3U0DA

The structure of human siderocalin bound to the bacterial siderophore 2,3-dhba
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
175
structure length
175
Chain Sequence
TSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
molecule keywords Neutrophil gelatinase-associated lipocalin
molecule tags Antimicrobial protein
source organism Homo sapiens
total genus 38
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3u0dA00
3VG3A 4AZMA 2E4JA 5EEEA 1E5PA 5L8OA 1UZ2X 4DQ4A 1A3YA 1S2PA 5FAZA 1JBHA 5DPQA 3KFFA 3VG7A 1OEKA 4BQUA 5HTDA 2QO4A 3D97A 1KGLA 1YP7A 5LJKA 1LKEA 2LB6A 4NLIA 5KHPA 3CBSA 1U18A 1B8EA 1GX8A 1KT7A 5HZQA 2HYSA 4A1YA 1I06A 4ZHFA 4QGWA 3FLLA 5AQ6A 1G85A 2FT9A 1SXUA 2NNDA 1MX7A 2FLJA 2W2FA 4ORRA 1B56A 1LIBA 1HMTA 1LIEA 5HA0A 3O19A 1QG5A 1FELA 4ZR2A 4AZOA 1L6MA 1BLRA 4ZH9A 3WJBA 1QY0A 1T0VA 2AT3X 1EW3A 1SY2A 1ZNHA 1JYDA 1KZWA 2Q39A 1GKAB 2PY1A 2A2UA 4YCHA 5HCCC 3EBWA 1ICNA 4GNWA 4TLJA 4AZRA 1X8PA 1XCAA 1D3SA 2QOSC 3BLGA 5LJDA 2WSJA 4Y0RA 4CK4A 2FRSA 1CBRA 4D6AA 2JU7A 1HN2A 1BEBA 4O9SA 2X45A 1YIVA 4ZFXA 1QWDA 3CWKA 2AL0X 1OPAA 1KQXA 4N7CA 5KIDA 2JOZA 2FR2A 1X71A 3STKA 1CBQA 5D8JA 4AZPA 5HCEC 1Z24A 5H9KA 3UEWA 2QO6A 4GKCA 5D47A 1IIUA 2GC9A 1BRPA 2LBVA 1QY1A 4HPBA 1UREA 4I9RA 1ERXA 4PSQA 4YGGA 2K62A 2NP1A 4MVKA 1FDQA 1DF3A 1LPJA 4QAEA 3P6FA 5LJEA 2OVEA 5L8NA 2A13A 2HNXA 1QABE 4IAWA 3WVMA 4EXZA 4UU3A 4DQ3A 4I3CA 2JN3A 2R73A 3BU1A 3JS1A 4QZTA 5F6BA 4AYHA 4Y0QA 1LIDA 1SY1A 3FA8A 5DG4A 4ZHHA 1TOWA 1ZNLA 4LKPA 3F9DA 4ORSA 1HMSA 1GKAA 5HWZA 1R0UA 1BJ7A 1YWBA 2RCQA 4LZVA 1VYFA 5HZ6A 2RQ0A 2Q2PA 1ICMA 3APUA 1SXYA 4IB7A 1VYGA 1HBQA 3NX2A 2L68A 1OBPA 3STMX 5FENA 3NQ3A 4R0BA 3UEVA 3I0AA 3ELXA 2R74A 4ZGUA 2POAA 3U9PC 3G7XA 4QGXA 3B2HA 3C78X 4YFQA 3BS2A 1LFOA 3B2IA 5HCDC 1GX9A 1GT4A 2LKKA 3DSZA 2G79A 3TGBA 3SAOA 5BVTA 1U17A 3WJFA 3T1DA 2CZUA 4YMYA 1HQPA 3KFGA 3PPTA 3KFIA 4MVIA 5LJBA 1AELA 2RD7C 4IB8A 4WBKA 1CBSA 1T68X 2L5PA 3RZYA 3FIQA 4TNNA 3NQ9A 1KT3A 3WJCA 4EFGA 1DV9A 2AT5X 1X8UA 2MO5A 2LFOA 3TGCA 5BVQA 3HWGA 1IFCA 3GAQA 2CZTA 4NNSA 1ADLA 1OBUA 5F1EA 4XMGA 2BLGA 4YH0A 4A8ZA 3B2JA 3PP6A 3BY0A 3ELZA 2OZQA 1X8NA 2CM9A 1JV4A 2YG2A 1PBOA 3IFBA 1SY3A 5HZ9A 1E06A 4AZNA 4ODDA 1BSQA 1QFTA 1EIIA 3AKNA 2A0AA 4ARHA 3NP1A 3P6GA 4MVLA 1KT4A 1KOIA 3FA6A 1LIFA 2HLVA 4YKMA 4ES7A 1I4UA 1NGLA 3APVA 3S26A 3PH6A 1IFBA 3QKGA 1N0SA 1X8QA 3PECA 4D6BA 1EQDA 4IMNA 3L4RA 2NNQA 1ZRYA 4YFRA 5EPQA 1IKJA 1NP4A 1CJ5A 2XKLA 4ZHDA 3NADA 3WBGA 3HK1A 3MBTA 3D95A 3PH5A 5C0NA 2OFRX 2W2BA 3STNA 2AKQA 4GETA 3JSQA 2L67A 4GRJA 4EEJA 4ORWA 5CE4A 1AVGI 4I3DA 1OBQA 4XMHA 2WUTA 1OEEA 3C77X 2AT0X 1DFVA 1ZNDA 4ZHGA 1KT6A 1X89A 2CBSA 1IKEA 4UU2A 3EMMA 3B2KA 1E02A 4XMCA 1ZNGA 1MVGA 5IO5A 1EUOA 1G74A 3P6DA 4YCEA 3FA9A 4BVMA 1JZUA 4YBPA 2F73A 3ZQ3A 4QZUA 1GM6A 4NYRA 1CBIA 3BX8A 4ZHCA 4GNYA 1BSYA 4K19A 1HBPA 5H9NA 3VG2A 2A2GA 2WQ9A 3CMPA 5B27A 3CBCA 3ZUOA 3RSWA 1JJJA 3VG6A 1T8VA 3NX1A 4ALOA 3O22A 2A3FX 1MUPA 4TKBA 5JR8A 3BX7A 4NYQA 1NP1A 5B29A 5IO7A 3FW4A 1ZNEA 5FFHA 4ZCBA 3BU9A 2Q9SA 2MJIA 2CBRA 2NNEA 3I17A 4LZUA 5HZ8A 1YUPA 2L9CA 2GJ5A 5BVSA 2AMMX 2QO5A 2W2AA 4GH7A 1DC9A 1SXXA 4IAXA 5F6ZA 2AH7X 4TQ2A 2G7BA 1XKIA 2ANSA 1YP6A 4TJZA 5D48A 1AQBA 1GT1A 2FTBA 1EPBA 1LICA 1KXOA 3Q6LA 4AZQA 4I9SA 5KICA 1VPRA 4IBAA 1JYJA 1RLBE 2LBAA 1YWDA 2AT6X 1EALA 1KT5A 3BDRA 4XMEA 1OPBA 2ASNX 1QY2A 2FWVA 4ZJ0A 3KQ0A 1GT5A 4ORXA 2P8GA 3P6CA 5HTEA 3APWA 5LJCA 4YGZA 2KTDA 1BM5A 3APXA 1MX8A 3EYCA 4NNTA 5HZ5A 1ZNKA 1G5WA 1TW4A 5EDCA 1DZPA 1DZKA 1S44A 2ACPX 5F7GA 4ORUA 2CM4A 4OS0A 5HBSA 4OMXA 4WFVA 1BRQA 5EDBA 3C76X 3DTQA 3FEKA 4HPDA 5L8IA 2WR6A 4I3BA 5F58A 1ML7A 3EM0A 1G7NA 4XMFA 2HMBA 4HPCA 2WQAE 3AKMA 3D96A 4OMWA 3HWEA 1O1VA 1BSOA 2O62A 3ZUIA 1PMPA 1D2UA 2QM9A 4TKHA 1RBPA 4Y0PA 4EDEA 1E00A 2WEWA 1DZMA 1HMRA 3BSZE 1EXSA 2JU3A 3FEPA 1PEEA 1FTPA 5HA1A 5LJHA 5IO6A 1YWAA 5D45A 4HFOA 3KZAA 1B0OA 4IB6A 4NP1A 1A18A 4RUNA 2RA6A 1PM1X 1SA8A 2MM3A 1YWCA 1S7DA 3VG5A 2R56A 3HWFA 2Q2MA 3TF6A 1U0XA 4YFPA 2AT8X 4OS3A 1AB0A 1FENA 2FS7A 4A60A 5LKEA 1KQWA 5H8TA 4QGVA 1X8OA 4YDBA 3P6HA 1O1UA 1I04A 1A2DA 3FR5A 1EPAA 1GXAA 2ALLX 4XMDA 3FR4A 2OVDA 5H9AA 5HAEA 3WXQA 4BOEA 5LJGA 1A57A 3U03A 2WWPA 2DM5A 3BRNA 5LKFA 1JJXA 1MDCA 4ZH6A 2FS6A 3IA8A 1ACDA 4OS8A 4YBUA 3NR3A 3CQNA 1P6PA 1QFVA 3FR2A 1QQSA 4YDAA 4RUUA 1SXWA 3NPOA 4GE1A 2KT4B 2ACOA 2FR3A 4IB9A 3U0DA 1FE3A 4TKJA 2OVAA 1ERBA 1IW2A 1LNMA 2OFMX 3F8AA 4QYPA 4Y0SA 2K23A 4QYNA 2N93A 5K06A 3MVFA 1EIOA 2G78A 1ALBA 2GTFX 1I05A 2XSTA 1O8VA 4AW8A 3HWDA 4WFUA 3P6EA 5EZ2A 1GT3A 3B2LA 1GGLA 2HZQA 3UEXA 1OEJA 4ORYA 3WJDA 3FA7A 1SY0A 3CR6A 5D4AA 1H91A 1LF7A 5H9LA 1TOUA 4M7MA 4ALBA 3O2YA 4NLJA 2IFBA 3FENA 4A1HA 4M6SA 4YKOA 3FELA 3FW5A 3K3LA 3PEDA 3KFHA 4N7DA 4LKTA 2WEXA 3WJEA 2EU7X 3VG4A 1TVQA 2Q4NA 4YGHA 2HZRA 3OJYC 3UEUA 1CRBA 2JU8A 1B4MA 3CQRA 3TGAA 1BWYA 2X46A 5EEDA 1DZJA 2RCTA 1FEMA 4KIIA 1BBPA 4HPAA 3FMZA 1TXLA 3WJGA 3TZSA 1KZXA 3EBKA 4IMOA
chains in the Genus database with same CATH superfamily
4JNJA 3VG3A 4I95A 2VFCA 2E4JA 2IZLB 1E5PA 5EEEA 4AZMA 4CPHB 5L8OA 3RDXA 1UZ2X 4DQ4A 1A3YA 1S2PA 1STSB 1JQPA 4EKVA 3ZZVA 5FAZA 1JBHA 5DPQA 1VWDB 4I6SA 3KFFA 4BX5A 3VG7A 1OEKA 4BQUA 1SWKA 2OVSA 2QO4A 5HTDA 3D97A 3RDOA 1KGLA 1YP7A 5FQ6E 3HOEA 1K3BA 4U46A 1LKEA 5LJKA 2LB6A 4NLIA 5KHPA 3WYQA 1SWPA 2X8TA 5IXGA 2RTEB 4COTA 3CBSA 1STRB 1B8EA 1GX8A 1KT7A 1U18A 4O3YA 5HZQA 4MISA 2RTPB 2HYSA 4YVBA 4ZGFA 3VHMA 4A1YA 1I06A 3WZQA 4ZHFA 3V8UA 4QGWA 4Z6JA 3FLLA 3FIDA 4GJVA 5AQ6A 1G85A 1RSTB 1IJ8A 2Z4IA 3Q34A 4O49A 3SLOA 2FT9A 2G8CO 3VPJE 3U0DA 1SXUA 2IZDB 2NNDA 2RN4A 1MX7A 2FLJA 2W2FA 4ORRA 3OE3A 1B56A 1LELA 2YMSA 4GU8A 1LIBA 4KH8A 2IZKA 1HMTA 1LIEA 3OBLA 2DJFA 4OEMA 1SRHA 3O19A 1QG5A 5HA0A 1FELA 4ZR2A 4C5PA 4AZOA 1L6MA 4U3QA 1BLRA 4ZH9A 3WJBA 1QY0A 1T0VA 2AT3X 1EW3A 3P24A 1SY2A 1ZNHA 1JYDA 2RTOB 1KZWA 2Q39A 1GKAB 2PY1A 2A2UA 3RDUA 1HXZA 1LUQA 2RTLA 4YCHA 5HCCC 3T6FA 1VWFB 3EBWA 1ICNA 4GNWA 4TLJA 4AZRA 1X8PA 1XCAA 1D3SA 2QOSC 3BLGA 1SWRA 4KT5A 3N91A 2WSJA 5LJDA 4Y0RA 4CK4A 2FRSA 1CBRA 4D6AA 3HOLA 3ZW1B 2JU7A 1HN2A 1SWJA 1BEBA 4O9SA 3JQOA 2X45A 1YIVA 4ZFXA 1QWDA 3CWKA 3GE2A 4GZVA 2AL0X 1OPAA 1KQXA 4N7CA 3WOVA 3S60A 2JOZA 2FR2A 2UYWA 1X71A 5KIDA 1SWBA 3T2XA 4U8UN 1CBQA 5D8JA 3STKA 4AZPA 5HCEC 3ZWEA 1Z24A 2IZBA 5H9KA 1KL5A 3UEWA 2QO6A 4Z2PA 4GKCA 1SRJA 5D47A 1IIUA 2GC9A 1BRPA 2IZGB 2LBVA 1QY1A 4HPBA 3D4RA 1UREA 4I9RA 1ERXA 1Y53X 4PSQA 4YGGA 2FKGA 1SWSA 2K62A 2OY8A 4JGLA 4FBRA 1PTSA 2NP1A 4EFGA 4MVKA 1FDQA 1DF3A 1LPJA 2CAMA 1SWHA 4HWMA 3H3IA 1HXLA 1SWEA 2IZJA 4QAEA 4BBOA 3PK2A 3P6FA 5LJEA 2OVEA 5L8NA 2A13A 2HNXA 1QABE 4IAWA 3WVMA 4EXZA 1SMPI 1VWHB 4UU3A 4DQ3A 2OY5O 4I3CA 2JN3A 2R73A 3BU1A 3JS1A 4QZTA 4Z28A 4BJ8A 2FKJA 5F6BA 4AYHA 1SWQA 5IRWA 4Y0QA 1LIDA 2RTAA 2Y3FA 1SY1A 3FA8A 5DG4A 4Z27A 4ZHHA 1TOWA 1Y0GA 1ZNLA 1KL4A 4CV7A 4LKPA 3F9DA 4MIRA 4ORSA 1HMSA 1LDQA 1GKAA 3MM0A 5HWZA 1R0UA 3RY2A 1BJ7A 1YWBA 2IZAA 4FBOA 2RCQA 2RTFB 5K68A 3RE5A 1VWQB 2KW1A 4LZVA 1VYFA 1NC9A 5HZ6A 1SRGA 2RQ0A 2Q2PA 1ICMA 3APUA 5CYBA 1SXYA 1WUBA 4IB7A 1SWAA 4CDCA 1VYGA 2IZFB 1HBQA 4WHIA 3SZHA 4GUZA 3NX2A 2L68A 1OBPA 3AEHA 1JIWI 3STMX 5FENA 3NQ3A 4R0BA 3UEVA 3I0AA 3ELXA 5JD2A 2R74A 4ZGUA 2POAA 3U9PC 3G7XA 4QGXA 3B2HA 3C78X 4YFQA 2X8SA 3BS2A 1LFOA 4GDAA 3B2IA 5HCDC 1GX9A 3FYFA 1GT4A 2LKKA 4BX7A 3DSZA 2G79A 2QOMA 3FDCA 1SWTA 3TGBA 3SAOA 5BVTA 1U17A 3WJFA 2MWHA 3T1DA 4GD9A 2CZUA 4YMYA 1HQPA 4NW4A 2JW1A 3KFGA 2Y3EA 3PPTA 5B2AO 2RTIB 3KFIA 4U8UM 4MVIA 2BS6A 5LJBA 3WYPA 1AELA 4KC8A 2RD7C 4IB8A 1VWGB 4WBKA 5AJCA 1CBSA 1T68X 2L5PA 3RZYA 3FIQA 4TNNA 3E3CA 1KT3A 2KTSA 3NQ9A 3WJCA 3ZI8A 1N9YA 2IZIA 2AT5X 1X8UA 1NQMA 2LFOA 2MO5A 1SLFB 3TGCA 1W4TA 5BVQA 3HWGA 1IFCA 3GAQA 1AVEA 3RDQA 4GDZA 2CZTA 4NNSA 3RBYA 4CDEA 1ADLA 1OBUA 3PQUA 5F1EA 4XMGA 1VWIB 2BLGA 4YH0A 1SWGA 1VWMB 1JJUA 4A8ZA 1VWPB 3B2JA 3PQSA 1SWFA 2G5LA 1N7YA 2MF6A 3PP6A 3BY0A 3SOTA 3ELZA 1DF8A 3VE2A 2OZQA 5AJBA 1X8NA 2CM9A 3VU1A 2FGSA 3ZW2A 1JV4A 2YG2A 1NDJA 1PBOA 2RTMA 2UZ2A 3IFBA 2PI3O 1HQQA 4JO6A 1SY3A 4Z2OA 1E06A 4AZNA 4ODDA 4L3RA 5HZ9A 1BSQA 1QFTA 1VWNB 1EIIA 2KD2A 2OFBA 3AKNA 4O4XA 1VYOA 2A0AA 4ARHA 1E2TA 2BT9A 2RTRB 3NP1A 3P6GA 4L1NA 4MVLA 3CKFA 1KT4A 1KOIA 1NQNA 1RXHA 2OYBO 3X00A 4BCSA 1LCVA 1PBYA 2GTLN 3MG5A 3FA6A 1LCZA 4OKAA 1JMZA 2DJGA 1LIFA 2X32A 2HLVA 4YKMA 4CDDA 2ZAGA 4GJSA 1I4UA 4ES7A 3SZIA 3PDFA 1NGLA 1RXJA 3APVA 1OSPO 1SRIA 3RY1A 3S26A 3PH6A 1STPA 1IFBA 3QKGA 1N0SA 1MK5A 1X8QA 4JHQA 2A8GA 5BYPA 2OL7A 3PECA 4D6BA 1GX3A 1EQDA 4IMNA 3L4RA 2NNQA 1HY2A 1ZRYA 2IZHB 4IABA 2VFBA 4YFRA 5K67A 2RTGB 1IKJA 4GGRA 1NP4A 1SWUA 5EPQA 1CJ5A 2XKLA 4ZHDA 1VWRB 3NADA 3WBGA 3HK1A 3MBTA 3D95A 2GTLO 3PH5A 4Z2VA 4KCAA 5C0NA 2OFRX 2W2BA 1N9MA 1SWOA 2LA7A 2IZCB 2QCBA 2AKQA 4GETA 4GGTA 4QNIA 3STNA 3JSQA 2L67A 3T2WA 4GRJA 5FQ8E 4EEJA 4CSBA 4ORWA 4O4OA 1AVGI 4I3DA 5CE4A 3VE1A 1OBQA 4XMHA 4O3XB 3LTWA 2WUTA 1OEEA 1RSUB 2RTBB 3C77X 2AT0X 1DFVA 1ZNDA 4ZHGA 1KT6A 1X89A 2RTCB 2CBSA 1IKEA 1MEPA 2Y32A 3EMMA 2A5BA 4UU2A 4CPHA 3B2KA 2M4LA 2OF8A 1E02A 3OD9A 4XMCA 1ZNGA 1MVGA 1UYNX 5IO5A 1EUOA 1G74A 3HPEA 1I78A 4BX5B 5AEOA 3P6DA 2OF9A 3FA9A 4YCEA 3MX7A 5IRUA 4BVMA 1JZUA 4YBPA 1SWLA 2F73A 4Y59A 4QZUA 2OY7A 3ZQ3A 1GM6A 1MM9A 4IMOA 1CBIA 3BX8A 4NYRA 4O4SA 4GNYA 3NBXX 1BSYA 4K19A 1HBPA 5H9NA 2BS5A 2RTHB 3VG2A 2A5CA 2X4MA 5B5FA 2RTDB 2I5ZO 3LV4A 2A2GA 2WQ9A 3CMPA 5B27A 4O3WA 3CBCA 3ZUOA 3RSWA 1JJJA 3VG6A 1T8VA 3NX1A 2RTJA 2BSZA 3O22A 2A3FX 1MUPA 4ALOA 4TKBA 5JR8A 3BX7A 4NYQA 3ZW1A 4CPFA 1AVDA 1NP1A 2WPUA 2X8FA 5B29A 5IO7A 3FW4A 1ZNEA 5FFHA 4ZCBA 3BU9A 2Q9SA 4MEEA 2BC3A 2MJIA 2CBRA 2NNEA 3EC5A 3I17A 4LZUA 5HZ8A 1YUPA 2L9CA 4CPIA 2GJ5A 5BVSA 2AMMX 2QO5A 2W2AA 4FQBB 4GH7A 4IRWA 1DC9A 1SXXA 4IAXA 4ZHCA 4U9CA 5F6ZA 2AH7X 4TQ2A 1SRFA 2G7BA 1XKIA 2X56A 2ANSA 1KL3A 2GTLM 1YP6A 4TJZA 4INNA 1RAVA 5IRAA 1RXKA 1Y9LA 2X55A 5D48A 3QQ2A 4OELA 5F2BA 1VWKB 1AQBA 1GT1A 2FTBA 3EW1A 2C4IA 5FQ7E 1EPBA 1LICA 1KXOA 2OL8O 3Q6LA 4AZQA 4I9SA 5KICA 1VPRA 4IBAA 1LDOA 1JYJA 1RLBE 2LBAA 1SWNA 1YWDA 2AT6X 1KT5A 1EALA 3BDRA 4XMEA 1NBXA 1OPBA 4KC7A 2ASNX 1W6FA 1QY2A 2FWVA 2RTNB 4ZJ0A 3KQ0A 1GT5A 4MVEA 2AF5A 4ORXA 2P8GA 3P6CA 3D9WA 3APWA 5HTEA 2C1QA 5LJCA 4YGZA 2KTDA 1BM5A 3APXA 1MX8A 3EYCA 4NNTA 3CKGA 2OY1O 5HZ5A 1ZNKA 3WZNA 3ZW0B 1G5WA 1TW4A 5EDCA 5CHKA 3EW2A 3S5VA 1DZPA 1DZKA 1S44A 2ACPX 1SLEB 5F7GA 4ORUA 2CM4A 4OS0A 5HBSA 2GH7A 4OMXA 4WFVA 1BRQA 5EDBA 3C76X 3DTQA 3FEKA 4HPDA 1VWCB 5L8IA 2WR6A 4I3BA 3RDMA 5F58A 1ML7A 3EM0A 1G7NA 4XMFA 1SLDB 2HMBA 4HPCA 2WQAE 3AKMA 3D96A 4O3ZA 4DCBA 2IZEB 3P02A 4OMWA 2JMBA 1MOYA 5B5GA 4B55A 3RKGA 3HWEA 4DNEA 3F6ZB 1O1VA 1BSOA 1I9HA 2O62A 2ZSCA 1PMPA 1D2UA 1SWDA 2QM9A 2RTKA 1RBPA 4TKHA 4Y0PA 4EDEA 1E00A 1Y52X 2WEWA 4QQ1A 1DZMA 1HMRA 3BSZE 1EXSA 1SREA 2F01A 2JU3A 3FEPA 2RTQB 1FTPA 1PEEA 5HA1A 5LJHA 5IO6A 1N4JA 1YWAA 5D45A 4CPEA 4HFOA 4ID2A 3VHIA 3KZAA 1B0OA 1VWAB 4IB6A 4NP1A 1A18A 1VWEB 4RUNA 2RA6A 1PM1X 1SA8A 2MM3A 2FHLA 4ON1A 1YWCA 1S7DA 3VG5A 2R56A 3HWFA 2Q2MA 3T6LA 3TF6A 4BX6B 1U0XA 4O4UA 1VWOB 2AT8X 4YFPA 4OS3A 1AB0A 1FENA 1FJ1E 2FS7A 3LHNA 2JGSA 3ZUIA 4A60A 5LKEA 1KQWA 5B10O 5H8TA 3RDSA 1X8OA 4QGVA 4YDBA 3P6HA 1O1UA 1I04A 1A2DA 3FR5A 4I60A 3SZJA 1EPAA 3VHHA 1GXAA 2ALLX 4XMDA 5L3YA 1DV9A 1UYOX 2ZAIA 3FR4A 2OVDA 5H9AA 5HAEA 1VWJB 3WXQA 4BOEA 5LJGA 1A57A 3U03A 4BGFA 2WWPA 1WBIA 2DM5A 3BRNA 5LKFA 1JJXA 1MDCA 4ZH6A 2FS6A 3IA8A 1ACDA 1Y55X 4OS8A 3SLJA 4YBUA 2HKDA 3NR3A 3CQNA 1P6PA 1QFVA 4BX7B 3FR2A 1QQSA 4LQZA 4YDAA 4QRLA 3ZW0A 4RUUA 1SXWA 2BHVA 3NPOA 4GE1A 2KT4B 2ACOA 2FR3A 1EI5A 3NQKA 1FE3A 4IB9A 2OVAA 2C1SA 4TKJA 3RE6A 1ERBA 1IW2A 1LNMA 2OFMX 3F8AA 4QYPA 4ML7B 4Y0SA 2K23A 4QYNA 5B11O 3KVNA 2N93A 5K06A 4U8UO 3MVFA 1EIOA 1KFFA 2AVIA 2G78A 1ALBA 2GTFX 1I05A 2F09A 2XSTA 1O8VA 4AW8A 3HWDA 4WFUA 2FHNX 2OL6O 1W5RA 1VWBB 2MHDA 3P6EA 5EZ2A 1GT3A 1K24A 3B2LA 1GGLA 2HZQA 1SLGB 3AUMO 1OEJA 3UEXA 4ORYA 3WJDA 3FA7A 2QMIA 1SY0A 3CR6A 5D4AA 1H91A 1LF7A 5H9LA 5B3MO 1TOUA 4M7MA 4ALBA 3O2YA 1SWCA 4NLJA 4NV8A 2IFBA 3FENA 4A1HA 3S5XA 2OFAA 4M6SA 4YKOA 2X34A 2I5VO 3FELA 4Y5DA 3FW5A 3K3LA 5CSEA 3WZOA 1JMXA 3PEDA 3KFHA 3WZPA 2Z4HA 3HTYA 4BX6A 1Y9TA 1VWLB 4N7DA 4LKTA 4EQAC 2WEXA 3WJEA 3UAQA 2EU7X 4GGZA 1TVQA 3VG4A 2Q4NA 4YGHA 2HZRA 4GK9A 4CDFA 3SLTA 3RWXA 3OJYC 4FGIB 3UEUA 1CRBA 2JU8A 4PJ2A 1B4MA 3CQRA 3TGAA 1BWYA 2X46A 5EEDA 1DZJA 2RCTA 1FEMA 4KIIA 1BBPA 3VGWA 4HPAA 3FMZA 1TXLA 3WJGA 1LCWA 3TZSA 2VDFA 1KZXA 4NV7A 1N43A 3EBKA 4FBVA
chains in the Genus database with same CATH topology
3VG3A 4I95A 4AZMA 2E4JA 5EEEA 1E5PA 5L8OA 1UZ2X 4DQ4A 1A3YA 1S2PA 3ZZVA 5FAZA 1JBHA 5DPQA 4I6SA 3KFFA 3VG7A 1OEKA 4BQUA 5HTDA 2OVSA 2QO4A 3D97A 1KGLA 1YP7A 5FQ6E 3HOEA 5LJKA 1LKEA 2LB6A 4NLIA 5KHPA 2X8TA 4COTA 3CBSA 1U18A 1B8EA 1GX8A 1KT7A 4O3YA 5HZQA 4ZGFA 4MISA 2HYSA 4A1YA 1I06A 4ZHFA 3V8UA 4QGWA 3FLLA 5AQ6A 1G85A 2Z4IA 4O49A 2FT9A 3VPJE 1SXUA 2NNDA 2RN4A 1MX7A 2FLJA 2W2FA 4ORRA 3OE3A 1B56A 2YMSA 4GU8A 1LIBA 4KH8A 1HMTA 1LIEA 3OBLA 5HA0A 3O19A 1QG5A 1FELA 4ZR2A 4AZOA 1L6MA 4U3QA 1BLRA 4ZH9A 3WJBA 1QY0A 1T0VA 2AT3X 1EW3A 3P24A 1SY2A 1ZNHA 1JYDA 1KZWA 2Q39A 1GKAB 2PY1A 2A2UA 4YCHA 5HCCC 3EBWA 1ICNA 4GNWA 4TLJA 4AZRA 1X8PA 1XCAA 1D3SA 2QOSC 3BLGA 4KT5A 3N91A 2WSJA 5LJDA 4Y0RA 4CK4A 2FRSA 1CBRA 4D6AA 3HOLA 3ZW1B 2JU7A 1HN2A 1BEBA 4O9SA 3JQOA 2X45A 1YIVA 4ZFXA 1QWDA 3CWKA 3GE2A 4GZVA 2AL0X 1OPAA 1KQXA 4N7CA 3WOVA 3S60A 2JOZA 2FR2A 5KIDA 1X71A 4U8UN 1CBQA 5D8JA 3STKA 4AZPA 5HCEC 3ZWEA 1Z24A 5H9KA 3UEWA 2QO6A 4GKCA 5D47A 1IIUA 2GC9A 1BRPA 2LBVA 1QY1A 4HPBA 3D4RA 1UREA 4I9RA 1ERXA 4PSQA 4YGGA 2K62A 4JGLA 4FBRA 2NP1A 4MVKA 1FDQA 1DF3A 1LPJA 4HWMA 3H3IA 4QAEA 3P6FA 5LJEA 2OVEA 5L8NA 2A13A 2HNXA 1QABE 4IAWA 3WVMA 4EXZA 1SMPI 4UU3A 4DQ3A 4I3CA 2JN3A 2R73A 3BU1A 3JS1A 4QZTA 5F6BA 4AYHA 4Y0QA 1LIDA 1SY1A 3FA8A 5DG4A 4ZHHA 1TOWA 1ZNLA 4CV7A 4LKPA 3F9DA 4MIRA 4ORSA 1HMSA 1GKAA 5HWZA 1R0UA 1BJ7A 1YWBA 4FBOA 2RCQA 2KW1A 4LZVA 1VYFA 5HZ6A 2RQ0A 2Q2PA 1ICMA 3APUA 5CYBA 1SXYA 4IB7A 1VYGA 4WHIA 1HBQA 3NX2A 2L68A 1OBPA 1JIWI 3STMX 5FENA 3NQ3A 4R0BA 3UEVA 3I0AA 3ELXA 2R74A 4ZGUA 2POAA 3U9PC 3G7XA 4QGXA 3B2HA 3C78X 4YFQA 2X8SA 3BS2A 1LFOA 3B2IA 5HCDC 1GX9A 3FYFA 1GT4A 2LKKA 3DSZA 2G79A 3TGBA 3SAOA 5BVTA 1U17A 3WJFA 2MWHA 3T1DA 2CZUA 4YMYA 1HQPA 4NW4A 2JW1A 3KFGA 3PPTA 3KFIA 4U8UM 4MVIA 2BS6A 5LJBA 1AELA 4KC8A 2RD7C 4IB8A 4WBKA 5AJCA 1CBSA 1T68X 2L5PA 3RZYA 3FIQA 4TNNA 3E3CA 1KT3A 2KTSA 3NQ9A 3WJCA 3ZI8A 4EFGA 1DV9A 2AT5X 1X8UA 2MO5A 2LFOA 3TGCA 5BVQA 3HWGA 1IFCA 3GAQA 4GDZA 2CZTA 4NNSA 3RBYA 1ADLA 1OBUA 3PQUA 5F1EA 4XMGA 2BLGA 4YH0A 4A8ZA 3PQSA 3B2JA 3PP6A 3BY0A 3SOTA 3ELZA 3VE2A 2OZQA 5AJBA 1X8NA 2CM9A 3VU1A 3ZW2A 1JV4A 2YG2A 1PBOA 3IFBA 1SY3A 5HZ9A 1E06A 4AZNA 4ODDA 4L3RA 1BSQA 1QFTA 1EIIA 2KD2A 3AKNA 4O4XA 2A0AA 4ARHA 2BT9A 3NP1A 3P6GA 4L1NA 4MVLA 1KT4A 1KOIA 2GTLN 3FA6A 1LIFA 2HLVA 4YKMA 4ES7A 2ZAGA 1I4UA 1NGLA 3APVA 3S26A 3PH6A 1IFBA 3QKGA 1N0SA 1X8QA 5BYPA 3PECA 4D6BA 1EQDA 4IMNA 3L4RA 2NNQA 1ZRYA 4IABA 4YFRA 5EPQA 1IKJA 1NP4A 1CJ5A 2XKLA 4ZHDA 3NADA 3WBGA 3HK1A 3MBTA 3D95A 2GTLO 3PH5A 4KCAA 5C0NA 2OFRX 2W2BA 3STNA 2LA7A 2AKQA 4GETA 4QNIA 3JSQA 2L67A 4GRJA 5FQ8E 4EEJA 4CSBA 4ORWA 4O4OA 1AVGI 4I3DA 5CE4A 3VE1A 1OBQA 4XMHA 4O3XB 2WUTA 1OEEA 3C77X 2AT0X 1DFVA 1ZNDA 4ZHGA 1KT6A 1X89A 2CBSA 1IKEA 4UU2A 3EMMA 3B2KA 2M4LA 1E02A 3OD9A 4XMCA 1ZNGA 1MVGA 5IO5A 1EUOA 1G74A 5AEOA 3P6DA 4YCEA 3FA9A 3MX7A 4BVMA 1JZUA 4YBPA 2F73A 3ZQ3A 4QZUA 1GM6A 4NYRA 4IMOA 1CBIA 3BX8A 4O4SA 4ZHCA 4GNYA 3NBXX 1BSYA 4K19A 1HBPA 5H9NA 2BS5A 3VG2A 3LV4A 2A2GA 2WQ9A 3CMPA 5B27A 4O3WA 3CBCA 3ZUOA 3RSWA 1JJJA 3VG6A 1T8VA 3NX1A 4ALOA 3O22A 2A3FX 1MUPA 4TKBA 5JR8A 3BX7A 4NYQA 3ZW1A 1NP1A 2X8FA 5B29A 5IO7A 3FW4A 1ZNEA 5FFHA 4ZCBA 3BU9A 2Q9SA 2MJIA 2CBRA 2NNEA 3I17A 4LZUA 5HZ8A 1YUPA 2L9CA 2GJ5A 5BVSA 2AMMX 2QO5A 2W2AA 4FQBB 4GH7A 1DC9A 1SXXA 4IAXA 4U9CA 5F6ZA 2AH7X 4TQ2A 2G7BA 1XKIA 2ANSA 2GTLM 1YP6A 4TJZA 4INNA 1Y9LA 5D48A 1AQBA 1GT1A 2FTBA 5FQ7E 1EPBA 1LICA 1KXOA 3Q6LA 4AZQA 4I9SA 5KICA 1VPRA 4IBAA 1JYJA 1RLBE 2LBAA 1YWDA 2AT6X 1EALA 1KT5A 3BDRA 4XMEA 1OPBA 4KC7A 2ASNX 1QY2A 2FWVA 4ZJ0A 3KQ0A 1GT5A 4MVEA 4ORXA 2P8GA 3P6CA 5HTEA 3APWA 5LJCA 4YGZA 2KTDA 1BM5A 3APXA 1MX8A 3EYCA 4NNTA 5HZ5A 1ZNKA 3ZW0B 1G5WA 1TW4A 5EDCA 3S5VA 1DZPA 1DZKA 1S44A 2ACPX 5F7GA 4ORUA 2CM4A 4OS0A 5HBSA 4OMXA 4WFVA 1BRQA 5EDBA 3C76X 3DTQA 3FEKA 4HPDA 5L8IA 2WR6A 4I3BA 5F58A 1ML7A 3EM0A 1G7NA 4XMFA 2HMBA 4HPCA 2WQAE 3AKMA 3D96A 4O3ZA 3P02A 4OMWA 2JMBA 3RKGA 3HWEA 3F6ZB 1O1VA 1BSOA 2O62A 3ZUIA 1PMPA 1D2UA 2QM9A 4TKHA 1RBPA 4Y0PA 4EDEA 1E00A 4QQ1A 2WEWA 1DZMA 1HMRA 3BSZE 1EXSA 2JU3A 3FEPA 1PEEA 1FTPA 5HA1A 5LJHA 5IO6A 1YWAA 5D45A 4HFOA 4ID2A 3KZAA 1B0OA 4IB6A 4NP1A 1A18A 4RUNA 2RA6A 1PM1X 1SA8A 2MM3A 4ON1A 1YWCA 1S7DA 3VG5A 2R56A 3HWFA 2Q2MA 3TF6A 1U0XA 4O4UA 2AT8X 4YFPA 4OS3A 1AB0A 1FENA 2FS7A 3LHNA 4A60A 5LKEA 1KQWA 5H8TA 4QGVA 1X8OA 4YDBA 3P6HA 1O1UA 1I04A 1A2DA 3FR5A 1EPAA 1GXAA 2ALLX 4XMDA 2ZAIA 3FR4A 2OVDA 5H9AA 5HAEA 3WXQA 4BOEA 5LJGA 1A57A 3U03A 2WWPA 2DM5A 3BRNA 5LKFA 1JJXA 1MDCA 4ZH6A 2FS6A 3IA8A 1ACDA 4OS8A 4YBUA 3NR3A 3CQNA 1P6PA 1QFVA 3FR2A 1QQSA 4LQZA 4YDAA 4QRLA 3ZW0A 4RUUA 1SXWA 2BHVA 3NPOA 4GE1A 2KT4B 2ACOA 2FR3A 1EI5A 3NQKA 1FE3A 4IB9A 2OVAA 4TKJA 3U0DA 1ERBA 1IW2A 1LNMA 2OFMX 3F8AA 4QYPA 4ML7B 4Y0SA 2K23A 4QYNA 2N93A 5K06A 4U8UO 3MVFA 1EIOA 2G78A 1ALBA 2GTFX 1I05A 2F09A 2XSTA 1O8VA 4AW8A 3HWDA 4WFUA 2MHDA 3P6EA 5EZ2A 1GT3A 3B2LA 1GGLA 2HZQA 3UEXA 1OEJA 4ORYA 3WJDA 3FA7A 2QMIA 1SY0A 3CR6A 5D4AA 1H91A 1LF7A 5H9LA 1TOUA 4M7MA 4ALBA 3O2YA 4NLJA 2IFBA 3FENA 4A1HA 3S5XA 4M6SA 4YKOA 3FELA 3FW5A 3K3LA 3PEDA 3KFHA 2Z4HA 3HTYA 1Y9TA 4N7DA 4EQAC 4LKTA 2WEXA 3WJEA 3UAQA 2EU7X 3VG4A 1TVQA 2Q4NA 4YGHA 2HZRA 4GK9A 3RWXA 3OJYC 4FGIB 3UEUA 1CRBA 2JU8A 4PJ2A 1B4MA 3CQRA 3TGAA 1BWYA 2X46A 5EEDA 1DZJA 2RCTA 1FEMA 4KIIA 1BBPA 4HPAA 3FMZA 1TXLA 3WJGA 3TZSA 1KZXA 3EBKA 4FBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VG3 A;  4AZM A;  2E4J A;  5EEE A;  1E5P A;  5L8O A;  1UZ2 X;  4DQ4 A;  1A3Y A;  1S2P A;  5FAZ A;  1JBH A;  5DPQ A;  3KFF A;  3VG7 A;  1OEK A;  4BQU A;  5HTD A;  2QO4 A;  3D97 A;  1KGL A;  1YP7 A;  5LJK A;  1LKE A;  2LB6 A;  4NLI A;  5KHP A;  3CBS A;  1U18 A;  1B8E A;  1GX8 A;  1KT7 A;  5HZQ A;  2HYS A;  4A1Y A;  1I06 A;  4ZHF A;  4QGW A;  3FLL A;  5AQ6 A;  1G85 A;  2FT9 A;  1SXU A;  2NND A;  1MX7 A;  2FLJ A;  2W2F A;  4ORR A;  1B56 A;  1LIB A;  1HMT A;  1LIE A;  5HA0 A;  3O19 A;  1QG5 A;  1FEL A;  4ZR2 A;  4AZO A;  1L6M A;  1BLR A;  4ZH9 A;  3WJB A;  1QY0 A;  1T0V A;  2AT3 X;  1EW3 A;  1SY2 A;  1ZNH A;  1JYD A;  1KZW A;  2Q39 A;  1GKA B;  2PY1 A;  2A2U A;  4YCH A;  5HCC C;  3EBW A;  1ICN A;  4GNW A;  4TLJ A;  4AZR A;  1X8P A;  1XCA A;  1D3S A;  2QOS C;  3BLG A;  5LJD A;  2WSJ A;  4Y0R A;  4CK4 A;  2FRS A;  1CBR A;  4D6A A;  2JU7 A;  1HN2 A;  1BEB A;  4O9S A;  2X45 A;  1YIV A;  4ZFX A;  1QWD A;  3CWK A;  2AL0 X;  1OPA A;  1KQX A;  4N7C A;  5KID A;  2JOZ A;  2FR2 A;  1X71 A;  3STK A;  1CBQ A;  5D8J A;  4AZP A;  5HCE C;  1Z24 A;  5H9K A;  3UEW A;  2QO6 A;  4GKC A;  5D47 A;  1IIU A;  2GC9 A;  1BRP A;  2LBV A;  1QY1 A;  4HPB A;  1URE A;  4I9R A;  1ERX A;  4PSQ A;  4YGG A;  2K62 A;  2NP1 A;  4MVK A;  1FDQ A;  1DF3 A;  1LPJ A;  4QAE A;  3P6F A;  5LJE A;  2OVE A;  5L8N A;  2A13 A;  2HNX A;  1QAB E;  4IAW A;  3WVM A;  4EXZ A;  4UU3 A;  4DQ3 A;  4I3C A;  2JN3 A;  2R73 A;  3BU1 A;  3JS1 A;  4QZT A;  5F6B A;  4AYH A;  4Y0Q A;  1LID A;  1SY1 A;  3FA8 A;  5DG4 A;  4ZHH A;  1TOW A;  1ZNL A;  4LKP A;  3F9D A;  4ORS A;  1HMS A;  1GKA A;  5HWZ A;  1R0U A;  1BJ7 A;  1YWB A;  2RCQ A;  4LZV A;  1VYF A;  5HZ6 A;  2RQ0 A;  2Q2P A;  1ICM A;  3APU A;  1SXY A;  4IB7 A;  1VYG A;  1HBQ A;  3NX2 A;  2L68 A;  1OBP A;  3STM X;  5FEN A;  3NQ3 A;  4R0B A;  3UEV A;  3I0A A;  3ELX A;  2R74 A;  4ZGU A;  2POA A;  3U9P C;  3G7X A;  4QGX A;  3B2H A;  3C78 X;  4YFQ A;  3BS2 A;  1LFO A;  3B2I A;  5HCD C;  1GX9 A;  1GT4 A;  2LKK A;  3DSZ A;  2G79 A;  3TGB A;  3SAO A;  5BVT A;  1U17 A;  3WJF A;  3T1D A;  2CZU A;  4YMY A;  1HQP A;  3KFG A;  3PPT A;  3KFI A;  4MVI A;  5LJB A;  1AEL A;  2RD7 C;  4IB8 A;  4WBK A;  1CBS A;  1T68 X;  2L5P A;  3RZY A;  3FIQ A;  4TNN A;  3NQ9 A;  1KT3 A;  3WJC A;  4EFG A;  1DV9 A;  2AT5 X;  1X8U A;  2MO5 A;  2LFO A;  3TGC A;  5BVQ A;  3HWG A;  1IFC A;  3GAQ A;  2CZT A;  4NNS A;  1ADL A;  1OBU A;  5F1E A;  4XMG A;  2BLG A;  4YH0 A;  4A8Z A;  3B2J A;  3PP6 A;  3BY0 A;  3ELZ A;  2OZQ A;  1X8N A;  2CM9 A;  1JV4 A;  2YG2 A;  1PBO A;  3IFB A;  1SY3 A;  5HZ9 A;  1E06 A;  4AZN A;  4ODD A;  1BSQ A;  1QFT A;  1EII A;  3AKN A;  2A0A A;  4ARH A;  3NP1 A;  3P6G A;  4MVL A;  1KT4 A;  1KOI A;  3FA6 A;  1LIF A;  2HLV A;  4YKM A;  4ES7 A;  1I4U A;  1NGL A;  3APV A;  3S26 A;  3PH6 A;  1IFB A;  3QKG A;  1N0S A;  1X8Q A;  3PEC A;  4D6B A;  1EQD A;  4IMN A;  3L4R A;  2NNQ A;  1ZRY A;  4YFR A;  5EPQ A;  1IKJ A;  1NP4 A;  1CJ5 A;  2XKL A;  4ZHD A;  3NAD A;  3WBG A;  3HK1 A;  3MBT A;  3D95 A;  3PH5 A;  5C0N A;  2OFR X;  2W2B A;  3STN A;  2AKQ A;  4GET A;  3JSQ A;  2L67 A;  4GRJ A;  4EEJ A;  4ORW A;  5CE4 A;  1AVG I;  4I3D A;  1OBQ A;  4XMH A;  2WUT A;  1OEE A;  3C77 X;  2AT0 X;  1DFV A;  1ZND A;  4ZHG A;  1KT6 A;  1X89 A;  2CBS A;  1IKE A;  4UU2 A;  3EMM A;  3B2K A;  1E02 A;  4XMC A;  1ZNG A;  1MVG A;  5IO5 A;  1EUO A;  1G74 A;  3P6D A;  4YCE A;  3FA9 A;  4BVM A;  1JZU A;  4YBP A;  2F73 A;  3ZQ3 A;  4QZU A;  1GM6 A;  4NYR A;  1CBI A;  3BX8 A;  4ZHC A;  4GNY A;  1BSY A;  4K19 A;  1HBP A;  5H9N A;  3VG2 A;  2A2G A;  2WQ9 A;  3CMP A;  5B27 A;  3CBC A;  3ZUO A;  3RSW A;  1JJJ A;  3VG6 A;  1T8V A;  3NX1 A;  4ALO A;  3O22 A;  2A3F X;  1MUP A;  4TKB A;  5JR8 A;  3BX7 A;  4NYQ A;  1NP1 A;  5B29 A;  5IO7 A;  3FW4 A;  1ZNE A;  5FFH A;  4ZCB A;  3BU9 A;  2Q9S A;  2MJI A;  2CBR A;  2NNE A;  3I17 A;  4LZU A;  5HZ8 A;  1YUP A;  2L9C A;  2GJ5 A;  5BVS A;  2AMM X;  2QO5 A;  2W2A A;  4GH7 A;  1DC9 A;  1SXX A;  4IAX A;  5F6Z A;  2AH7 X;  4TQ2 A;  2G7B A;  1XKI A;  2ANS A;  1YP6 A;  4TJZ A;  5D48 A;  1AQB A;  1GT1 A;  2FTB A;  1EPB A;  1LIC A;  1KXO A;  3Q6L A;  4AZQ A;  4I9S A;  5KIC A;  1VPR A;  4IBA A;  1JYJ A;  1RLB E;  2LBA A;  1YWD A;  2AT6 X;  1EAL A;  1KT5 A;  3BDR A;  4XME A;  1OPB A;  2ASN X;  1QY2 A;  2FWV A;  4ZJ0 A;  3KQ0 A;  1GT5 A;  4ORX A;  2P8G A;  3P6C A;  5HTE A;  3APW A;  5LJC A;  4YGZ A;  2KTD A;  1BM5 A;  3APX A;  1MX8 A;  3EYC A;  4NNT A;  5HZ5 A;  1ZNK A;  1G5W A;  1TW4 A;  5EDC A;  1DZP A;  1DZK A;  1S44 A;  2ACP X;  5F7G A;  4ORU A;  2CM4 A;  4OS0 A;  5HBS A;  4OMX A;  4WFV A;  1BRQ A;  5EDB A;  3C76 X;  3DTQ A;  3FEK A;  4HPD A;  5L8I A;  2WR6 A;  4I3B A;  5F58 A;  1ML7 A;  3EM0 A;  1G7N A;  4XMF A;  2HMB A;  4HPC A;  2WQA E;  3AKM A;  3D96 A;  4OMW A;  3HWE A;  1O1V A;  1BSO A;  2O62 A;  3ZUI A;  1PMP A;  1D2U A;  2QM9 A;  4TKH A;  1RBP A;  4Y0P A;  4EDE A;  1E00 A;  2WEW A;  1DZM A;  1HMR A;  3BSZ E;  1EXS A;  2JU3 A;  3FEP A;  1PEE A;  1FTP A;  5HA1 A;  5LJH A;  5IO6 A;  1YWA A;  5D45 A;  4HFO A;  3KZA A;  1B0O A;  4IB6 A;  4NP1 A;  1A18 A;  4RUN A;  2RA6 A;  1PM1 X;  1SA8 A;  2MM3 A;  1YWC A;  1S7D A;  3VG5 A;  2R56 A;  3HWF A;  2Q2M A;  3TF6 A;  1U0X A;  4YFP A;  2AT8 X;  4OS3 A;  1AB0 A;  1FEN A;  2FS7 A;  4A60 A;  5LKE A;  1KQW A;  5H8T A;  4QGV A;  1X8O A;  4YDB A;  3P6H A;  1O1U A;  1I04 A;  1A2D A;  3FR5 A;  1EPA A;  1GXA A;  2ALL X;  4XMD A;  3FR4 A;  2OVD A;  5H9A A;  5HAE A;  3WXQ A;  4BOE A;  5LJG A;  1A57 A;  3U03 A;  2WWP A;  2DM5 A;  3BRN A;  5LKF A;  1JJX A;  1MDC A;  4ZH6 A;  2FS6 A;  3IA8 A;  1ACD A;  4OS8 A;  4YBU A;  3NR3 A;  3CQN A;  1P6P A;  1QFV A;  3FR2 A;  1QQS A;  4YDA A;  4RUU A;  1SXW A;  3NPO A;  4GE1 A;  2KT4 B;  2ACO A;  2FR3 A;  4IB9 A;  3U0D A;  1FE3 A;  4TKJ A;  2OVA A;  1ERB A;  1IW2 A;  1LNM A;  2OFM X;  3F8A A;  4QYP A;  4Y0S A;  2K23 A;  4QYN A;  2N93 A;  5K06 A;  3MVF A;  1EIO A;  2G78 A;  1ALB A;  2GTF X;  1I05 A;  2XST A;  1O8V A;  4AW8 A;  3HWD A;  4WFU A;  3P6E A;  5EZ2 A;  1GT3 A;  3B2L A;  1GGL A;  2HZQ A;  3UEX A;  1OEJ A;  4ORY A;  3WJD A;  3FA7 A;  1SY0 A;  3CR6 A;  5D4A A;  1H91 A;  1LF7 A;  5H9L A;  1TOU A;  4M7M A;  4ALB A;  3O2Y A;  4NLJ A;  2IFB A;  3FEN A;  4A1H A;  4M6S A;  4YKO A;  3FEL A;  3FW5 A;  3K3L A;  3PED A;  3KFH A;  4N7D A;  4LKT A;  2WEX A;  3WJE A;  2EU7 X;  3VG4 A;  1TVQ A;  2Q4N A;  4YGH A;  2HZR A;  3OJY C;  3UEU A;  1CRB A;  2JU8 A;  1B4M A;  3CQR A;  3TGA A;  1BWY A;  2X46 A;  5EED A;  1DZJ A;  2RCT A;  1FEM A;  4KII A;  1BBP A;  4HPA A;  3FMZ A;  1TXL A;  3WJG A;  3TZS A;  1KZX A;  3EBK A;  4IMO A; 
#chains in the Genus database with same CATH topology
 4JNJ A;  3VG3 A;  4I95 A;  2VFC A;  2E4J A;  2IZL B;  1E5P A;  5EEE A;  4AZM A;  4CPH B;  5L8O A;  3RDX A;  1UZ2 X;  4DQ4 A;  1A3Y A;  1S2P A;  1STS B;  1JQP A;  4EKV A;  3ZZV A;  5FAZ A;  1JBH A;  5DPQ A;  1VWD B;  4I6S A;  3KFF A;  4BX5 A;  3VG7 A;  1OEK A;  4BQU A;  1SWK A;  2OVS A;  2QO4 A;  5HTD A;  3D97 A;  3RDO A;  1KGL A;  1YP7 A;  5FQ6 E;  3HOE A;  1K3B A;  4U46 A;  1LKE A;  5LJK A;  2LB6 A;  4NLI A;  5KHP A;  3WYQ A;  1SWP A;  2X8T A;  5IXG A;  2RTE B;  4COT A;  3CBS A;  1STR B;  1B8E A;  1GX8 A;  1KT7 A;  1U18 A;  4O3Y A;  5HZQ A;  4MIS A;  2RTP B;  2HYS A;  4YVB A;  4ZGF A;  3VHM A;  4A1Y A;  1I06 A;  3WZQ A;  4ZHF A;  3V8U A;  4QGW A;  4Z6J A;  3FLL A;  3FID A;  4GJV A;  5AQ6 A;  1G85 A;  1RST B;  1IJ8 A;  2Z4I A;  3Q34 A;  4O49 A;  3SLO A;  2FT9 A;  2G8C O;  3VPJ E;  3U0D A;  1SXU A;  2IZD B;  2NND A;  2RN4 A;  1MX7 A;  2FLJ A;  2W2F A;  4ORR A;  3OE3 A;  1B56 A;  1LEL A;  2YMS A;  4GU8 A;  1LIB A;  4KH8 A;  2IZK A;  1HMT A;  1LIE A;  3OBL A;  2DJF A;  4OEM A;  1SRH A;  3O19 A;  1QG5 A;  5HA0 A;  1FEL A;  4ZR2 A;  4C5P A;  4AZO A;  1L6M A;  4U3Q A;  1BLR A;  4ZH9 A;  3WJB A;  1QY0 A;  1T0V A;  2AT3 X;  1EW3 A;  3P24 A;  1SY2 A;  1ZNH A;  1JYD A;  2RTO B;  1KZW A;  2Q39 A;  1GKA B;  2PY1 A;  2A2U A;  3RDU A;  1HXZ A;  1LUQ A;  2RTL A;  4YCH A;  5HCC C;  3T6F A;  1VWF B;  3EBW A;  1ICN A;  4GNW A;  4TLJ A;  4AZR A;  1X8P A;  1XCA A;  1D3S A;  2QOS C;  3BLG A;  1SWR A;  4KT5 A;  3N91 A;  2WSJ A;  5LJD A;  4Y0R A;  4CK4 A;  2FRS A;  1CBR A;  4D6A A;  3HOL A;  3ZW1 B;  2JU7 A;  1HN2 A;  1SWJ A;  1BEB A;  4O9S A;  3JQO A;  2X45 A;  1YIV A;  4ZFX A;  1QWD A;  3CWK A;  3GE2 A;  4GZV A;  2AL0 X;  1OPA A;  1KQX A;  4N7C A;  3WOV A;  3S60 A;  2JOZ A;  2FR2 A;  2UYW A;  1X71 A;  5KID A;  1SWB A;  3T2X A;  4U8U N;  1CBQ A;  5D8J A;  3STK A;  4AZP A;  5HCE C;  3ZWE A;  1Z24 A;  2IZB A;  5H9K A;  1KL5 A;  3UEW A;  2QO6 A;  4Z2P A;  4GKC A;  1SRJ A;  5D47 A;  1IIU A;  2GC9 A;  1BRP A;  2IZG B;  2LBV A;  1QY1 A;  4HPB A;  3D4R A;  1URE A;  4I9R A;  1ERX A;  1Y53 X;  4PSQ A;  4YGG A;  2FKG A;  1SWS A;  2K62 A;  2OY8 A;  4JGL A;  4FBR A;  1PTS A;  2NP1 A;  4EFG A;  4MVK A;  1FDQ A;  1DF3 A;  1LPJ A;  2CAM A;  1SWH A;  4HWM A;  3H3I A;  1HXL A;  1SWE A;  2IZJ A;  4QAE A;  4BBO A;  3PK2 A;  3P6F A;  5LJE A;  2OVE A;  5L8N A;  2A13 A;  2HNX A;  1QAB E;  4IAW A;  3WVM A;  4EXZ A;  1SMP I;  1VWH B;  4UU3 A;  4DQ3 A;  2OY5 O;  4I3C A;  2JN3 A;  2R73 A;  3BU1 A;  3JS1 A;  4QZT A;  4Z28 A;  4BJ8 A;  2FKJ A;  5F6B A;  4AYH A;  1SWQ A;  5IRW A;  4Y0Q A;  1LID A;  2RTA A;  2Y3F A;  1SY1 A;  3FA8 A;  5DG4 A;  4Z27 A;  4ZHH A;  1TOW A;  1Y0G A;  1ZNL A;  1KL4 A;  4CV7 A;  4LKP A;  3F9D A;  4MIR A;  4ORS A;  1HMS A;  1LDQ A;  1GKA A;  3MM0 A;  5HWZ A;  1R0U A;  3RY2 A;  1BJ7 A;  1YWB A;  2IZA A;  4FBO A;  2RCQ A;  2RTF B;  5K68 A;  3RE5 A;  1VWQ B;  2KW1 A;  4LZV A;  1VYF A;  1NC9 A;  5HZ6 A;  1SRG A;  2RQ0 A;  2Q2P A;  1ICM A;  3APU A;  5CYB A;  1SXY A;  1WUB A;  4IB7 A;  1SWA A;  4CDC A;  1VYG A;  2IZF B;  1HBQ A;  4WHI A;  3SZH A;  4GUZ A;  3NX2 A;  2L68 A;  1OBP A;  3AEH A;  1JIW I;  3STM X;  5FEN A;  3NQ3 A;  4R0B A;  3UEV A;  3I0A A;  3ELX A;  5JD2 A;  2R74 A;  4ZGU A;  2POA A;  3U9P C;  3G7X A;  4QGX A;  3B2H A;  3C78 X;  4YFQ A;  2X8S A;  3BS2 A;  1LFO A;  4GDA A;  3B2I A;  5HCD C;  1GX9 A;  3FYF A;  1GT4 A;  2LKK A;  4BX7 A;  3DSZ A;  2G79 A;  2QOM A;  3FDC A;  1SWT A;  3TGB A;  3SAO A;  5BVT A;  1U17 A;  3WJF A;  2MWH A;  3T1D A;  4GD9 A;  2CZU A;  4YMY A;  1HQP A;  4NW4 A;  2JW1 A;  3KFG A;  2Y3E A;  3PPT A;  5B2A O;  2RTI B;  3KFI A;  4U8U M;  4MVI A;  2BS6 A;  5LJB A;  3WYP A;  1AEL A;  4KC8 A;  2RD7 C;  4IB8 A;  1VWG B;  4WBK A;  5AJC A;  1CBS A;  1T68 X;  2L5P A;  3RZY A;  3FIQ A;  4TNN A;  3E3C A;  1KT3 A;  2KTS A;  3NQ9 A;  3WJC A;  3ZI8 A;  1N9Y A;  2IZI A;  2AT5 X;  1X8U A;  1NQM A;  2LFO A;  2MO5 A;  1SLF B;  3TGC A;  1W4T A;  5BVQ A;  3HWG A;  1IFC A;  3GAQ A;  1AVE A;  3RDQ A;  4GDZ A;  2CZT A;  4NNS A;  3RBY A;  4CDE A;  1ADL A;  1OBU A;  3PQU A;  5F1E A;  4XMG A;  1VWI B;  2BLG A;  4YH0 A;  1SWG A;  1VWM B;  1JJU A;  4A8Z A;  1VWP B;  3B2J A;  3PQS A;  1SWF A;  2G5L A;  1N7Y A;  2MF6 A;  3PP6 A;  3BY0 A;  3SOT A;  3ELZ A;  1DF8 A;  3VE2 A;  2OZQ A;  5AJB A;  1X8N A;  2CM9 A;  3VU1 A;  2FGS A;  3ZW2 A;  1JV4 A;  2YG2 A;  1NDJ A;  1PBO A;  2RTM A;  2UZ2 A;  3IFB A;  2PI3 O;  1HQQ A;  4JO6 A;  1SY3 A;  4Z2O A;  1E06 A;  4AZN A;  4ODD A;  4L3R A;  5HZ9 A;  1BSQ A;  1QFT A;  1VWN B;  1EII A;  2KD2 A;  2OFB A;  3AKN A;  4O4X A;  1VYO A;  2A0A A;  4ARH A;  1E2T A;  2BT9 A;  2RTR B;  3NP1 A;  3P6G A;  4L1N A;  4MVL A;  3CKF A;  1KT4 A;  1KOI A;  1NQN A;  1RXH A;  2OYB O;  3X00 A;  4BCS A;  1LCV A;  1PBY A;  2GTL N;  3MG5 A;  3FA6 A;  1LCZ A;  4OKA A;  1JMZ A;  2DJG A;  1LIF A;  2X32 A;  2HLV A;  4YKM A;  4CDD A;  2ZAG A;  4GJS A;  1I4U A;  4ES7 A;  3SZI A;  3PDF A;  1NGL A;  1RXJ A;  3APV A;  1OSP O;  1SRI A;  3RY1 A;  3S26 A;  3PH6 A;  1STP A;  1IFB A;  3QKG A;  1N0S A;  1MK5 A;  1X8Q A;  4JHQ A;  2A8G A;  5BYP A;  2OL7 A;  3PEC A;  4D6B A;  1GX3 A;  1EQD A;  4IMN A;  3L4R A;  2NNQ A;  1HY2 A;  1ZRY A;  2IZH B;  4IAB A;  2VFB A;  4YFR A;  5K67 A;  2RTG B;  1IKJ A;  4GGR A;  1NP4 A;  1SWU A;  5EPQ A;  1CJ5 A;  2XKL A;  4ZHD A;  1VWR B;  3NAD A;  3WBG A;  3HK1 A;  3MBT A;  3D95 A;  2GTL O;  3PH5 A;  4Z2V A;  4KCA A;  5C0N A;  2OFR X;  2W2B A;  1N9M A;  1SWO A;  2LA7 A;  2IZC B;  2QCB A;  2AKQ A;  4GET A;  4GGT A;  4QNI A;  3STN A;  3JSQ A;  2L67 A;  3T2W A;  4GRJ A;  5FQ8 E;  4EEJ A;  4CSB A;  4ORW A;  4O4O A;  1AVG I;  4I3D A;  5CE4 A;  3VE1 A;  1OBQ A;  4XMH A;  4O3X B;  3LTW A;  2WUT A;  1OEE A;  1RSU B;  2RTB B;  3C77 X;  2AT0 X;  1DFV A;  1ZND A;  4ZHG A;  1KT6 A;  1X89 A;  2RTC B;  2CBS A;  1IKE A;  1MEP A;  2Y32 A;  3EMM A;  2A5B A;  4UU2 A;  4CPH A;  3B2K A;  2M4L A;  2OF8 A;  1E02 A;  3OD9 A;  4XMC A;  1ZNG A;  1MVG A;  1UYN X;  5IO5 A;  1EUO A;  1G74 A;  3HPE A;  1I78 A;  4BX5 B;  5AEO A;  3P6D A;  2OF9 A;  3FA9 A;  4YCE A;  3MX7 A;  5IRU A;  4BVM A;  1JZU A;  4YBP A;  1SWL A;  2F73 A;  4Y59 A;  4QZU A;  2OY7 A;  3ZQ3 A;  1GM6 A;  1MM9 A;  4IMO A;  1CBI A;  3BX8 A;  4NYR A;  4O4S A;  4GNY A;  3NBX X;  1BSY A;  4K19 A;  1HBP A;  5H9N A;  2BS5 A;  2RTH B;  3VG2 A;  2A5C A;  2X4M A;  5B5F A;  2RTD B;  2I5Z O;  3LV4 A;  2A2G A;  2WQ9 A;  3CMP A;  5B27 A;  4O3W A;  3CBC A;  3ZUO A;  3RSW A;  1JJJ A;  3VG6 A;  1T8V A;  3NX1 A;  2RTJ A;  2BSZ A;  3O22 A;  2A3F X;  1MUP A;  4ALO A;  4TKB A;  5JR8 A;  3BX7 A;  4NYQ A;  3ZW1 A;  4CPF A;  1AVD A;  1NP1 A;  2WPU A;  2X8F A;  5B29 A;  5IO7 A;  3FW4 A;  1ZNE A;  5FFH A;  4ZCB A;  3BU9 A;  2Q9S A;  4MEE A;  2BC3 A;  2MJI A;  2CBR A;  2NNE A;  3EC5 A;  3I17 A;  4LZU A;  5HZ8 A;  1YUP A;  2L9C A;  4CPI A;  2GJ5 A;  5BVS A;  2AMM X;  2QO5 A;  2W2A A;  4FQB B;  4GH7 A;  4IRW A;  1DC9 A;  1SXX A;  4IAX A;  4ZHC A;  4U9C A;  5F6Z A;  2AH7 X;  4TQ2 A;  1SRF A;  2G7B A;  1XKI A;  2X56 A;  2ANS A;  1KL3 A;  2GTL M;  1YP6 A;  4TJZ A;  4INN A;  1RAV A;  5IRA A;  1RXK A;  1Y9L A;  2X55 A;  5D48 A;  3QQ2 A;  4OEL A;  5F2B A;  1VWK B;  1AQB A;  1GT1 A;  2FTB A;  3EW1 A;  2C4I A;  5FQ7 E;  1EPB A;  1LIC A;  1KXO A;  2OL8 O;  3Q6L A;  4AZQ A;  4I9S A;  5KIC A;  1VPR A;  4IBA A;  1LDO A;  1JYJ A;  1RLB E;  2LBA A;  1SWN A;  1YWD A;  2AT6 X;  1KT5 A;  1EAL A;  3BDR A;  4XME A;  1NBX A;  1OPB A;  4KC7 A;  2ASN X;  1W6F A;  1QY2 A;  2FWV A;  2RTN B;  4ZJ0 A;  3KQ0 A;  1GT5 A;  4MVE A;  2AF5 A;  4ORX A;  2P8G A;  3P6C A;  3D9W A;  3APW A;  5HTE A;  2C1Q A;  5LJC A;  4YGZ A;  2KTD A;  1BM5 A;  3APX A;  1MX8 A;  3EYC A;  4NNT A;  3CKG A;  2OY1 O;  5HZ5 A;  1ZNK A;  3WZN A;  3ZW0 B;  1G5W A;  1TW4 A;  5EDC A;  5CHK A;  3EW2 A;  3S5V A;  1DZP A;  1DZK A;  1S44 A;  2ACP X;  1SLE B;  5F7G A;  4ORU A;  2CM4 A;  4OS0 A;  5HBS A;  2GH7 A;  4OMX A;  4WFV A;  1BRQ A;  5EDB A;  3C76 X;  3DTQ A;  3FEK A;  4HPD A;  1VWC B;  5L8I A;  2WR6 A;  4I3B A;  3RDM A;  5F58 A;  1ML7 A;  3EM0 A;  1G7N A;  4XMF A;  1SLD B;  2HMB A;  4HPC A;  2WQA E;  3AKM A;  3D96 A;  4O3Z A;  4DCB A;  2IZE B;  3P02 A;  4OMW A;  2JMB A;  1MOY A;  5B5G A;  4B55 A;  3RKG A;  3HWE A;  4DNE A;  3F6Z B;  1O1V A;  1BSO A;  1I9H A;  2O62 A;  2ZSC A;  1PMP A;  1D2U A;  1SWD A;  2QM9 A;  2RTK A;  1RBP A;  4TKH A;  4Y0P A;  4EDE A;  1E00 A;  1Y52 X;  2WEW A;  4QQ1 A;  1DZM A;  1HMR A;  3BSZ E;  1EXS A;  1SRE A;  2F01 A;  2JU3 A;  3FEP A;  2RTQ B;  1FTP A;  1PEE A;  5HA1 A;  5LJH A;  5IO6 A;  1N4J A;  1YWA A;  5D45 A;  4CPE A;  4HFO A;  4ID2 A;  3VHI A;  3KZA A;  1B0O A;  1VWA B;  4IB6 A;  4NP1 A;  1A18 A;  1VWE B;  4RUN A;  2RA6 A;  1PM1 X;  1SA8 A;  2MM3 A;  2FHL A;  4ON1 A;  1YWC A;  1S7D A;  3VG5 A;  2R56 A;  3HWF A;  2Q2M A;  3T6L A;  3TF6 A;  4BX6 B;  1U0X A;  4O4U A;  1VWO B;  2AT8 X;  4YFP A;  4OS3 A;  1AB0 A;  1FEN A;  1FJ1 E;  2FS7 A;  3LHN A;  2JGS A;  3ZUI A;  4A60 A;  5LKE A;  1KQW A;  5B10 O;  5H8T A;  3RDS A;  1X8O A;  4QGV A;  4YDB A;  3P6H A;  1O1U A;  1I04 A;  1A2D A;  3FR5 A;  4I60 A;  3SZJ A;  1EPA A;  3VHH A;  1GXA A;  2ALL X;  4XMD A;  5L3Y A;  1DV9 A;  1UYO X;  2ZAI A;  3FR4 A;  2OVD A;  5H9A A;  5HAE A;  1VWJ B;  3WXQ A;  4BOE A;  5LJG A;  1A57 A;  3U03 A;  4BGF A;  2WWP A;  1WBI A;  2DM5 A;  3BRN A;  5LKF A;  1JJX A;  1MDC A;  4ZH6 A;  2FS6 A;  3IA8 A;  1ACD A;  1Y55 X;  4OS8 A;  3SLJ A;  4YBU A;  2HKD A;  3NR3 A;  3CQN A;  1P6P A;  1QFV A;  4BX7 B;  3FR2 A;  1QQS A;  4LQZ A;  4YDA A;  4QRL A;  3ZW0 A;  4RUU A;  1SXW A;  2BHV A;  3NPO A;  4GE1 A;  2KT4 B;  2ACO A;  2FR3 A;  1EI5 A;  3NQK A;  1FE3 A;  4IB9 A;  2OVA A;  2C1S A;  4TKJ A;  3RE6 A;  1ERB A;  1IW2 A;  1LNM A;  2OFM X;  3F8A A;  4QYP A;  4ML7 B;  4Y0S A;  2K23 A;  4QYN A;  5B11 O;  3KVN A;  2N93 A;  5K06 A;  4U8U O;  3MVF A;  1EIO A;  1KFF A;  2AVI A;  2G78 A;  1ALB A;  2GTF X;  1I05 A;  2F09 A;  2XST A;  1O8V A;  4AW8 A;  3HWD A;  4WFU A;  2FHN X;  2OL6 O;  1W5R A;  1VWB B;  2MHD A;  3P6E A;  5EZ2 A;  1GT3 A;  1K24 A;  3B2L A;  1GGL A;  2HZQ A;  1SLG B;  3AUM O;  1OEJ A;  3UEX A;  4ORY A;  3WJD A;  3FA7 A;  2QMI A;  1SY0 A;  3CR6 A;  5D4A A;  1H91 A;  1LF7 A;  5H9L A;  5B3M O;  1TOU A;  4M7M A;  4ALB A;  3O2Y A;  1SWC A;  4NLJ A;  4NV8 A;  2IFB A;  3FEN A;  4A1H A;  3S5X A;  2OFA A;  4M6S A;  4YKO A;  2X34 A;  2I5V O;  3FEL A;  4Y5D A;  3FW5 A;  3K3L A;  5CSE A;  3WZO A;  1JMX A;  3PED A;  3KFH A;  3WZP A;  2Z4H A;  3HTY A;  4BX6 A;  1Y9T A;  1VWL B;  4N7D A;  4LKT A;  4EQA C;  2WEX A;  3WJE A;  3UAQ A;  2EU7 X;  4GGZ A;  1TVQ A;  3VG4 A;  2Q4N A;  4YGH A;  2HZR A;  4GK9 A;  4CDF A;  3SLT A;  3RWX A;  3OJY C;  4FGI B;  3UEU A;  1CRB A;  2JU8 A;  4PJ2 A;  1B4M A;  3CQR A;  3TGA A;  1BWY A;  2X46 A;  5EED A;  1DZJ A;  2RCT A;  1FEM A;  4KII A;  1BBP A;  3VGW A;  4HPA A;  3FMZ A;  1TXL A;  3WJG A;  1LCW A;  3TZS A;  2VDF A;  1KZX A;  4NV7 A;  1N43 A;  3EBK A;  4FBV A; 
#chains in the Genus database with same CATH homology
 3VG3 A;  4I95 A;  4AZM A;  2E4J A;  5EEE A;  1E5P A;  5L8O A;  1UZ2 X;  4DQ4 A;  1A3Y A;  1S2P A;  3ZZV A;  5FAZ A;  1JBH A;  5DPQ A;  4I6S A;  3KFF A;  3VG7 A;  1OEK A;  4BQU A;  5HTD A;  2OVS A;  2QO4 A;  3D97 A;  1KGL A;  1YP7 A;  5FQ6 E;  3HOE A;  5LJK A;  1LKE A;  2LB6 A;  4NLI A;  5KHP A;  2X8T A;  4COT A;  3CBS A;  1U18 A;  1B8E A;  1GX8 A;  1KT7 A;  4O3Y A;  5HZQ A;  4ZGF A;  4MIS A;  2HYS A;  4A1Y A;  1I06 A;  4ZHF A;  3V8U A;  4QGW A;  3FLL A;  5AQ6 A;  1G85 A;  2Z4I A;  4O49 A;  2FT9 A;  3VPJ E;  1SXU A;  2NND A;  2RN4 A;  1MX7 A;  2FLJ A;  2W2F A;  4ORR A;  3OE3 A;  1B56 A;  2YMS A;  4GU8 A;  1LIB A;  4KH8 A;  1HMT A;  1LIE A;  3OBL A;  5HA0 A;  3O19 A;  1QG5 A;  1FEL A;  4ZR2 A;  4AZO A;  1L6M A;  4U3Q A;  1BLR A;  4ZH9 A;  3WJB A;  1QY0 A;  1T0V A;  2AT3 X;  1EW3 A;  3P24 A;  1SY2 A;  1ZNH A;  1JYD A;  1KZW A;  2Q39 A;  1GKA B;  2PY1 A;  2A2U A;  4YCH A;  5HCC C;  3EBW A;  1ICN A;  4GNW A;  4TLJ A;  4AZR A;  1X8P A;  1XCA A;  1D3S A;  2QOS C;  3BLG A;  4KT5 A;  3N91 A;  2WSJ A;  5LJD A;  4Y0R A;  4CK4 A;  2FRS A;  1CBR A;  4D6A A;  3HOL A;  3ZW1 B;  2JU7 A;  1HN2 A;  1BEB A;  4O9S A;  3JQO A;  2X45 A;  1YIV A;  4ZFX A;  1QWD A;  3CWK A;  3GE2 A;  4GZV A;  2AL0 X;  1OPA A;  1KQX A;  4N7C A;  3WOV A;  3S60 A;  2JOZ A;  2FR2 A;  5KID A;  1X71 A;  4U8U N;  1CBQ A;  5D8J A;  3STK A;  4AZP A;  5HCE C;  3ZWE A;  1Z24 A;  5H9K A;  3UEW A;  2QO6 A;  4GKC A;  5D47 A;  1IIU A;  2GC9 A;  1BRP A;  2LBV A;  1QY1 A;  4HPB A;  3D4R A;  1URE A;  4I9R A;  1ERX A;  4PSQ A;  4YGG A;  2K62 A;  4JGL A;  4FBR A;  2NP1 A;  4MVK A;  1FDQ A;  1DF3 A;  1LPJ A;  4HWM A;  3H3I A;  4QAE A;  3P6F A;  5LJE A;  2OVE A;  5L8N A;  2A13 A;  2HNX A;  1QAB E;  4IAW A;  3WVM A;  4EXZ A;  1SMP I;  4UU3 A;  4DQ3 A;  4I3C A;  2JN3 A;  2R73 A;  3BU1 A;  3JS1 A;  4QZT A;  5F6B A;  4AYH A;  4Y0Q A;  1LID A;  1SY1 A;  3FA8 A;  5DG4 A;  4ZHH A;  1TOW A;  1ZNL A;  4CV7 A;  4LKP A;  3F9D A;  4MIR A;  4ORS A;  1HMS A;  1GKA A;  5HWZ A;  1R0U A;  1BJ7 A;  1YWB A;  4FBO A;  2RCQ A;  2KW1 A;  4LZV A;  1VYF A;  5HZ6 A;  2RQ0 A;  2Q2P A;  1ICM A;  3APU A;  5CYB A;  1SXY A;  4IB7 A;  1VYG A;  4WHI A;  1HBQ A;  3NX2 A;  2L68 A;  1OBP A;  1JIW I;  3STM X;  5FEN A;  3NQ3 A;  4R0B A;  3UEV A;  3I0A A;  3ELX A;  2R74 A;  4ZGU A;  2POA A;  3U9P C;  3G7X A;  4QGX A;  3B2H A;  3C78 X;  4YFQ A;  2X8S A;  3BS2 A;  1LFO A;  3B2I A;  5HCD C;  1GX9 A;  3FYF A;  1GT4 A;  2LKK A;  3DSZ A;  2G79 A;  3TGB A;  3SAO A;  5BVT A;  1U17 A;  3WJF A;  2MWH A;  3T1D A;  2CZU A;  4YMY A;  1HQP A;  4NW4 A;  2JW1 A;  3KFG A;  3PPT A;  3KFI A;  4U8U M;  4MVI A;  2BS6 A;  5LJB A;  1AEL A;  4KC8 A;  2RD7 C;  4IB8 A;  4WBK A;  5AJC A;  1CBS A;  1T68 X;  2L5P A;  3RZY A;  3FIQ A;  4TNN A;  3E3C A;  1KT3 A;  2KTS A;  3NQ9 A;  3WJC A;  3ZI8 A;  4EFG A;  1DV9 A;  2AT5 X;  1X8U A;  2MO5 A;  2LFO A;  3TGC A;  5BVQ A;  3HWG A;  1IFC A;  3GAQ A;  4GDZ A;  2CZT A;  4NNS A;  3RBY A;  1ADL A;  1OBU A;  3PQU A;  5F1E A;  4XMG A;  2BLG A;  4YH0 A;  4A8Z A;  3PQS A;  3B2J A;  3PP6 A;  3BY0 A;  3SOT A;  3ELZ A;  3VE2 A;  2OZQ A;  5AJB A;  1X8N A;  2CM9 A;  3VU1 A;  3ZW2 A;  1JV4 A;  2YG2 A;  1PBO A;  3IFB A;  1SY3 A;  5HZ9 A;  1E06 A;  4AZN A;  4ODD A;  4L3R A;  1BSQ A;  1QFT A;  1EII A;  2KD2 A;  3AKN A;  4O4X A;  2A0A A;  4ARH A;  2BT9 A;  3NP1 A;  3P6G A;  4L1N A;  4MVL A;  1KT4 A;  1KOI A;  2GTL N;  3FA6 A;  1LIF A;  2HLV A;  4YKM A;  4ES7 A;  2ZAG A;  1I4U A;  1NGL A;  3APV A;  3S26 A;  3PH6 A;  1IFB A;  3QKG A;  1N0S A;  1X8Q A;  5BYP A;  3PEC A;  4D6B A;  1EQD A;  4IMN A;  3L4R A;  2NNQ A;  1ZRY A;  4IAB A;  4YFR A;  5EPQ A;  1IKJ A;  1NP4 A;  1CJ5 A;  2XKL A;  4ZHD A;  3NAD A;  3WBG A;  3HK1 A;  3MBT A;  3D95 A;  2GTL O;  3PH5 A;  4KCA A;  5C0N A;  2OFR X;  2W2B A;  3STN A;  2LA7 A;  2AKQ A;  4GET A;  4QNI A;  3JSQ A;  2L67 A;  4GRJ A;  5FQ8 E;  4EEJ A;  4CSB A;  4ORW A;  4O4O A;  1AVG I;  4I3D A;  5CE4 A;  3VE1 A;  1OBQ A;  4XMH A;  4O3X B;  2WUT A;  1OEE A;  3C77 X;  2AT0 X;  1DFV A;  1ZND A;  4ZHG A;  1KT6 A;  1X89 A;  2CBS A;  1IKE A;  4UU2 A;  3EMM A;  3B2K A;  2M4L A;  1E02 A;  3OD9 A;  4XMC A;  1ZNG A;  1MVG A;  5IO5 A;  1EUO A;  1G74 A;  5AEO A;  3P6D A;  4YCE A;  3FA9 A;  3MX7 A;  4BVM A;  1JZU A;  4YBP A;  2F73 A;  3ZQ3 A;  4QZU A;  1GM6 A;  4NYR A;  4IMO A;  1CBI A;  3BX8 A;  4O4S A;  4ZHC A;  4GNY A;  3NBX X;  1BSY A;  4K19 A;  1HBP A;  5H9N A;  2BS5 A;  3VG2 A;  3LV4 A;  2A2G A;  2WQ9 A;  3CMP A;  5B27 A;  4O3W A;  3CBC A;  3ZUO A;  3RSW A;  1JJJ A;  3VG6 A;  1T8V A;  3NX1 A;  4ALO A;  3O22 A;  2A3F X;  1MUP A;  4TKB A;  5JR8 A;  3BX7 A;  4NYQ A;  3ZW1 A;  1NP1 A;  2X8F A;  5B29 A;  5IO7 A;  3FW4 A;  1ZNE A;  5FFH A;  4ZCB A;  3BU9 A;  2Q9S A;  2MJI A;  2CBR A;  2NNE A;  3I17 A;  4LZU A;  5HZ8 A;  1YUP A;  2L9C A;  2GJ5 A;  5BVS A;  2AMM X;  2QO5 A;  2W2A A;  4FQB B;  4GH7 A;  1DC9 A;  1SXX A;  4IAX A;  4U9C A;  5F6Z A;  2AH7 X;  4TQ2 A;  2G7B A;  1XKI A;  2ANS A;  2GTL M;  1YP6 A;  4TJZ A;  4INN A;  1Y9L A;  5D48 A;  1AQB A;  1GT1 A;  2FTB A;  5FQ7 E;  1EPB A;  1LIC A;  1KXO A;  3Q6L A;  4AZQ A;  4I9S A;  5KIC A;  1VPR A;  4IBA A;  1JYJ A;  1RLB E;  2LBA A;  1YWD A;  2AT6 X;  1EAL A;  1KT5 A;  3BDR A;  4XME A;  1OPB A;  4KC7 A;  2ASN X;  1QY2 A;  2FWV A;  4ZJ0 A;  3KQ0 A;  1GT5 A;  4MVE A;  4ORX A;  2P8G A;  3P6C A;  5HTE A;  3APW A;  5LJC A;  4YGZ A;  2KTD A;  1BM5 A;  3APX A;  1MX8 A;  3EYC A;  4NNT A;  5HZ5 A;  1ZNK A;  3ZW0 B;  1G5W A;  1TW4 A;  5EDC A;  3S5V A;  1DZP A;  1DZK A;  1S44 A;  2ACP X;  5F7G A;  4ORU A;  2CM4 A;  4OS0 A;  5HBS A;  4OMX A;  4WFV A;  1BRQ A;  5EDB A;  3C76 X;  3DTQ A;  3FEK A;  4HPD A;  5L8I A;  2WR6 A;  4I3B A;  5F58 A;  1ML7 A;  3EM0 A;  1G7N A;  4XMF A;  2HMB A;  4HPC A;  2WQA E;  3AKM A;  3D96 A;  4O3Z A;  3P02 A;  4OMW A;  2JMB A;  3RKG A;  3HWE A;  3F6Z B;  1O1V A;  1BSO A;  2O62 A;  3ZUI A;  1PMP A;  1D2U A;  2QM9 A;  4TKH A;  1RBP A;  4Y0P A;  4EDE A;  1E00 A;  4QQ1 A;  2WEW A;  1DZM A;  1HMR A;  3BSZ E;  1EXS A;  2JU3 A;  3FEP A;  1PEE A;  1FTP A;  5HA1 A;  5LJH A;  5IO6 A;  1YWA A;  5D45 A;  4HFO A;  4ID2 A;  3KZA A;  1B0O A;  4IB6 A;  4NP1 A;  1A18 A;  4RUN A;  2RA6 A;  1PM1 X;  1SA8 A;  2MM3 A;  4ON1 A;  1YWC A;  1S7D A;  3VG5 A;  2R56 A;  3HWF A;  2Q2M A;  3TF6 A;  1U0X A;  4O4U A;  2AT8 X;  4YFP A;  4OS3 A;  1AB0 A;  1FEN A;  2FS7 A;  3LHN A;  4A60 A;  5LKE A;  1KQW A;  5H8T A;  4QGV A;  1X8O A;  4YDB A;  3P6H A;  1O1U A;  1I04 A;  1A2D A;  3FR5 A;  1EPA A;  1GXA A;  2ALL X;  4XMD A;  2ZAI A;  3FR4 A;  2OVD A;  5H9A A;  5HAE A;  3WXQ A;  4BOE A;  5LJG A;  1A57 A;  3U03 A;  2WWP A;  2DM5 A;  3BRN A;  5LKF A;  1JJX A;  1MDC A;  4ZH6 A;  2FS6 A;  3IA8 A;  1ACD A;  4OS8 A;  4YBU A;  3NR3 A;  3CQN A;  1P6P A;  1QFV A;  3FR2 A;  1QQS A;  4LQZ A;  4YDA A;  4QRL A;  3ZW0 A;  4RUU A;  1SXW A;  2BHV A;  3NPO A;  4GE1 A;  2KT4 B;  2ACO A;  2FR3 A;  1EI5 A;  3NQK A;  1FE3 A;  4IB9 A;  2OVA A;  4TKJ A;  3U0D A;  1ERB A;  1IW2 A;  1LNM A;  2OFM X;  3F8A A;  4QYP A;  4ML7 B;  4Y0S A;  2K23 A;  4QYN A;  2N93 A;  5K06 A;  4U8U O;  3MVF A;  1EIO A;  2G78 A;  1ALB A;  2GTF X;  1I05 A;  2F09 A;  2XST A;  1O8V A;  4AW8 A;  3HWD A;  4WFU A;  2MHD A;  3P6E A;  5EZ2 A;  1GT3 A;  3B2L A;  1GGL A;  2HZQ A;  3UEX A;  1OEJ A;  4ORY A;  3WJD A;  3FA7 A;  2QMI A;  1SY0 A;  3CR6 A;  5D4A A;  1H91 A;  1LF7 A;  5H9L A;  1TOU A;  4M7M A;  4ALB A;  3O2Y A;  4NLJ A;  2IFB A;  3FEN A;  4A1H A;  3S5X A;  4M6S A;  4YKO A;  3FEL A;  3FW5 A;  3K3L A;  3PED A;  3KFH A;  2Z4H A;  3HTY A;  1Y9T A;  4N7D A;  4EQA C;  4LKT A;  2WEX A;  3WJE A;  3UAQ A;  2EU7 X;  3VG4 A;  1TVQ A;  2Q4N A;  4YGH A;  2HZR A;  4GK9 A;  3RWX A;  3OJY C;  4FGI B;  3UEU A;  1CRB A;  2JU8 A;  4PJ2 A;  1B4M A;  3CQR A;  3TGA A;  1BWY A;  2X46 A;  5EED A;  1DZJ A;  2RCT A;  1FEM A;  4KII A;  1BBP A;  4HPA A;  3FMZ A;  1TXL A;  3WJG A;  3TZS A;  1KZX A;  3EBK A;  4FBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...