3U1IA

Dengue virus protease covalently bound to a peptide
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
39
structure length
39
Chain Sequence
DLTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease subunit NS2B
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
total genus 1
structure length 39
sequence length 39
chains with identical sequence C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...