2CPZ A;  2M9K A;  1HPZ A;  2HHH J;  4XPC A;  4CO0 A;  4NLT A;  3Q83 A;  1SJR A;  3GYX B;  4NLS A;  1PIE A;  1TMM A;  4LSZ B;  1Y7P A;  2DNN A;  3NVL A;  1H0H B;  3QT6 A;  3OV7 A;  2X1G A;  1S0O A;  4ZJO A;  1VQ5 S;  1W2I A;  1HBM A;  3WDO A;  2P9C A;  3WZ0 A;  2P9E A;  2J9E A;  1RTJ A;  3OFG A;  1HQA A;  1WF1 A;  1Y10 A;  1R0C B;  1F60 B;  2XMA A;  2YKO A;  2MKK A;  1PYT A;  3LH2 S;  3MED A;  3U27 A;  4WZM A;  1JLQ A;  4F4X A;  2GML A;  3VQT A;  1JX4 A;  4TN2 A;  1NK8 A;  1ZAX A;  1S1W A;  2DHS A;  3Q89 A;  1QVF R;  2GSN A;  3NGT A;  2PC6 A;  4NLQ A;  1MSW D;  4ALZ A;  3HHK A;  2W7A A;  1WSR A;  3SZY A;  3F41 A;  1S6U A;  4CLZ A;  3TVY A;  3B8H A;  2R42 A;  4KFB A;  3I56 S;  2Q79 A;  1XK8 A;  4CWB A;  3ENQ A;  3FKB A;  2YY3 A;  2HVH A;  4UY8 T;  3WC0 A;  2UU9 F;  3QPI A;  4QZV B;  4G1I A;  1JIH A;  2R8J A;  2HND A;  2OPP A;  5L1K A;  2FLP A;  4ED4 A;  4HDH A;  2ZH9 A;  4DV2 J;  4UUW A;  3RR7 A;  1TVR B;  5GAG I;  3MMC B;  2I8E A;  2LMI A;  3MM7 B;  1P9Y A;  2ABY A;  5E7O B;  3NBP B;  2HRY A;  2Z8Q A;  4CP5 A;  1U4B A;  5KOW A;  3MM6 B;  1AYE A;  5HJX A;  2QZU A;  4Z2X A;  5AE2 A;  4EWT A;  2GQQ A;  2AEJ A;  1JLB A;  3QLH B;  3R5B A;  1SC4 B;  4Y28 C;  2ZZM A;  5ETV A;  2Y1L B;  4L75 A;  4V19 X;  2RAQ A;  1N52 B;  1NK0 A;  2VZ9 A;  2QMW A;  1Q1K A;  3J81 U;  3Q3Q A;  4DJB A;  3WBZ A;  1Q7L B;  2VFS A;  4PCQ A;  4MKA A;  3NKN A;  3EWG A;  3RU0 A;  1KKH A;  2JFK A;  1NSQ A;  2MST A;  4EBC A;  1U25 A;  1SL1 A;  1QTN B;  4UOG A;  2GQC A;  1LWC B;  4NZ7 A;  3PX6 A;  4B3M J;  2J6S A;  3WIV A;  5E0O A;  2P8I A;  5ETT A;  3BBF A;  5LRN A;  3KLG B;  5ETS A;  1LK7 A;  4LF2 A;  1C0U B;  1NSP A;  4JI2 F;  4JYA F;  4DG1 A;  3BGO P;  4LR7 A;  4ZVO B;  5DDO C;  4C3L A;  2P5V A;  2HHT A;  3D28 A;  4DV6 F;  1NJI T;  3I5A A;  4EU0 A;  5KFY A;  4DL5 A;  4ENO A;  4LF6 J;  4ECW A;  2VJU A;  4URS A;  4DZD A;  4X4P A;  2W01 A;  2ZM6 F;  4AFF A;  3UCG A;  4DL6 A;  4B9U A;  2ACM A;  1RTI A;  1X4E A;  4ID8 A;  4WU2 A;  3GSD A;  3MR7 A;  1S7I A;  3B6B A;  1HNW F;  2W2P P;  4ZHR A;  3OTC A;  2MYF A;  2OFG X;  5LSR A;  1NXI A;  3BKT A;  3KLI A;  1YRX A;  1JLF A;  1XJW B;  4LSL B;  1FWL A;  4AQY J;  2UUA J;  2W8D A;  1AZS A;  5CH7 B;  3KOA A;  2WBR A;  4O23 A;  1B0P A;  2W8L A;  3BDP A;  2PMZ D;  1VDH A;  5RUB A;  4USK A;  1R7I A;  3CO0 P;  2FJX A;  2I2Y A;  4NWX A;  3VAG A;  3RUB L;  3IR7 B;  4U96 A;  3CVK A;  3HSZ A;  4Q0B A;  3MK1 A;  4DV4 F;  2GV1 A;  2HNZ B;  3S7R A;  1VYA A;  3IGZ B;  3T9Z A;  1RQ0 A;  4H4K A;  1YQH A;  3Q22 A;  3NGD A;  2BQ3 A;  2WSC C;  1OY9 A;  4DR2 J;  1DZ5 A;  3RW7 A;  1KQF B;  5DO2 A;  3SXL A;  4M5D A;  3H8Y A;  3EDR B;  2D3O R;  2Y3Y A;  5GAE U;  3CJ0 A;  4UOR A;  2VQE F;  3MOJ B;  1ELY A;  1QSY A;  1YJ7 A;  4LFC J;  4LFB J;  2IHR 1;  2HFZ A;  2Q1L A;  4M1K A;  1NDP A;  5F9N A;  1RWU A;  1OIA A;  5KFC A;  3AOC A;  4A47 A;  1PJ5 A;  2RS8 A;  4M8L A;  1HQU A;  2V69 A;  1YGY A;  3DRS B;  4WIQ A;  1R0A B;  1G7C B;  4DLG A;  1U8S A;  4I69 A;  1J5E F;  2UXB J;  1J27 A;  3CJQ A;  3L09 A;  1S1U B;  3DMJ A;  4FBU A;  4B3O A;  1YWX A;  4KAI A;  2L3M A;  4FDI A;  2LEP A;  1Q0N A;  4BCA A;  3DRR A;  2W5Q A;  6FDR A;  1M5S A;  4WYW A;  2UV8 G;  3DC2 A;  3AJ1 A;  4LQ3 A;  5DG8 A;  1BQN A;  1HI0 P;  1H38 A;  4I1T A;  2ZE2 B;  5M2U A;  1U49 A;  2QTW A;  1K0V A;  2J5A A;  3FBE A;  1XN9 A;  3KFW X;  3KJN B;  4HTI A;  2XHC A;  3AA9 A;  1VIO A;  5J1E A;  2YKN B;  1GT8 A;  4KKO B;  2JDJ A;  4GO7 X;  2DCL A;  4MKB A;  4J9O A;  4UZC A;  3HHL D;  3UD4 P;  2IFY A;  2CZV C;  2UUB J;  4NZ6 A;  4A8K A;  5D4O A;  3PO5 A;  4CLF A;  1ICE B;  4ZVF A;  5CYM A;  3ENV A;  1RTD B;  1S1X B;  5AE3 A;  4C97 A;  3W1Y C;  4LRF A;  4IYQ A;  2GLQ A;  3R5J B;  2X1A A;  2HFS A;  1WC3 A;  4NEY A;  3MTJ A;  4NE9 C;  1NK5 A;  3LOU A;  4NMX A;  3DHW C;  2EFP A;  1RAO A;  4ZOS A;  5DDQ C;  3EGV A;  1UJ4 A;  2DB1 A;  1WOO A;  2OP5 A;  3I32 A;  2XEX A;  4FF4 A;  2XMU A;  1DLO B;  3M1V A;  1NK9 A;  2KB2 A;  4NZ0 A;  2H48 B;  1TR0 A;  4CLT A;  3KWM A;  1OQ6 A;  4IFY A;  2E9Z A;  4KO0 B;  3DNC A;  3NMR A;  6FD1 A;  5C5J A;  1M5P C;  4QYZ K;  4QW8 A;  3GIM A;  3OR1 B;  3N6L A;  4FXD A;  2HFN A;  3UFC X;  3G6V A;  4YFU A;  2WK4 A;  2VG6 A;  2BJ9 A;  4R5P A;  1LWF B;  1T7P A;  5H9E J;  5KG2 A;  5GAD U;  3QWU A;  4LF5 F;  3PX0 A;  2NXJ A;  1V3R A;  3IS9 A;  8ATC B;  3PJX A;  1NDL A;  3TAM A;  5DG7 A;  3R9L A;  3NOG A;  3TEG A;  1RT3 B;  1EHW A;  4FXV A;  5F9L A;  5G0R A;  3KK1 B;  2WVD A;  3P96 A;  1HBO B;  2IDL A;  4JUZ A;  5E41 A;  1B3T A;  2BJE A;  3BYP A;  1YBT A;  2YKM B;  3KUE A;  2CAD A;  2IJR A;  1C4A A;  2ZH7 A;  4ES3 A;  5A8K A;  1S9G A;  2YBV A;  4CM2 A;  1ZM2 A;  5A8R A;  3ZZT A;  5C24 B;  5DS7 A;  3R97 A;  1UEU A;  3JS9 A;  3KK2 B;  4IRK A;  5FDL B;  3AQP A;  4ELT A;  5HRO B;  2ROE A;  2FZK B;  5L1I A;  5IV4 A;  5IS2 A;  4DSE A;  4ILL A;  3CDU A;  4CNY A;  5JMN A;  3HSD A;  4WP3 A;  2CUY A;  3K0J A;  1XMO J;  2BKP A;  1HI8 A;  4ZPV R;  2I9S A;  4I64 A;  2IC3 B;  2NPI A;  1QJH A;  4YQW A;  2JZ5 A;  4B9S A;  2UUC F;  1FKP A;  4HLB A;  2W8K A;  1KHN A;  1RTH A;  2RT3 A;  4PXB A;  4JI1 J;  3H4D A;  2WHO A;  1NJY A;  4X66 F;  2B9W A;  1RJJ A;  2LP4 A;  1UWA A;  2BR0 A;  5C42 A;  4ERD A;  4XAK A;  5INH A;  1Q8I A;  1U26 A;  2CXE A;  3A52 A;  1D8Y A;  1IKW B;  4KIA A;  4WPA A;  4P2M A;  3JSM A;  1HQ2 A;  4F0K A;  4GO5 X;  1A0O B;  2C2E A;  1KVK A;  2RRA A;  2J0Q D;  1L3V A;  4H4K C;  2AZ1 A;  3RB6 A;  2OTJ S;  2W1B A;  1GXT A;  5J2Q A;  4IDK A;  2Z2M A;  4UF4 A;  1LFP A;  4ILR A;  3EVO A;  4MTP A;  3QNW B;  3PIO Q;  2AYE A;  1JLE A;  3EZO A;  5H9F K;  5EDW A;  1B0V A;  1CJV B;  1R43 A;  2RUS A;  2AYM A;  2R7X A;  4P9S A;  2BJ8 A;  1XNQ J;  4YEA A;  4CXK A;  1FA0 A;  3J7A N;  4O3Q A;  1LV5 A;  1S9E B;  3CJ4 A;  1H74 A;  2D74 B;  1I51 B;  1SIW B;  1M90 T;  3BGF A;  4OI6 A;  3P5T L;  2F8M A;  3SCK E;  4EUV A;  1N6Q B;  4NLY A;  2AEM A;  4ED3 A;  1HIY A;  4TY8 A;  1APS A;  2AJF E;  5AXM A;  2FJB B;  1KTV A;  1PJ6 A;  5I3U A;  4C8L A;  2HWH A;  1V9O A;  3A8E A;  1BWV A;  3R7B B;  1ZTW A;  4O44 A;  4Q2L A;  2OSQ A;  4FP9 A;  1Q78 A;  2VC0 A;  4IH5 A;  5ETR A;  5H1S V;  1RT4 B;  3HVR A;  2XZT B;  1W7W A;  3HUL A;  5FLX Y;  3D9B A;  1OS5 A;  1TFW A;  1U6F A;  1LW2 A;  4L3K A;  1JB0 C;  1HWI A;  1HNI B;  3NRB A;  2ERR A;  3DOL B;  2MTL A;  1SQG A;  4YDD B;  1S0V A;  3TUP A;  3M8P B;  2DR8 A;  2BM0 A;  3ETO A;  1U0S A;  4FPI A;  1KWM A;  2QLB B;  3C6U A;  1RZM A;  1YVF A;  1LEO A;  2HBR B;  2KHC A;  4NYO A;  1D8Z A;  3DI6 B;  4N5S A;  4CQ1 A;  2YNI A;  4P71 A;  4FZV A;  1C0T A;  2Q43 A;  4H4M A;  1T9W A;  3Q8P B;  3ZZP A;  3H25 A;  3QT7 A;  1HQE A;  2I5J B;  4KGZ B;  2HW3 A;  1KHW A;  4LF7 F;  1AFJ A;  5CCL A;  2KO1 A;  4USV A;  2KFZ A;  1RU2 A;  4FN5 A;  1TV6 B;  2FJD B;  3MR3 A;  4WII A;  1I5O B;  3QMQ A;  2FY8 A;  2GIR A;  1QVG R;  1RK8 A;  3FMB A;  3RRH A;  4TKT A;  2NXC A;  1IBL F;  1IR2 A;  2WOM A;  3CNQ P;  3VVT A;  4DR4 F;  4JP8 A;  3H2L A;  4L74 A;  4K2J A;  4RJV A;  2ZNZ A;  3U02 A;  1IBK F;  1SC1 B;  2DRD A;  4DPU A;  2IRU A;  2DGO A;  3HM9 A;  2ASL A;  1NDK A;  2YKP A;  1KOO A;  4KTQ A;  3PRD A;  3IAM 9;  4L3N A;  3UNY A;  3TUJ C;  1Q95 G;  2RDI A;  1SIZ A;  4I6Y A;  2QLJ B;  5F8L A;  4RW8 A;  2VG5 A;  1PYS B;  2QSF A;  3AAW B;  3J7Y U;  3Q8V A;  3CPW R;  1SC3 B;  3C2P A;  1CJK B;  4HDG A;  4U8Y A;  1BE4 A;  1JNR B;  2OIH A;  3TA1 A;  4MKV A;  4DI6 A;  3DLG A;  5KFZ A;  3SSQ A;  4WCE Q;  4RL1 A;  2Z58 B;  3OT9 A;  1N5Y A;  3IFE A;  1VRT B;  2VB6 A;  3VGU A;  4WU3 A;  4K4U A;  3SQO P;  5KFJ A;  2NRE A;  3C46 A;  2G1D A;  3C15 A;  4DCJ B;  4XIU A;  2OPS B;  2E1C A;  4NYP A;  1GH8 A;  2RRN A;  4LSN A;  4ECS A;  4RU9 A;  1QLN A;  4F0H A;  4TY9 A;  2XSJ B;  3D1O A;  2VG7 A;  1HMV B;  1YBU A;  5HMZ A;  1X4H A;  5HI7 A;  3HFV A;  1HNV B;  2M5Y A;  4RW6 A;  4X65 F;  4C8Y A;  4X2B A;  3SSS A;  2XI3 A;  1EJ7 L;  3IN5 A;  2ZOG A;  4CM0 A;  2QEX S;  5LJ5 Y;  3HLU A;  3JSR A;  2F9J A;  3Q23 A;  3UE2 A;  1AJC A;  5A2Q Y;  3K5N A;  4XDC A;  2CFX A;  2N3O A;  3HZE A;  2JVR A;  2ZHB A;  4M5N A;  1HHS A;  1WWH A;  5ETK A;  3TYT A;  4DEZ A;  1YBA A;  3AY0 A;  1NLK L;  3NXZ A;  2GQ2 A;  4USM A;  5KT4 A;  3ENW A;  5DQI A;  5D0H A;  2BX6 A;  4AUK A;  3R6L B;  2V4J B;  4JI2 J;  4JYA J;  3ZZY A;  3GYN A;  2RQC A;  5KFX A;  5D15 A;  1MU2 B;  4X64 J;  1PAE X;  4DV6 J;  4LF8 F;  1TK8 A;  2EFO A;  2DGU A;  2L9D A;  3D4J A;  1E6Y A;  1RAB B;  2FLL A;  2QYC A;  4R0E A;  4ECQ A;  2VBW A;  4NXN F;  1N5S A;  5BJR A;  3PCO B;  2ZM6 J;  2CA9 A;  2BJ7 A;  1SH3 A;  3M2V B;  5CHC B;  2HZA A;  2IVM A;  4GC6 A;  1JJH A;  3FBB A;  4DHV A;  3MAQ A;  4DR3 F;  1WOP A;  1ZYQ A;  1HNW J;  1TTH B;  4PYD A;  4TU9 A;  2IM3 A;  3KG1 A;  3OQ2 A;  4YR2 A;  2DR5 A;  2PE8 A;  7FD1 A;  3CD7 A;  4RW4 B;  4Z7C A;  4ZJQ A;  3SI8 A;  2O3D A;  3NAI A;  3DDN A;  4EO6 A;  2FUG 9;  2F7V A;  2BXJ A;  1RWP B;  2IRY A;  2AIR B;  2KT2 A;  2PFD A;  1RBA A;  2RQK A;  3I9V 9;  1TUV A;  1IKY B;  3MEC A;  4KH1 B;  3GWC A;  2GIQ A;  1P49 A;  3ELH A;  1FJ7 A;  3W65 A;  3SDE A;  4CO3 A;  4DV4 J;  3T5J A;  1Q8L A;  2WB4 A;  3QIP B;  1YIT S;  2JVO A;  3AJ2 A;  2AJQ A;  2CQG A;  3VAK A;  2JLF A;  4LF4 F;  4DR6 F;  1X4F A;  3CJ3 A;  1Y9O A;  3GG1 A;  1RWM B;  2XWY A;  1N88 A;  3PYE A;  4ATN A;  4YR3 A;  3PYG A;  3ZZZ A;  1YZ7 A;  3B54 A;  3E2D A;  5D0G A;  1FVQ A;  4DS5 A;  2VQE J;  4PPZ A;  4C7Q A;  3LF0 A;  2MLX A;  1HBM B;  2HGL A;  1UFW A;  1VRQ C;  2J9D E;  2NLW A;  4ZCK A;  2V4Q A;  1IVZ A;  2FJW A;  1RTJ B;  1TAU A;  1M5H A;  3SZZ A;  1DUR A;  1YJR A;  2R8K A;  4C2M A;  4PWD A;  4UT4 A;  3ZC4 A;  1XR5 A;  3PV8 A;  3HDS A;  1J5E J;  3TZY A;  2FGO A;  2JC1 A;  2ZDP A;  2ZBQ A;  4WJB A;  5DGA A;  3MED B;  2V2K A;  2C42 A;  2GCF A;  2XCP A;  2ADB A;  3K5P A;  1JLQ B;  4Y00 A;  1AJB A;  1B64 A;  4QIE A;  2YNH B;  1S4E A;  4LQY A;  4D3G A;  3SQG A;  3IDD A;  3MUM P;  3KHR A;  4ZPC A;  4EYH B;  2MKJ A;  4DL3 A;  1RAF B;  1S1W B;  2UVV A;  1KTQ A;  4ZVT B;  1YJN S;  2EWH A;  2MZR A;  2D1C A;  5F8N A;  1TK0 A;  1N34 F;  5KAK A;  4LVN P;  2D3O 1;  1D0E A;  2ATL A;  1MRO A;  4KFB B;  1PC4 A;  2R9L A;  5I4M A;  3IG1 A;  3BO4 A;  4EEY A;  1O0P A;  2HND B;  2OPP B;  1CPZ A;  3VGS A;  3BO2 A;  1QTM A;  1S6P A;  1YTY A;  3CCE S;  1B7Y B;  2HQG A;  1T9V A;  3BZQ A;  1Z2L A;  2ZIT A;  4DF4 A;  2RRB A;  2AP6 A;  4WFB Q;  3ILL A;  4B3S J;  2XB2 D;  2E7X A;  3QYY A;  4ETZ A;  1JLB B;  3ILI A;  1MNE A;  3ZTS A;  2CPI A;  2K06 A;  2M7S A;  1V5I B;  4N41 A;  4L6V 3;  1Q8K A;  1EI6 A;  4Y0F A;  2ZOM A;  4U7U K;  4RBV A;  5KFB A;  3LUY A;  3IWX A;  4J9N A;  1WC6 A;  4O4G B;  3WAW A;  2RH3 A;  3MZI A;  4QYR A;  4YS2 A;  2F9D A;  4I68 A;  1RSC A;  4OV1 A;  1X60 A;  1V3S A;  2W5R A;  3M2U A;  4G65 A;  5GVQ A;  1F9H A;  3NKR A;  1B7F A;  5KFS A;  1WSV A;  1YG0 A;  4KB7 A;  4JI8 F;  4LF5 J;  3V6H A;  3N5B A;  2FHM A;  5A2Q U;  4DG1 B;  4NOH A;  4RNF A;  3GE9 A;  1WKJ A;  3E01 A;  1X9S A;  3ZNJ 1;  3OHA A;  4HHH A;  4Y2K A;  4AT1 B;  4C3K A;  1U1N A;  2VFV A;  4I0W A;  3ONQ A;  3PW4 A;  1ALK A;  2MEW A;  3NKP A;  3CD5 A;  1XEZ A;  4F4A A;  2FJA B;  3B82 A;  4GVB A;  1RTI B;  2G0I A;  3HVA A;  1G4C A;  2W25 A;  3QID A;  3W5Z A;  2E5H A;  3LO3 A;  3ISN C;  4CCH A;  5D4N A;  4N76 A;  2FHO B;  3I5B A;  4ZHR B;  3M6U A;  3EPI A;  2LLZ A;  1REV A;  2CZ4 A;  2MLY A;  4HVZ A;  3KLI B;  5D78 A;  1JLF B;  5KFG A;  2ZBR A;  3DLH A;  1TQL A;  4WZQ A;  1AZS B;  4I2Q A;  3W9H A;  4DFJ A;  3FJ2 A;  3M8Q A;  4PYA A;  1WEZ A;  2B7B B;  3W3S A;  1S7H A;  1R31 A;  3TOQ A;  1N0U A;  2H9Z A;  3C3L A;  3THP A;  2YWG A;  4DQP A;  1RA6 A;  2UUC J;  4Q0B B;  3V6D B;  5HRT A;  2PGC A;  3HSG A;  1NJZ A;  5L0K A;  2ROP A;  4LRC A;  1T9T A;  3VF0 B;  3CCQ S;  2J76 E;  3G8T A;  1WD6 A;  1IR1 A;  3MAA A;  1T9Y A;  2XHW A;  3I96 A;  1K47 A;  2KFN A;  3OTB A;  4QWA A;  2QLF B;  4NWB A;  4M5D B;  2FDN A;  2DY1 A;  3PEH A;  3PO4 A;  1JXV A;  1AW0 A;  2VON A;  4O0N A;  2Y8W A;  2BE9 B;  1XWL A;  1HR0 F;  3BBC A;  1IXK A;  2Z30 B;  3MK0 A;  2XBP A;  2XLK A;  4NI2 A;  4RO0 A;  2F8H A;  3MM5 A;  2V34 A;  3G71 S;  2LQJ A;  1T8E A;  1A6L A;  1QD1 A;  4RZR A;  1RP5 A;  2R7T A;  3G2X A;  4WTY A;  1WAC A;  1HQU B;  4AL5 A;  5IC4 B;  1DTQ A;  4F4Y A;  1YLX A;  2HKE A;  3DMJ B;  2MKI A;  4B3O B;  3RBX A;  2ZUG A;  2VOD A;  3DRR B;  2DPJ A;  4WYL A;  3PRB A;  2QA4 S;  3PFO A;  3EIC A;  2ZJR Q;  3POT A;  5K5M A;  2HRT A;  3GIL A;  3KDO A;  3PW0 A;  1BQN B;  2PSZ A;  2PEH A;  4PG4 A;  2DBB A;  3IAS 9;  2VOP A;  4M5G A;  4QPX A;  1F3V A;  4F4Z A;  1U1P A;  3KLF A;  2YH0 A;  2E66 A;  5J1E B;  3UCZ P;  3VAJ A;  2JFD A;  4Y2C A;  4J7C A;  1FI4 A;  2MQQ A;  1AT1 B;  2JL9 A;  1CG2 A;  1RB0 A;  3RG6 A;  3DOM A;  2IMW P;  4ICL A;  3PW2 A;  4U6P A;  4ZLN A;  1U02 A;  3D6M B;  4LR9 A;  5CYM B;  2HNY A;  4PQA A;  4FYX B;  4Q45 A;  3FSI A;  2DNY A;  4N77 A;  3VGV A;  4QW9 A;  3HPO A;  1X31 C;  2XMT A;  5B0E A;  1UZD A;  3H2V E;  1ZBT A;  4ZVP B;  2V2Q A;  3CUN A;  1U1R A;  5BYS A;  1UEV A;  2YNF A;  4O3N A;  2XMJ A;  3FSY A;  3JSY A;  5ETM A;  4LF9 F;  3UN3 A;  1UPP A;  5LL6 d;  3MF5 A;  1N56 A;  4LIW A;  2KI2 A;  3UDE A;  4C11 A;  3M1V B;  2M3D A;  1YJT A;  1M5O C;  2DCU B;  2AYG A;  2MDA A;  1R8H A;  2R7W A;  1RWO B;  4QBU A;  2D3U A;  5IT9 Y;  4IFY B;  1S57 A;  1HHQ A;  1VJQ A;  4RLE A;  3PY8 A;  1FE0 A;  2GAH C;  5E3R A;  3V4M A;  4BWJ A;  2DH8 A;  2DXF A;  3T5H A;  2E9R X;  1ITP A;  3OR2 A;  2VG6 B;  2V9K A;  3LP1 B;  4R5P B;  2X3G A;  5DGB A;  1I94 F;  2MQ8 A;  4FKY A;  3BH7 B;  4XTT A;  2MHN A;  1ZED A;  1IBL J;  3IS9 B;  3K89 A;  3TAM B;  4DR4 J;  3WBH A;  2YNG A;  3KHH A;  5G0R B;  2BAN B;  2XC9 A;  4I7F A;  4X4S A;  2R8G A;  2IAJ A;  1IBK J;  3D1H A;  3MMA A;  3V81 A;  3GR1 A;  5F8J A;  1H2V Z;  2HHQ A;  4MFB A;  5A8K B;  4OHV A;  1S9G B;  4RBT A;  2OTL S;  4B9L A;  4LUB A;  5A8R B;  2EPI A;  2VIH A;  2DRA A;  2Y1J A;  5CYJ A;  1MN7 A;  1XMB A;  3P49 B;  1Q79 A;  2L08 A;  2NSB A;  2W9A A;  3NG8 A;  1LKZ A;  1RA7 A;  4LJM A;  1SC6 A;  3W62 A;  1KC8 T;  2W5S A;  1NEE A;  2KRB A;  3AFG A;  3H0P A;  2LCW A;  2YVS A;  1RDR A;  3M6W A;  1N5T A;  1TL4 A;  3KUH A;  4YUD A;  2M8D B;  3C8Y A;  2DNH A;  1J5O A;  3GYG A;  3FBF A;  1YJV A;  2KVQ E;  1S0M A;  4IRD A;  1GFW B;  3I4H X;  3Q2T C;  2D3Z A;  2JLG A;  1FKP B;  4HTJ A;  5JUM A;  1RTH B;  5K8O A;  3VZI A;  3BKU A;  2ZWO A;  3MPY A;  4NX9 A;  4FNI A;  5DZ6 A;  4BHQ A;  1Y00 A;  2DYA A;  5C42 B;  4X65 J;  3QSY B;  1S1T B;  3E51 A;  2OAU A;  4UQT A;  1UKU A;  1O5J A;  2V9W A;  1FVS A;  2BJ1 A;  5LOQ A;  1VQ6 S;  4PR6 A;  4ES1 A;  3DU5 A;  2UZA A;  3M30 A;  1GK8 A;  4I2P A;  3JSM B;  3SV3 A;  2W2M P;  1FJG F;  3CIM A;  4PAB A;  4F7V A;  1ALH A;  4WXW A;  1RAD B;  1T3N A;  1EW2 A;  3FCW A;  4A8F A;  3EE3 A;  3R5D A;  2XY5 A;  1BLU A;  2CJX B;  2DH7 A;  4LF8 J;  4QIW D;  2XYG B;  2XS7 A;  5J2Q B;  2V0N A;  2CQD A;  3HO1 A;  1FDD A;  1SHQ A;  1T9X A;  1NKB A;  2HQD A;  2R7S A;  1V6H A;  4OX9 F;  1HD1 A;  4RX6 A;  3S6E A;  3PIP Q;  4HKQ A;  1JLE B;  4RNM A;  3MPD A;  4X84 A;  4NXN J;  2CQ4 A;  4LRE A;  4DPY A;  3UO0 A;  2MZJ A;  2HS4 A;  3DLL Q;  2Y1I A;  2OLW A;  1H7W A;  5F8G A;  4TVA B;  4DR3 J;  2OUG A;  1X4B A;  2WZ1 A;  2V8D A;  2DH9 A;  1F0X A;  5BR8 F;  1RT5 A;  3NL0 A;  3T41 A;  4O3O A;  3UCU P;  4TNO A;  5LMU F;  4ETX A;  1RYR A;  3CDA A;  1G3O A;  3PNI A;  3R2D J;  1MW7 A;  3AT1 B;  4TY8 B;  4AYB D;  2DGS A;  1SJQ A;  2QO3 A;  4KC5 A;  1QDU B;  3IA0 A;  4TLR A;  5I3U B;  3ED4 A;  2QFI A;  3SFU A;  3RB0 A;  3N79 A;  3CW2 C;  2APO A;  4OZ0 A;  3TZW A;  4IG0 A;  2NYI A;  4EI2 A;  3GFY A;  4O44 B;  4CO4 A;  3P5B P;  4KT0 C;  3Q8U A;  2KG0 A;  2I0X A;  3DM2 B;  3CWJ A;  4KHM A;  4NLO A;  1H6K X;  2G2Y A;  2OPR A;  2D41 A;  1LW2 B;  1RT3 A;  2POK A;  1X4A A;  1TL1 A;  1FX4 A;  5IWA F;  3PZP A;  4ECV A;  4LF4 J;  4DR6 J;  3B78 A;  3DDK A;  3BH6 B;  1RHK B;  3I4P A;  3A12 A;  4URG A;  3GV5 B;  1SUQ A;  4F50 A;  3C6U B;  3AD7 C;  2R7R A;  4KAV A;  1BMQ B;  1CS4 A;  4A8W A;  2YNI B;  3BJY A;  2AJ1 A;  1C0T B;  2C3O A;  4H4M B;  5FDL A;  2MQO A;  3QRR A;  3O6Q A;  4OJ3 A;  4P10 A;  1HQE B;  3KYL A;  1EB0 A;  3QGG A;  3C19 A;  4DQR A;  4ECY A;  3K5L A;  3KTQ A;  2A10 A;  2AJ4 A;  5IT9 U;  1UW4 A;  3M9O B;  3OJS A;  4N8O A;  2FIU A;  1FJC A;  2CJY B;  3D54 A;  2WOM B;  2M52 A;  2DT9 A;  5ADZ A;  4PG7 A;  3FC9 A;  2FHJ D;  1X5S A;  2ASJ A;  3QQC D;  4X4Q A;  1ZZN A;  1VK3 A;  4PXE A;  4DV5 F;  5ETP A;  3OVA A;  4YP3 A;  2DHH A;  2RML A;  2KJV A;  1OPZ A;  2DO4 A;  2Q6C A;  2B4U A;  1N34 J;  1NK4 A;  3CJ2 A;  4MK9 A;  3PEJ A;  2CQ1 A;  3BSO A;  1U1O A;  3BGL A;  5EGH A;  3LGN A;  1JXE A;  4RW8 B;  1B4S A;  2VG5 B;  4C8N A;  2C1E B;  2B8Q A;  4PEO A;  5F8M A;  2HS0 A;  2ZOF A;  1ELX A;  3UNG C;  2HQF A;  2J0X A;  2RH6 A;  3G9C A;  2CVI A;  2QMX A;  2ZC4 A;  1ZEB A;  5D6G A;  3IP0 A;  2Q3P A;  2MKH A;  3Q86 A;  4PG6 A;  2AJ0 A;  5C2G A;  3MFH A;  1FFG B;  3DLG B;  4ZN1 A;  4P6Q A;  3ZXW A;  4FNH A;  2VBX A;  1N5Y B;  3UW1 A;  3AD9 C;  1OO0 B;  3ADA C;  1RAC B;  3C15 B;  4U8V A;  6AT1 B;  3K2Y A;  5E3Q A;  1VLY A;  4WK1 A;  4LSN B;  2JC0 A;  1RHR B;  3IGV A;  2EI5 A;  5LRM A;  4FS1 A;  5HJY A;  4CNZ A;  4DQQ A;  2VG7 B;  2ZH8 A;  5DQG A;  2HHW A;  2Y9H A;  4X4V A;  1RT2 A;  2OMO A;  4RW6 B;  1FRK A;  4ZDN A;  4RUB A;  1YK9 A;  4CLU A;  2HBQ B;  4TLQ A;  2ZBP A;  3ZZO A;  2QLX A;  2QRR A;  3TRG A;  2XZD B;  5D3G A;  1EIY B;  3X3U A;  2IM0 A;  3RBZ A;  3K5M A;  5KFF A;  4FYD A;  2HIQ A;  1RXO B;  4GTX A;  5CAB A;  3MDF A;  4J9M A;  2XO7 A;  4JI8 J;  2W24 A;  1BWE A;  4K2X A;  3ZFV A;  5L38 A;  1YZ6 A;  3TAN A;  4DU7 A;  3KNA A;  3NKY A;  2OPQ B;  2EW9 A;  2VFU A;  3FRY A;  4E2F B;  1I1G A;  4I67 A;  2J6T A;  1R8C A;  1E6Y B;  2NZC A;  2HWT A;  4GRS A;  2CQI A;  2Y8Y A;  3HD2 A;  5CYQ A;  4B3R F;  3JTP A;  2WW8 A;  1TL3 A;  3HVW A;  3ICL A;  4W90 B;  3LAL A;  4YHH F;  1N32 F;  3MFI A;  3FZB A;  5H9E K;  4Q43 A;  5GAH I;  1IN0 A;  3TWZ A;  3RGI A;  4EFA C;  1Q4R A;  1XQI A;  1N54 B;  4NA3 A;  2PD1 A;  1KP6 A;  2R7Q A;  3H2U B;  4S0M A;  2WVC A;  1RAH B;  2M70 A;  3IBC B;  3OHB A;  3LPY A;  1C1B A;  1HWU A;  1VBX A;  3WAY A;  3I6P A;  1AUD A;  3R1H A;  3DXB A;  4K5S A;  1O6X A;  4UPL A;  3MEC B;  2ADC A;  1DFD A;  3IM8 A;  3EZU A;  1S1V A;  1VOM A;  1BQM A;  4IQX A;  2VPX B;  3PJW A;  1WF2 A;  1DQA A;  2DR9 A;  3VGT A;  1UL3 A;  4QWD A;  4LBP A;  1WHW A;  3EGZ A;  2XLI A;  3J81 j;  2EBG A;  1VC5 A;  2GHV C;  2P9G A;  1KR4 A;  3D68 A;  2BE2 A;  5EN1 A;  2HQI A;  3L3C A;  1FWP A;  4B02 A;  2GW8 A;  2CQC A;  2CG8 A;  3KNG A;  1HR0 J;  4YB5 A;  2R7O A;  4OI2 A;  2CPH A;  4M5J A;  2AGP A;  1SBR A;  4OZL A;  2CDR B;  4B9T A;  2XTJ P;  3H90 A;  4JV5 F;  4FVM A;  2PEB A;  4PWD B;  1OY8 A;  4ZK7 M;  4WFA Q;  4OYP A;  2RVJ A;  1DQ8 A;  2CAJ A;  1D09 B;  4G6V B;  1E6V A;  1F5C A;  4LQ9 A;  1R6Y A;  4UOO A;  3TAR A;  2X98 A;  1GAO A;  3NS5 A;  4JI3 F;  4OJG A;  3SQG B;  1N33 F;  2J8A A;  1P8G A;  1VC0 A;  3M32 A;  3VAH A;  4KYZ A;  3CE8 A;  1QE1 A;  1D3W A;  2K1R A;  3FGV A;  1IJF B;  4QYZ J;  3PJ9 A;  4DCO B;  4ELV A;  1MRO B;  4KPC A;  4ANC A;  3AQO A;  4J9L A;  1S48 A;  3IG1 B;  2PN6 A;  4OI1 A;  2LEA A;  3N0V A;  5ETO A;  3W60 A;  1U24 A;  2JLE A;  2W5T A;  2J7K A;  2XG8 A;  2K7K A;  1S6P B;  3QJP A;  3A3N B;  5E5N A;  2W2N P;  1ZM3 A;  2QA2 A;  3MMJ A;  4BS2 A;  4KR0 B;  3BSN A;  2ZBI A;  1XNR J;  4FYY B;  2UVW A;  2C3U A;  3UI3 A;  1B8J A;  2OHD A;  2IY5 B;  2B43 A;  3PKM A;  2QYG A;  1IBM F;  3RR8 A;  3EGW B;  3OL8 A;  1RGV A;  4B08 A;  1MLA A;  5ETL A;  1YIJ S;  1T94 A;  1X5O A;  3TAP A;  5IFM A;  2B4V A;  4OV6 A;  3HJV A;  1GX5 A;  3PX4 A;  5L8R C;  4YME A;  4LF9 J;  1UVL A;  2C22 A;  5HAN A;  4ZG6 A;  2DNL A;  2J6U A;  3M2V A;  3H5X A;  2HZC A;  3SIP B;  2WVF A;  1VQ9 S;  3PR5 B;  1CUL B;  4WK3 A;  4NL5 A;  1VFJ A;  5KFE A;  4QWB A;  4RW7 A;  2EK6 A;  1M1G A;  3G6Y A;  1UEK A;  3N01 A;  4DR7 F;  2QA4 G;  2G1H A;  5L1L A;  4HEA 9;  2OML A;  3T1A A;  1FF2 A;  1QM9 A;  4F8R A;  3M2U B;  4Q5V A;  1WDT A;  3TI0 A;  3MEE A;  3KG0 A;  4DL2 A;  1S12 A;  4KAY A;  3LQV A;  1URN A;  1I94 J;  1U1M A;  2PI5 A;  4JI4 F;  2B7C B;  4ZLP A;  5E2Q A;  4ZKA A;  3E01 B;  2BMB A;  3OUY A;  3WX8 A;  4KHR A;  2FVQ A;  3BS9 A;  2DXD A;  4ZG7 A;  2E5L F;  2EC0 A;  3G4S S;  4RNN A;  5K8P A;  4DX6 A;  5KG5 A;  1Y3K A;  2KU7 A;  5ETN A;  3T01 A;  1JJ4 A;  1SV5 A;  2O67 A;  2KTQ A;  4GVB B;  4OI4 A;  3OW2 R;  4X62 F;  3BQ1 A;  4PUO A;  2P6T A;  2GGP A;  2QZ8 A;  1REV B;  1VGY A;  2YWK A;  2IVF B;  5HVH A;  3BGU A;  4C0O C;  2GA7 A;  2DIU A;  2KXN B;  4MIV A;  4I2Q B;  9RUB A;  2F5G A;  4USU A;  5H9F J;  3GFZ A;  3ET6 A;  2PII A;  1GXL A;  3M8Q B;  3T02 A;  3MCS A;  2KRR A;  2B5J A;  3Q8R B;  3O1L A;  3KLE A;  4ECR A;  4PZV A;  5K14 A;  1EET A;  1WG5 A;  3ZTR A;  1TUG B;  3SCI E;  3QAE A;  4KPY A;  3HFZ B;  4EYI B;  4N8N A;  2EKY A;  2YNH A;  3BDH A;  2DPI A;  4NCG A;  4U95 A;  4KJG A;  3CCM S;  4DUY F;  4YR1 A;  3G8Q A;  3H59 A;  3KLH A;  1ZPW X;  2QN6 B;  3MAA B;  2ASD A;  2NXU A;  2HYI B;  1U6Z A;  3JXO A;  1VQO S;  2BKO A;  2OEL A;  3NNA A;  2D1G A;  5GOV A;  7FDR A;  3SEO A;  2FYX A;  2WSE C;  1NB7 A;  4ED6 A;  2FVC A;  1FEE A;  4DPT A;  1FJG J;  5AT1 B;  4NI2 B;  4FVC A;  3DN9 A;  3MM5 B;  1S79 A;  2DIT A;  4Z7Y A;  1FO1 A;  3QJL A;  2CQ0 A;  1U47 A;  4CYR A;  3ZTQ A;  3UN5 A;  3HP6 A;  1FRM A;  1K1Q A;  4N56 A;  1F3F A;  1DTQ B;  3OPK A;  5KG0 A;  2EG2 A;  1EAY C;  3I9Z A;  4MMO A;  2RE1 A;  2B9X A;  4CYS A;  2HLT A;  1F5A A;  1R89 A;  4TQR A;  2C2R A;  2HHU A;  1IUJ A;  1YX2 A;  3POT B;  2IA0 A;  1VLO A;  4JI5 J;  4JI0 F;  2HAF A;  3OL9 A;  5BR8 J;  2R7V A;  2QJ3 A;  3N6N A;  2IJF A;  4DR5 J;  3PR4 A;  2PFF B;  3OLB A;  1S6Q A;  2F4F A;  3NLC A;  4O4G A;  1FKA F;  4DDF A;  2IBK A;  2UVR A;  5LMU J;  2B8P A;  1M1H A;  2LQ8 A;  3KLF B;  4JI7 F;  2E5J A;  1FRI A;  1HWJ A;  3CTR A;  3V5R A;  5KG3 A;  3CDW A;  2AU0 A;  2LEC A;  3DOM B;  4ICL B;  4ZPD A;  2L41 A;  1ZA1 B;  4J91 A;  4QWC A;  2UUW A;  2L9N A;  2Z56 B;  4M5L A;  5HQM A;  3SCL E;  2HNY B;  1X4D A;  5EX3 A;  4BWM A;  3BQ2 A;  3FMW A;  2PA3 A;  2W2O P;  1MML A;  1U09 A;  4DCP B;  4ZVG A;  2HVZ A;  2MXY A;  3O3L A;  2ZH6 A;  1UWB A;  3LPE A;  2IJN A;  5IWA J;  4KE5 A;  3CMA S;  4IRC A;  3T1Y F;  2YNF B;  5BYQ A;  2RIJ A;  5LXR A;  2VC1 A;  2R2R A;  2BQR A;  3BPD A;  2IYG A;  3GPA A;  2HVD A;  4C4W A;  1MMD A;  3BF4 A;  2QT7 A;  2D9O A;  4M5I A;  4C11 B;  4CXU A;  2Z2Z A;  3R5C A;  1BD6 A;  1VR6 A;  3DKD A;  3CCW A;  3HVT A;  3MUV P;  2AW0 A;  5CCM A;  1JLC A;  3TQE A;  5D8H B;  9ATC B;  1HW8 A;  2KL8 A;  4C0H A;  2XYP B;  2EFV A;  3IWN C;  2G9Y A;  4UOP A;  2JRS A;  2DRB A;  2W4D A;  4OX7 A;  4KGX B;  1LNQ A;  3LXQ A;  1KHK A;  1EW9 A;  3OR2 B;  5T14 A;  5JJB A;  1QUP A;  1CEZ A;  4QPT A;  2XGQ A;  3P4U B;  1FNX H;  2KDO A;  5M2P A;  1RTZ A;  1Q7Y T;  1O98 A;  1G2E A;  4J9P A;  3TA2 A;  2YNG B;  3UN2 A;  4QR0 A;  3V6D A;  1KD1 T;  4I7F B;  3OXL A;  3F56 A;  2AGQ A;  2IAJ B;  1CQM A;  1LWX A;  4DV5 J;  3MMA B;  1ZS6 A;  3V81 B;  3E3X A;  3ISN D;  3GR0 A;  4IO1 A;  3GTY X;  3AB2 B;  2CWX A;  4EO8 A;  3A8I A;  4MFB B;  2E7V A;  2FGC A;  4ECU A;  4PWU A;  3FSX A;  1EJJ A;  4OYO A;  2O5D A;  3T5L A;  5AE1 A;  2AJ2 A;  1T0T V;  1U0H A;  3DYA A;  3UD3 P;  1HKA A;  3KJV B;  1PBU A;  5GAG U;  2ZEJ A;  3NP5 A;  2J7W A;  3M8W A;  4NLG A;  4J90 A;  5IOL A;  2BRK A;  3PYD A;  4FDF A;  3DDI A;  1XR7 A;  2DNR A;  4PG5 A;  4ZGA A;  3KJF B;  1ARO P;  3RZA A;  1SJ3 P;  4OZJ A;  2YQ1 A;  3MHY A;  3O2I A;  1OJ4 A;  1N8R T;  1TP7 A;  1JWW A;  1BY9 A;  2PMH A;  4B9M A;  3RJM B;  5LQQ A;  3GP9 A;  1SJF A;  3CD0 A;  3HX9 A;  4PXC A;  1ALJ A;  2MQN A;  1J5O B;  1HBU A;  3IGN A;  3M8Z A;  2DGQ A;  4KGK A;  2FLN A;  1TFY A;  5EWF A;  2CYY A;  5HAT A;  2X1B A;  1FX2 A;  3GG0 A;  2FZC B;  1IQZ A;  3LAM A;  5B7W A;  3M7V A;  3CCZ A;  2HHX A;  1F5B A;  1FXL A;  2W9B A;  4C8K A;  3Q2S C;  4LF6 F;  3B4D A;  5EWE A;  3D0G E;  5KG6 A;  5HK4 A;  2D69 A;  4K8R A;  3VAM A;  1S49 A;  3C14 A;  3M30 B;  5EGE A;  2G4B A;  4I2P B;  2C3M A;  2H5E A;  3CDE A;  2WW4 A;  2CPF A;  3FEX B;  1UET A;  3BBB A;  4RUC A;  3AJD A;  1EW8 A;  1UMJ A;  3VQS A;  2X3D A;  2GJF A;  2VQF F;  4DV3 F;  4K59 A;  4C8M A;  2DHG A;  1RWK B;  3IO1 A;  2WSF C;  3H98 A;  3ZTO A;  1Z1Z A;  4M5H A;  2ZUA A;  4GTZ A;  1JXL A;  3KK3 A;  3RW6 A;  1WC5 A;  4B3R J;  3UVJ A;  5KT5 A;  1JLA A;  2DHX A;  3VAL A;  1ZAW A;  1RAJ A;  4YHH J;  3PM9 A;  3MM8 A;  1PAU B;  1RT5 B;  4DV0 F;  1VBK A;  4Z37 A;  3G87 A;  2BOA A;  4DFK A;  4UPK A;  1AXQ A;  1A7G E;  3QO9 A;  2KXF A;  4ZPW R;  5HQ8 A;  3IRW P;  4TN0 A;  3EYZ A;  4KHP F;  4I4B A;  1JLG A;  4IG0 B;  3NGU A;  2EXU A;  3P3D A;  4QIV A;  2DNM A;  3LP1 A;  2AKW B;  1TEL A;  5SUH A;  1TZ0 A;  2JEJ A;  4LFB F;  5I42 A;  2HEK A;  4DZ6 A;  2XR9 A;  2XGP A;  4OHY A;  2OPR B;  3KXD A;  1HNX F;  2HBY B;  1ZH5 A;  4OYB A;  1TL1 B;  3D0I E;  2EKN A;  2BAN A;  2M4M A;  3UDL A;  5KFD A;  3OSN A;  4PPD A;  3NMA A;  4ILM A;  5E33 A;  2VOO A;  1O99 A;  2GSO A;  1SUQ B;  4IQM A;  2QGF B;  4C98 A;  2VDI A;  4P52 A;  1VQ8 S;  2HGM A;  3MPW A;  1LFW A;  1CS4 B;  1FK9 A;  4F04 B;  2WB1 D;  5IJQ A;  2GHP A;  1TKX A;  3IGY B;  4A8O A;  3QJJ A;  2OD4 A;  3MCO A;  2IFX A;  4G3I A;  1SQE A;  3G86 A;  5AJ9 A;  1D9D A;  1YRT A;  4JV5 J;  1ELZ A;  3OLA A;  2H51 B;  3ZTP A;  2IYI A;  3J80 Y;  1VRU A;  5B0C A;  2CPE A;  1VQL S;  3RB3 A;  4CO1 A;  2B3T B;  2OJ3 A;  4RNO A;  2RHQ B;  2AT1 B;  4P2X A;  3JAM Y;  1RU1 A;  4IFV A;  5FD1 A;  3HCX A;  1YKW A;  4JI3 J;  1RIS A;  2CWK A;  3HT0 A;  1N33 J;  5DLG A;  3M6X A;  3FZ2 A;  1Y0H A;  5CD4 A;  3RTV A;  1N5Q A;  3GIK A;  4WXO A;  3AOB A;  2DGT A;  1QAY A;  2H5J B;  4HHJ A;  2AZ3 A;  2BOP A;  4DQS A;  4PXD A;  1S1T A;  3SZ2 A;  2AWZ A;  5KXA A;  4RUH A;  3KUG A;  2ILY A;  1KVI A;  2CDQ A;  4F4W A;  5KFO A;  5A6P A;  4ZA1 A;  2FVP A;  2G0J A;  1D1U A;  3TJ9 A;  3R1L A;  3CJK A;  4LMZ A;  4OYA A;  3NNC A;  2K8G A;  4LF1 A;  2AGO A;  2Z0G A;  3DOK A;  1B99 A;  2HWI A;  1H98 A;  4USW A;  2NSC A;  2QSW A;  3W7B A;  3RYL A;  2KFY A;  1IBM J;  2B9Y A;  4KV8 A;  1FDB A;  4F67 A;  2XM3 A;  4WWS A;  2QL5 B;  5KT3 A;  4B9V A;  1PYO B;  2IPO B;  3M6V A;  2GJI A;  3CCR S;  2LQ9 A;  5KFU A;  1RT2 B;  4AL6 A;  4DFP A;  4ZVS B;  2JOQ A;  2X1F A;  5HLF A;  2GHW A;  1MWQ A;  3UR0 A;  2XCA A;  3N28 A;  4RNH A;  4OI3 A;  2G2Z A;  1RAG B;  4EZ9 A;  4EK2 A;  1CJT A;  5CZX A;  2IBO A;  3ZO7 A;  4DR7 J;  2OI2 A;  1TKZ B;  5D3G B;  4DV1 F;  2MJU A;  4DUT A;  4MIW A;  3CB4 A;  4ID5 A;  1YJW S;  2WTF A;  4JI4 J;  1VQ7 S;  5KFK A;  5B08 A;  4KH0 B;  3JSB A;  1EP4 A;  2NYH A;  4JV1 A;  4K0K F;  2KZZ A;  4CDI A;  1ZOT A;  3W2W A;  3DM2 A;  1TL5 A;  2XNR A;  1X9W A;  3A13 A;  5DJB A;  1NUE A;  2E5L J;  1H3D A;  2UVU A;  2KYX A;  3BRE A;  3BPS P;  5THW A;  4EGL A;  3CJ8 A;  1KFD A;  5B09 A;  5CYQ B;  1SVD A;  3TZZ A;  2VA3 A;  1NME B;  4Q2M A;  1KBR A;  2HFU A;  1TL3 B;  1UW9 A;  2BRL A;  2RJZ A;  4K4X A;  2AX1 A;  2GVZ A;  3HF5 A;  3MUR P;  4X62 J;  2D7S A;  3TUZ C;  2XI2 A;  1UA0 A;  1KNZ A;  1FTR A;  3CCL S;  3FRZ A;  4PRF A;  4RW9 A;  1BQX A;  3LP0 A;  5DDR C;  2IM1 A;  5DRK A;  2CIM A;  3I55 S;  3ZZR A;  4G1Q A;  2KT5 A;  3ZZ0 A;  1WKL A;  1C1C A;  5KTQ A;  3TA0 A;  2E1P A;  1RWN B;  2B51 A;  2BW7 A;  3OFH A;  2XY7 A;  1C1B B;  4GTW A;  4DV7 F;  3D3B J;  4WP9 A;  4LR2 A;  1TL7 A;  4UOF A;  1RKJ A;  3NAH A;  3JYT A;  3QRQ A;  2R2U A;  5KFN A;  2GIF A;  1CC7 A;  1IKX A;  4RPF A;  2LQ5 A;  1S1V B;  2LDY A;  2J8S A;  1BQM B;  5IM0 A;  3Q8Q B;  1XMQ F;  4ED1 A;  2J0S D;  4DUY J;  5DM7 Q;  1EQJ A;  1SJ4 P;  2AHO B;  1P9Q C;  4KGV B;  2C2N A;  3HKZ D;  1UVK A;  2BE2 B;  5IC6 B;  3K8W A;  3DLJ A;  2MQP A;  1DY3 A;  2PO4 A;  1XNQ F;  2BJ3 A;  2FC9 A;  2UU9 J;  2DNG A;  1RBL A;  4C0B A;  2C3Y A;  4LFA F;  5AXK A;  2LVW A;  5F3Z A;  3S01 A;  1DTT A;  2XYH B;  3W66 A;  2EFQ A;  1U2C A;  4HI2 A;  1G6B A;  3CC7 S;  1HNZ F;  2E5I A;  3RBE A;  5KT6 A;  4TU7 A;  2CZ9 A;  1XR6 A;  4XK8 C;  1E6V B;  4Y2M A;  3OTO F;  5HVF A;  1DRZ A;  4KGM A;  2B4O A;  4K7Q A;  2OO4 A;  3GIR A;  4J9K A;  3J80 U;  3TO8 A;  1KON A;  3M32 B;  1NH7 A;  4JI0 J;  3H42 A;  2V68 A;  3IR6 B;  2IVY A;  1QE1 B;  4RBU A;  3JAM U;  5DQH A;  2K1R B;  1WG4 A;  4N47 A;  4M5M A;  1T02 A;  4HL9 A;  4F2S A;  1KH7 A;  2K3I A;  2KXH A;  4FXW A;  4JI7 J;  4CO2 A;  1NKE A;  2H1Y A;  3EXY A;  1CJU A;  2H5I B;  2A2D A;  4ECZ A;  1PBA A;  3RRG A;  4FDJ A;  4FF3 A;  1ANJ A;  2ZNY A;  3ZNU A;  1B70 B;  1P1L A;  2GS8 A;  3FQK A;  3MAH A;  3T1H F;  1NB2 A;  2OPQ A;  4PQU A;  1LK5 A;  1GMW D;  1HHT P;  1RWX B;  2XWX A;  2V8P A;  4OZ1 A;  4MAK A;  2LDI A;  4Y2A A;  5TJ3 A;  3T1Y J;  1LW0 A;  3TVZ A;  1ANI A;  2A3J A;  3CT9 A;  3OD2 A;  3HXM A;  3BDF A;  1NU4 A;  1FE4 A;  3DRP A;  4KM4 A;  5EGY A;  2EBE A;  2V50 A;  1RHM B;  2A6M A;  2W5W A;  5J2P A;  5ETQ A;  3I0S A;  1QY7 A;  3TAQ A;  3OFF A;  2JWN A;  1NBE B;  3MTK A;  1CSJ A;  5EUH A;  5LM7 E;  2OH2 A;  3FQL A;  3ILJ A;  4YB6 A;  2CJB A;  1ZZF A;  3P8B B;  1NSK L;  1NDC A;  2VF3 A;  2F4V F;  4RW7 B;  1X0F A;  1VHI A;  2RQM A;  4ES2 A;  4A8Y A;  3D6H B;  1WUU A;  2HUR A;  1VIS A;  5C7P A;  1QAI A;  4Q44 A;  1S59 A;  3GJQ B;  2ZFH A;  3Q8S B;  3MEE B;  4A46 A;  5FII A;  3KD8 A;  3RAM A;  3R8Y A;  2YWE A;  3GJT B;  3MGJ A;  4OYW A;  4J9U E;  2IUC A;  3CCJ S;  2CRL A;  5GAE I;  3BKF A;  4LBH A;  2OEK A;  2C28 A;  3H5U A;  4NLR A;  3D67 A;  1E1Z P;  3OUY B;  3QAU A;  1VK8 A;  1I3O B;  5D4L A;  3I87 A;  3P6Y C;  2DGV A;  3IXQ A;  4OYM A;  5DM6 Q;  1ACM B;  4FYV B;  2VBZ A;  2XMV A;  3IR5 B;  1B0T A;  1O8B A;  1SV5 B;  3LA0 A;  1O51 A;  3VAI A;  2DR7 A;  1CVJ A;  1JKH A;  5HSP A;  1QSS A;  2KYZ A;  4PUO B;  2GGP B;  1JJC B;  2B56 A;  2FB0 A;  2E44 A;  3PXG a;  1L5U A;  3BSC A;  2M8H A;  1M5K C;  3TG0 A;  4F3O A;  2JH3 A;  3M2R A;  3NKM A;  1NRK A;  2GFF A;  3J7A 1;  2R3V A;  4WKR A;  3ET6 B;  2V2V A;  4CI0 B;  3GB0 A;  1W26 A;  3OFE A;  2B5J B;  5F41 A;  3KLE B;  5K14 B;  1EET B;  4HAC A;  1ZET A;  4FYW B;  2FHJ A;  1U7L A;  3KG4 A;  1NZA A;  4HT7 A;  2P2C B;  4YB7 A;  1FT8 A;  4NCG B;  1R0B G;  3MEK A;  1BUX A;  4X64 F;  1Y5I B;  2VL1 A;  3KLH B;  2MSS A;  4OLP A;  3F44 A;  5CZV A;  2A2C A;  4C9D A;  4B17 A;  3H5S A;  2MZQ A;  1X5T A;  3NY0 A;  4DS4 A;  2Q66 A;  4FKX A;  3KDN A;  1TKD A;  2CJ9 A;  1HBN A;  5HQL A;  1IKV A;  4NYZ A;  3D7S B;  4DX8 H;  4DX5 A;  4GC7 A; 
#chains in the Genus database with same CATH homology
 3OT9 A;  1AUK A;  1KHL A;  5DLW A;  4CYR A;  4UPI A;  5INH A;  3TX0 A;  3UN5 A;  3DYC A;  1ED9 A;  3MK2 A;  1URB A;  3M7V A;  2W5R A;  3A52 A;  4MIV A;  5LIA A;  3TG0 A;  1KH7 A;  1EQJ A;  4FDI A;  5AJ9 A;  2W5Q A;  4UPK A;  1N2K A;  3NVL A;  4N7T A;  5LRN A;  3NKM A;  1ELZ A;  3ED4 A;  1KH9 A;  3NKR A;  4NWX A;  5K4P A;  3T02 A;  4B56 A;  2GSU A;  3E2D A;  4CYS A;  5DLT A;  4TN0 A;  3UN3 A;  4QAX A;  5DLV A;  3MK1 A;  1Y7A A;  2W5T A;  4KAY A;  1Y6V A;  4LR7 A;  1EJJ A;  5EGE A;  4MHX A;  3CMR A;  3WAV A;  5LRM A;  3B5Q A;  5HRT A;  3M8Y A;  3KD8 A;  1ALH A;  1HQA A;  3DPC A;  4ZG9 A;  1AJD A;  3IGZ B;  1EW8 A;  5L0K A;  4FDJ A;  4LRC A;  1ED8 A;  1EW2 A;  1E3C P;  2GA3 A;  4CXU A;  3BDH A;  2IUC A;  4LRD A;  2XRG A;  1KHJ A;  5C66 A;  2QZU A;  3SZZ A;  1ANJ A;  2ANH A;  3NKQ A;  4KJG A;  5IJS A;  2XR9 A;  3TWZ A;  1AJA A;  2IUC B;  3M8W A;  1E1Z P;  4LR8 A;  4NWJ A;  1KH5 A;  2W5S A;  1HDH A;  4YR1 A;  1B8J A;  1URA A;  1SHQ A;  3UNY A;  3BDG A;  4ZG7 A;  1AJC A;  1N2L A;  1KH4 A;  1ALK A;  4GTY A;  4ZGA A;  2ZKT A;  3NKP A;  1HJK A;  4UOP A;  2G9Y A;  5TJ3 A;  3BDG B;  4CXK A;  5EGH A;  2W5V A;  4UOR A;  3T01 A;  2IFY A;  5KXA A;  1O99 A;  1E33 P;  2D1G A;  3IGY B;  1ELY A;  2GSO A;  4GTZ A;  5GOV A;  5LQQ A;  4LRE A;  3LXQ A;  1EI6 A;  1AJB A;  1KHK A;  3Q3Q A;  4UPH A;  4LRA A;  3UO0 A;  1E2S P;  1EW9 A;  1FSU A;  1K7H A;  2VQR A;  4LQY A;  1ALJ A;  4CXS A;  2W5X A;  3IDD A;  4GTX A;  3WAX A;  4UOO A;  3WAY A;  1ANI A;  2GSN A;  1KHN A;  1P49 A;  3MK0 A;  2X98 A;  3M8Z A;  1ELX A;  3BDF A;  5GRR A;  4GTW A;  1ZED A;  4KAV A;  4UPL A;  3NKO A;  4KM4 A;  2RH6 A;  4ZG6 A;  4LR9 A;  3NKN A;  3SZY A;  4KJD A;  4LR2 A;  4MY4 A;  3WAW A;  1ALI A;  3WBH A;  4LRF A;  3T00 A;  1SHN A;  2W5W A;  1O98 A;  1ZEB A;  5L0E A;  1ZEF A;  2GLQ A;  2W8S A;  2W8D A;  5IJQ A;  3UN2 A;  4LRB A;  5L0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...