3UE8A

Kynurenine aminotransferase ii inhibitors
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
427
structure length
410
Chain Sequence
b'MNYARFITAASAARNPISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 129
structure length 410
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3ue8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3ue8A03
4XJPA 3PAAA 3WGBA 4J5UA 2CH2A 4ZWVA 1MLZA 4A0HA 4MQPA 5D95A 2CINA 1IX7A 3DXVA 4UHOA 3B1CA 3JZLA 4ZASA 2W8WA 4A0RA 1C7GA 1ASEA 1X29A 2W7GA 1C7OA 2R0TA 1ARGA 2DKBA 2PO3A 3KGWA 3WGCA 3WY7A 1ASAA 1WKGA 5HXXA 2YRRA 2AEUA 4AZKA 3ASBA 1VJOA 2CJHA 3BWNC 3E2YA 3EI9A 2YKXA 4WYFA 2C81A 2AEVA 5DB5A 2BI5A 1JS6A 5EIGA 1GEXA 1WYUA 2YKUA 3EIBA 4W1VA 4ATPA 5JAYA 2EZ1A 2VMXA 3DR7A 2FM1A 3F9TA 3FQ8A 1FG3A 1W7NA 1LW4A 3VP6A 2QB3A 2Z20A 3A9YA 2VIAA 3NDNA 2OKKA 1AMSA 3FZ6A 1W7LA 2R5EA 4M2MA 2R2NA 3UAKA 2FN6A 3NUBA 5EIGB 1QISA 4FFCA 2ZY2A 1PMMA 1AMAA 3EI8A 2ZY5A 2VMVA 5FT6A 1PMOA 1OXOA 4F5LA 1YJZA 3A9ZA 4Q76A 1AJSA 3USFA 1CQ6A 1ELQA 2C0RA 2W7IA 2GB3A 3BCBA 3LV2A 1TPLA 2BI1A 3JWAA 1N2TA 3AEMA 1KL2A 1BKGA 5EFSA 1X2AA 1AHYA 1B8GA 3FKDA 2Z9VA 3HDOA 1AJSB 1I41A 2FQ6A 2V1PA 2HUFA 2W7KA 3ISLA 1DJUA 3HQTA 3NX3A 3K7YA 2DKJA 3MAUA 1ASDA 1LKCA 1PFFA 3UWCA 3AELA 4B9BA 3HVYA 4QGRA 4WLJA 3M5UA 5G2QA 4IYOB 1RV4A 2OATA 5EAVA 1SZKA 2OGAA 3E77A 3T32A 2E7IA 2FNUA 4K2MA 3HLMA 4Y0DA 4LC3A 3FDDA 2VGUA 1J32A 2JJFA 2BIAA 4MKJA 2QB2A 2VMQA 4WXGA 1E5FA 1AMRA 3B46A 4IXOA 2GQNA 3PD6B 1DJ9A 1JG8A 1RVYA 2YRIA 3A2BA 3BWNA 1BJWA 1XEYA 3HMUA 4A6RA 5EUNA 5M4DA 3RQ1A 1B9IA 2YKVA 4Q6RA 2D66A 4MQQA 3HL2A 3K40A 3OKSA 3FVUA 3BS8A 1AKCA 3P1TA 1G4XA 2CY8A 1BS0A 4H51A 4A6UA 2Q7WA 4XJLA 3NYTA 4K2BA 2JISA 4CBSA 4P7YA 1GDEA 2DGLA 4XK1A 3PDBA 1O61A 2ZC0A 4PFNA 1ASBA 1D7UA 2BI2A 4XEWA 5LH9A 5HDMA 3FSLA 3R9AA 5D5SA 2EPJA 1AAMA 7AATA 1H1CA 2BI9A 2JG2A 1UU1A 3PGYA 1DJEA 4RM1A 1QGNA 4W1WA 5BJ3A 2VMTA 5EUDA 5G09A 2YCPA 4BMKA 3DYDA 3KE3A 2W7DA 1V2EA 2DR1A 3WCNA 3FZ7A 1SVVA 2HOYA 2WK7A 3PDBB 4R8DA 4ZLVA 2W7MA 3ASAA 3PDXA 4AOAA 4EB5A 4TN4A 2QMAA 1AMQA 1M0QA 2G6WA 2VLFA 4OBVA 1J04A 4CXQA 1D7VA 3LWSA 1AIAA 3RCHB 2JJEA 1ZOBA 1JS3A 5E4ZA 4RIZA 5M49A 2ZY4A 1EG5A 1KMKA 2AY1A 3II0A 1TOEA 4Y0HA 2DGMA 5AX8A 2VI9A 1GBNA 3ZRRA 2VMYA 4OTLA 1H0CA 1CZCA 1ARHA 2JJGA 3TFUA 4PVFA 4JE5A 1EJIA 2VMWA 2X5FA 3A9XA 3LVJA 9AATA 3DODA 4AO9A 4K2IA 1LC8A 4W1XA 1N31A 3L44A 3LY1A 2D63A 2X8UA 1M0NA 4BA5A 1D7SA 2F8JA 1WKHA 4MQRA 1FC4A 2BWNA 2W7LA 3VAXA 2BHXA 1AHFA 2AY8A 1IAXA 2Z9XA 3R4TA 3B1EA 4TV7A 2W7JA 2AY5A 3FDBA 4F5MA 2EGYA 3BWOA 1TOKA 4ZDPA 1M0OA 3DZZA 1BJ4A 1BQAA 2NMPA 3EI7A 2DGKA 4IW7A 2ZUKA 4JF1A 1LK9A 1Z3ZA 3KGXA 4WYEA 5F8VA 3LG0A 2O1BA 3FFRA 3COGA 5LHAA 2W8TA 1OHVA 1B9HA 1M32A 1AHEA 5K8BA 1DTYA 1YJYA 2O0RA 4Q31A 4OCAA 4AZJA 3NYUA 4L0OA 1YOOA 3EI5A 4OMAA 2HUIA 1TOJA 1QITA 2ZYJA 3NTJA 5I92A 4HVKA 2YHKA 1TARA 1V72A 3IHJA 2BYJA 1MLYA 1AX4A 1GC2A 2BKWA 4E3RA 5BJ4A 4DBCA 2Z9UA 4UHNA 4IXSA 4RJ0A 2WK9A 4ZM4A 1UU2A 4RKCA 1BJNA 2VMOA 3GSBA 5G4IA 3RUYA 1CQ8A 1OATA 3P6KA 4IYOA 5J8QA 2EH6A 1B5OA 2D61A 3MEBA 1B5PA 3DRDA 4GDYA 4UQVA 1D2FA 1S07A 2BIGA 3EUCA 3QI6A 1QJ3A 4OT8A 1RV3A 1GEYA 4GEBA 1I48A 3PPLA 5FT5A 3AEJC 1YAAA 1EQBA 4F5JA 3PD6A 3MKJA 4ISYA 3GWPA 1TASA 2XH1A 3DR4A 5IWQA 3GZCA 3JTXA 4U2HA 3PJ0A 1X0MA 3EZ1A 1IJIA 2OGEA 2E54A 1OHYA 2D65A 3BCAA 3VK2A 1V2FA 1WYTA 2WKAA 4JEYA 4XJOA 4ADBA 3WKSA 4ZSWA 1JF9A 1N8PA 3BC8A 2VMNA 2VMPA 2Z9WA 3AOWA 3CBFA 1TATA 3F6TA 4XAUA 1ASLA 2HOZA 1C0NA 1ORDA 2VLHA 3DXWA 1WYTB 3FVSA 1W7MA 1X28A 4R5FA 4GRXA 3RBLA 2BWPA 2PB0A 1UU0A 4GE4A 5FT4A 1CQ7A 1T3IA 1W23A 3JU7A 3CQ6A 1O62A 4JEVA 3WCOA 1MAQA 1GEWA 4LNJA 1IX6A 3BN1A 2BIEA 1ECXA 5E3KA 2C44A 1DGDA 1SZSA 3GETA 5EQCA 3VK3A 3RI6A 3RCHA 3E9KA 3LVLB 5DX5A 3NU7A 4P3MA 4MGRA 5FT8A 2VGZA 1AJRA 1GCKA 2VGWA 3H7FA 3NYSA 1AHGA 3I4JA 1LC7A 3LVKA 4EU1A 1MAPA 2W8UA 4A00A 1CZEA 1WSTA 2EZ2A 2CJDA 2W7FA 3F0HA 4LNLA 4UOYA 4BA4A 4BHDA 2CH1A 3NNKA 1S09A 1AY5A 2AY7A 3FRKA 3N5MA 2YCTA 2VGSA 1GC0A 2EO5A 1BW0A 5DJ1A 4ADDA 1ASNA 2CFBA 1I29A 2VYCA 4GE9A 3MADA 3GJUA 4IY7A 1AAWA 3N75A 2OQXA 3W1HA 4TMRA 3WX9A 4MKKA 3D6KA 3AEJA 3E6GA 2BI3A 1MDZA 2HZPA 1FG7A 3EZSA 3MC6C 4J8LA 2AY6A 5E5IA 3ZZKA 4DQ6A 3HT4A 2Z61A 3AEPA 3KKIA 1SF2A 4W5KA 3H14A 2ZSLA 1VEFA 1BQDA 3GBXA 4ZDLA 4WD2A 4LNMA 1SFFA 1VP4A 1O69A 2CSTA 5HHYA 3FQ7A 1LW5A 1LS3A 2QLRA 2VI8A 4WBTA 1YIYA 3ZRPA 2BYLA 1ARIA 5M46A 4N0WA 3WZFA 4JF0A 2HP1A 4KAMA 1CL1A 1S08A 4ATQA 4WP0A 4AO4A 4WXBA 2CTZA 1CJ0A 1AIBA 4RLGA 4A0FA 1WYVB 4KYOA 8AATA 1MDXA 1OXPA 4LW4A 1KKJA 1GC4A 2D64A 3FVXA 1ZC9A 3AENB 1MGVA 1G7XA 2O7CA 2W8JA 4B98A 2V0YA 4FL0A 2AATA 1DFOA 2R5CA 3HBXA 3N0LA 3CQ4A 2VMSA 3G8MA 3L8AA 1V2DA 2JGTA 3ELPA 4MY5A 1IUGA 1W3UA 3GZDC 2CANA 2CJGA 2OKJA 1CS1A 4F4EA 3AATA 4PIWA 1D7RA 3PIUA 2X3LA 2W7HA 3IF2A 4R5ZA 2GMSA 2R5CB 4GE7A 2GMUA 2W8VA 3ELEA 1TOGA 4BQ0A 3FD0A 1KKPA 2PB2A 2YKYA 3B8XA 4EFFA 2AY3A 2YCNA 2HORA 2ZP7A 1M0PA 4KXKA 3ZZJA 4PFFA 1DKAA 1GC3A 1AICA 4XJMA 1M4NA 4WYGA 2D7ZA 1QIRA 3FZ8A 4WYDA 5M4BA 2CB1A 1TOIA 3QHXA 5G2PA 4JEZA 3TATA 4JEXA 1WYUB 2WK8A 3OP7A 1S06A 2DOUA 3WLXA 4W91A 4EMYA 1O4SA 3JW9A 3RBFA 3DU4A 3MC6A 4OYTA 3E2FA 1OHWA 4RKDA 5EAAA 3VOMA 3W1IA 4NOGA 5C6UA 3NU8A 3PA9A 4CVQA 3CQ5A 3FQAA 2VMZA 4GSAA 4WXFA 3EI6A 4ADCA 4ADEA 1G4VA 2ZSMA 2RFVA 4F5FA 1Z7DA 3VK4A 2HUUA 1ZODA 3B1DA 2BWOA 5DJ9A 1SZUA 3ATHA 3AEOA 3MBBA 4JEWA 5F9SA 4ZAHA 1IX8A 3QGUA 4ZSYA 3QM2A 4EB7A 1AKBA 1E5EA 1KL1A 4WYCA 3BV0A 4HF8A 3G0TA 3I5TA 4E77A 1UKJA 3MAFA 4ZWMA 2QA3A 3E2ZA 4CXRA 1LC5A 2ZJGA 3WKRA 4W8IA 4WYAA 1ASCA 4ITXA 3A8UX 4IX8A 1I43A 2E7UA 3QN6A 1SPAA 2Z1ZA 3ECDA 2ZY3A 1P3WA 2Z67A 1ASFA 4RAEA 2VIBA 2VGTA 1ASGA 3BB8A 2XBNA 3GZDA 3MAFB 4A72A 1BJOA 3E2ZB 4M2JA 3DC1A 4UHMA 3FTBA 3G7QA 4M2KA 1KMJA 1AY4A 1PG8A 3UE8A 2D7YA 3NRAA 1C9CA 4E3QA 4ZM3A 3EIAA 2AY4A 2FNIA 4R2NA 4JE5D 2GSAA 1C7NA 2Z1YA 3I16A 1IBJA 2VMUA 4WB0A 5G4JA 3K28A 4F5HA 4OC9A 1BJOB 2VMRA 3TFTA 2AY2A 3QBOA 3QPGA 3ZRQA 4U1TA 4ITGA 4RJYA 1XI9A 1CL2A 2JJHA 1GD9A 5G0AA 4LW2A 2HOXA 4WB0B 2TPLA 4RITA 2FYFA 4WLHA 3FFHA 3JWBA 1AKAA 1BT4A 3Q8NA 3TQXA 5TF5A 1C4KA 1YJSA 1AY8A 4F5GA 1ARTA 1YNUA 4I8AA 4CBRA 1RVUA 4O6ZA 2E7JA 4AH3A 1QZ9A 4MSOA 4ZDOA 3NUIA 2VGVA 1B4XA 3TCMA 2ORDA 1IVRA 3AOVA 3GR9A 1YIZA 2QBTA 2YOBA 1Y4IA 1G7WA 1M6SA 1ELUA 3CAIA 4A0GA 2HP2A 1ARSA 1WYVA 5EUEA 1S0AA 2W7EA 4Y0IA 1U08A 1ASMA 1MDOA 3FCRA 3AEMC 1AHXA 4F5IA 1M7YA 3AENA 3ACZA 4A6TA 4IXZA 3AV7A 3W1JA 4F5KA 3LVMA 4DGTA 1QJ5A 1IAYA 2AY9A 3BCXA 2D5YA 4N0BA 4Q75A 4XQ2A 2X5DA 4E1OA 2C7TA 4OBUA 1DGEA
chains in the Genus database with same CATH superfamily
4XJPA 3PAAA 3WGBA 4J5UA 2CH2A 4ZWVA 1MLZA 4A0HA 4MQPA 5D95A 2CINA 1IX7A 3DXVA 4UHOA 3B1CA 3JZLA 4ZASA 2W8WA 4A0RA 1C7GA 1ASEA 1X29A 2W7GA 1C7OA 2R0TA 1ARGA 2DKBA 2PO3A 3KGWA 3WGCA 3WY7A 1ASAA 1WKGA 5HXXA 2YRRA 2AEUA 4AZKA 3ASBA 1VJOA 2CJHA 3BWNC 3E2YA 3EI9A 2YKXA 4WYFA 2C81A 2AEVA 5DB5A 2BI5A 1JS6A 5EIGA 1GEXA 1WYUA 2YKUA 3EIBA 4W1VA 4ATPA 5JAYA 2EZ1A 2VMXA 3DR7A 2FM1A 3F9TA 3FQ8A 1FG3A 1W7NA 1LW4A 3VP6A 2QB3A 2Z20A 3A9YA 2VIAA 3NDNA 2OKKA 1AMSA 2QSRA 3FZ6A 1W7LA 2R5EA 4M2MA 2R2NA 3UAKA 3N7NA 2FN6A 3NUBA 5EIGB 1QISA 4FFCA 2ZY2A 1PMMA 1AMAA 3EI8A 2ZY5A 2VMVA 5FT6A 1PMOA 1OXOA 4F5LA 1YJZA 3A9ZA 4Q76A 1AJSA 3USFA 1CQ6A 1ELQA 2C0RA 2W7IA 2GB3A 3BCBA 3LV2A 1TPLA 2BI1A 3JWAA 1N2TA 3AEMA 1KL2A 1BKGA 5EFSA 1X2AA 1AHYA 1B8GA 3FKDA 2Z9VA 3HDOA 1AJSB 1I41A 2FQ6A 2V1PA 2HUFA 2W7KA 3ISLA 1DJUA 3HQTA 3NX3A 3K7YA 2DKJA 3MAUA 2KFPA 1ASDA 1LKCA 1PFFA 3UWCA 3AELA 4B9BA 3HVYA 4QGRA 4WLJA 3M5UA 5G2QA 4IYOB 1RV4A 2OATA 5EAVA 1SZKA 2OGAA 3E77A 3T32A 2E7IA 2FNUA 4K2MA 3HLMA 4Y0DA 4LC3A 3FDDA 2VGUA 1J32A 2JJFA 2BIAA 4MKJA 2QB2A 2VMQA 4WXGA 1E5FA 1AMRA 3B46A 4IXOA 2GQNA 3PD6B 1DJ9A 1JG8A 1RVYA 2YRIA 3A2BA 3BWNA 1BJWA 1XEYA 3HMUA 4A6RA 5EUNA 5M4DA 3RQ1A 1B9IA 2YKVA 4Q6RA 2D66A 4MQQA 3HL2A 3K40A 3OKSA 3N4SA 3FVUA 3BS8A 1AKCA 3P1TA 1G4XA 2CY8A 1BS0A 4H51A 4A6UA 2Q7WA 4XJLA 3NYTA 4K2BA 2JISA 4CBSA 4P7YA 1GDEA 2DGLA 4XK1A 3PDBA 1O61A 2ZC0A 4PFNA 1ASBA 1D7UA 2BI2A 4XEWA 5LH9A 5HDMA 3FSLA 3R9AA 5D5SA 2EPJA 1AAMA 7AATA 1H1CA 2BI9A 2JG2A 1UU1A 3PGYA 1DJEA 4RM1A 1QGNA 4W1WA 5BJ3A 2VMTA 5EUDA 5G09A 2YCPA 4BMKA 3DYDA 3KE3A 2W7DA 1V2EA 2DR1A 3WCNA 3FZ7A 1SVVA 2HOYA 2WK7A 3PDBB 4R8DA 4ZLVA 2W7MA 3ASAA 3PDXA 4AOAA 4EB5A 4TN4A 2QMAA 1AMQA 1M0QA 2G6WA 2VLFA 4OBVA 1J04A 4CXQA 1D7VA 3LWSA 1AIAA 3RCHB 2JJEA 1ZOBA 1JS3A 5E4ZA 4RIZA 5M49A 2ZY4A 1EG5A 1KMKA 2AY1A 3II0A 1TOEA 4Y0HA 2DGMA 5AX8A 2VI9A 1GBNA 3ZRRA 4H63Q 2VMYA 4OTLA 1H0CA 1CZCA 1ARHA 2JJGA 3TFUA 4PVFA 4JE5A 1EJIA 2VMWA 2X5FA 3A9XA 3LVJA 9AATA 3DODA 4AO9A 4K2IA 1LC8A 4W1XA 1N31A 3L44A 3LY1A 2D63A 2X8UA 1M0NA 4BA5A 1D7SA 2F8JA 1WKHA 4MQRA 1FC4A 2BWNA 2W7LA 3VAXA 2BHXA 1AHFA 2AY8A 1IAXA 2Z9XA 3R4TA 3B1EA 4TV7A 2W7JA 2AY5A 3FDBA 4F5MA 2EGYA 3BWOA 1TOKA 4ZDPA 1M0OA 3DZZA 1BJ4A 1BQAA 2NMPA 3EI7A 2DGKA 4IW7A 2ZUKA 4JF1A 1LK9A 1Z3ZA 3KGXA 4WYEA 5F8VA 3LG0A 2O1BA 3FFRA 3COGA 5LHAA 2W8TA 1OHVA 1B9HA 1M32A 1AHEA 5K8BA 1DTYA 1YJYA 2O0RA 4Q31A 4OCAA 4AZJA 3NYUA 4L0OA 1YOOA 3EI5A 4OMAA 2G7JA 2HUIA 5KTBA 1TOJA 1QITA 2ZYJA 3NTJA 5I92A 4HVKA 2YHKA 1TARA 1V72A 3IHJA 2BYJA 1MLYA 1AX4A 1GC2A 2BKWA 4E3RA 5BJ4A 4DBCA 2Z9UA 4UHNA 4IXSA 4RJ0A 2WK9A 4ZM4A 1UU2A 4RKCA 1BJNA 2VMOA 3GSBA 5G4IA 3RUYA 1CQ8A 1OATA 3P6KA 4IYOA 5J8QA 2EH6A 1B5OA 2D61A 3MEBA 1B5PA 3DRDA 4GDYA 4UQVA 1D2FA 1S07A 2BIGA 3EUCA 3QI6A 1QJ3A 4OT8A 1RV3A 1GEYA 4GEBA 1I48A 3PPLA 5FT5A 3AEJC 1YAAA 1EQBA 4F5JA 3PD6A 3MKJA 4ISYA 3GWPA 1TASA 2XH1A 3DR4A 5IWQA 3GZCA 3JTXA 4U2HA 3PJ0A 1X0MA 3EZ1A 1IJIA 2OGEA 2E54A 1OHYA 2D65A 3BCAA 3VK2A 1V2FA 1WYTA 2WKAA 4JEYA 4XJOA 4ADBA 3WKSA 4ZSWA 1JF9A 1N8PA 3BC8A 2VMNA 2VMPA 2Z9WA 3AOWA 3CBFA 1TATA 3F6TA 4XAUA 1ASLA 2HOZA 1C0NA 1ORDA 2VLHA 3DXWA 1WYTB 3FVSA 1W7MA 1X28A 4R5FA 4GRXA 3RBLA 2BWPA 2PB0A 1UU0A 4GE4A 5FT4A 1CQ7A 1T3IA 1W23A 3JU7A 3CQ6A 1O62A 4JEVA 3WCOA 1MAQA 1GEWA 4LNJA 1IX6A 3BN1A 2BIEA 1ECXA 5E3KA 2C44A 1DGDA 1SZSA 3GETA 5EQCA 1KAFA 3VK3A 3RI6A 3RCHA 3E9KA 3LVLB 5DX5A 3NU7A 4P3MA 4MGRA 5FT8A 2VGZA 1AJRA 1GCKA 2VGWA 3H7FA 3NYSA 1AHGA 3I4JA 1LC7A 3LVKA 4EU1A 1MAPA 2W8UA 4A00A 1CZEA 1WSTA 2EZ2A 2CJDA 2W7FA 3F0HA 4LNLA 4UOYA 4BA4A 4BHDA 2CH1A 3NNKA 1S09A 1AY5A 2AY7A 3FRKA 3N5MA 2YCTA 2VGSA 1GC0A 2EO5A 1BW0A 5DJ1A 4ADDA 1ASNA 2CFBA 1I29A 2VYCA 4GE9A 3MADA 3GJUA 4IY7A 1AAWA 3N75A 2OQXA 3W1HA 4TMRA 3WX9A 4MKKA 3D6KA 3AEJA 3E6GA 2BI3A 1MDZA 2HZPA 1FG7A 3EZSA 3MC6C 4J8LA 2AY6A 5E5IA 3ZZKA 4DQ6A 3HT4A 2Z61A 3AEPA 3KKIA 1SF2A 4W5KA 3H14A 2ZSLA 1VEFA 1BQDA 3GBXA 4ZDLA 4WD2A 4LNMA 1SFFA 1VP4A 1O69A 2CSTA 5HHYA 3FQ7A 1LW5A 1LS3A 2QLRA 2VI8A 4WBTA 1YIYA 3ZRPA 2BYLA 1ARIA 5M46A 4N0WA 3WZFA 4JF0A 2HP1A 4KAMA 1CL1A 1S08A 4ATQA 4WP0A 4AO4A 4WXBA 2CTZA 1CJ0A 1AIBA 4RLGA 4A0FA 1WYVB 4KYOA 8AATA 1MDXA 3N4RA 1OXPA 4LW4A 1KKJA 1GC4A 2D64A 3FVXA 1ZC9A 3AENB 1MGVA 1G7XA 2O7CA 2W8JA 4B98A 2V0YA 4FL0A 2AATA 1DFOA 2R5CA 3HBXA 3N0LA 2EYQA 3CQ4A 2VMSA 3G8MA 3L8AA 1V2DA 2JGTA 3ELPA 4MY5A 1IUGA 1W3UA 3GZDC 2CANA 2CJGA 2OKJA 1CS1A 4F4EA 3AATA 4PIWA 1D7RA 3PIUA 2X3LA 2W7HA 3IF2A 4R5ZA 2GMSA 2R5CB 4GE7A 2GMUA 2W8VA 3ELEA 1TOGA 4BQ0A 3FD0A 1KKPA 2PB2A 2YKYA 3B8XA 4EFFA 2AY3A 2YCNA 2FKIA 2HORA 2ZP7A 1M0PA 4KXKA 3ZZJA 4PFFA 1DKAA 1GC3A 1AICA 4XJMA 1M4NA 4WYGA 2D7ZA 1QIRA 3FZ8A 4WYDA 5M4BA 2CB1A 1TOIA 3QHXA 5G2PA 4JEZA 3TATA 4JEXA 1WYUB 4K05A 2WK8A 3OP7A 1S06A 2DOUA 3WLXA 4W91A 4EMYA 1O4SA 3JW9A 3RBFA 3DU4A 3MC6A 4OYTA 3E2FA 1OHWA 4RKDA 5EAAA 3VOMA 3W1IA 4NOGA 5C6UA 3NU8A 3PA9A 4CVQA 3CQ5A 3FQAA 2VMZA 4GSAA 4WXFA 3EI6A 4ADCA 4ADEA 1G4VA 2ZSMA 2RFVA 4F5FA 1Z7DA 3VK4A 2HUUA 1ZODA 3B1DA 2BWOA 5DJ9A 1SZUA 3ATHA 3AEOA 3MBBA 4JEWA 5F9SA 4ZAHA 1IX8A 3QGUA 4ZSYA 3QM2A 4EB7A 1AKBA 1E5EA 1KL1A 4WYCA 3BV0A 4HF8A 3G0TA 3I5TA 4E77A 1UKJA 3MAFA 4ZWMA 2QA3A 3E2ZA 4CXRA 1LC5A 2ZJGA 3WKRA 4W8IA 4WYAA 1ASCA 4ITXA 3A8UX 4IX8A 1I43A 3H9XA 2E7UA 3QN6A 1SPAA 2Z1ZA 3ECDA 2ZY3A 1P3WA 2Z67A 1ASFA 4RAEA 2VIBA 2VGTA 1ASGA 3BB8A 2XBNA 3GZDA 3MAFB 4A72A 1BJOA 3E2ZB 2A1VA 4M2JA 3DC1A 4UHMA 3FTBA 3G7QA 4M2KA 1KMJA 1AY4A 1PG8A 3UE8A 2D7YA 3NRAA 1C9CA 4E3QA 4ZM3A 3EIAA 2AY4A 2FNIA 4R2NA 4JE5D 2GSAA 1C7NA 2Z1YA 3I16A 1IBJA 2VMUA 4WB0A 5G4JA 3K28A 4F5HA 4OC9A 1BJOB 2VMRA 3TFTA 2AY2A 3QBOA 3QPGA 3ZRQA 4U1TA 4ITGA 4RJYA 1XI9A 1CL2A 2JJHA 2WB6A 1GD9A 5G0AA 4LW2A 2HOXA 4WB0B 2TPLA 4RITA 2FYFA 4WLHA 3FFHA 3JWBA 1AKAA 1BT4A 3Q8NA 3TQXA 3N4XA 5TF5A 1C4KA 1YJSA 1AY8A 4F5GA 1ARTA 1YNUA 4I8AA 4CBRA 1RVUA 4O6ZA 2E7JA 4AH3A 1QZ9A 4MSOA 4ZDOA 3NUIA 2VGVA 1B4XA 3TCMA 2ORDA 1IVRA 3AOVA 3GR9A 1YIZA 2QBTA 2YOBA 1Y4IA 1G7WA 1M6SA 1ELUA 3CAIA 4A0GA 2HP2A 1ARSA 1WYVA 5EUEA 1S0AA 2W7EA 4Y0IA 1U08A 1ASMA 1MDOA 3FCRA 3AEMC 1AHXA 4F5IA 1M7YA 3AENA 3ACZA 4A6TA 4IXZA 3AV7A 3W1JA 4F5KA 3LVMA 4DGTA 1QJ5A 1IAYA 2AY9A 3BCXA 2D5YA 4N0BA 4Q75A 4XQ2A 2X5DA 4E1OA 2C7TA 4OBUA 1DGEA
chains in the Genus database with same CATH topology
4XJPA 3PAAA 3WGBA 4J5UA 2CH2A 4ZWVA 1MLZA 4A0HA 4MQPA 5D95A 2CINA 1IX7A 3DXVA 4UHOA 3B1CA 3JZLA 4ZASA 2W8WA 4A0RA 1C7GA 1ASEA 1X29A 2W7GA 1C7OA 2R0TA 1ARGA 2DKBA 2PO3A 3KGWA 3WGCA 3WY7A 1ASAA 1WKGA 5HXXA 2YRRA 2AEUA 4AZKA 3ASBA 1VJOA 2CJHA 3BWNC 3E2YA 3EI9A 2YKXA 4WYFA 2C81A 2AEVA 5DB5A 2BI5A 1JS6A 5EIGA 1GEXA 1WYUA 2YKUA 3EIBA 4W1VA 4ATPA 5JAYA 2EZ1A 2VMXA 3DR7A 2FM1A 3F9TA 3FQ8A 1FG3A 1W7NA 1LW4A 3VP6A 2QB3A 2Z20A 3A9YA 2VIAA 3NDNA 2OKKA 1AMSA 2QSRA 3FZ6A 1W7LA 2R5EA 4M2MA 2R2NA 3UAKA 3N7NA 2FN6A 3NUBA 5EIGB 1QISA 4FFCA 2ZY2A 1PMMA 1AMAA 3EI8A 2ZY5A 2VMVA 5FT6A 1PMOA 1OXOA 4F5LA 1YJZA 3A9ZA 4Q76A 1AJSA 3USFA 1CQ6A 1ELQA 2C0RA 2W7IA 2GB3A 3BCBA 3LV2A 1TPLA 2BI1A 3JWAA 1N2TA 3AEMA 1KL2A 1BKGA 5EFSA 1X2AA 1AHYA 1B8GA 3FKDA 2Z9VA 3HDOA 1AJSB 1I41A 2FQ6A 2V1PA 2HUFA 2W7KA 3ISLA 1DJUA 3HQTA 3NX3A 3K7YA 2DKJA 3MAUA 2KFPA 1ASDA 1LKCA 1PFFA 3UWCA 3AELA 4B9BA 3HVYA 4QGRA 4WLJA 3M5UA 5G2QA 4IYOB 1RV4A 2OATA 5EAVA 1SZKA 2OGAA 3E77A 3T32A 2E7IA 2FNUA 4K2MA 3HLMA 4Y0DA 4LC3A 3FDDA 2VGUA 1J32A 2JJFA 2BIAA 4MKJA 2QB2A 2VMQA 4WXGA 1E5FA 1AMRA 3B46A 4IXOA 2GQNA 3PD6B 1DJ9A 1JG8A 1RVYA 2YRIA 3A2BA 3BWNA 1BJWA 1XEYA 3HMUA 4A6RA 5EUNA 5M4DA 3RQ1A 1B9IA 2YKVA 4Q6RA 2D66A 4MQQA 3HL2A 3K40A 3OKSA 3N4SA 3FVUA 3BS8A 1AKCA 3P1TA 1G4XA 2CY8A 1BS0A 4H51A 4A6UA 2Q7WA 4XJLA 3NYTA 4K2BA 2JISA 4CBSA 4P7YA 1GDEA 2DGLA 4XK1A 3PDBA 1O61A 2ZC0A 4PFNA 1ASBA 1D7UA 2BI2A 4XEWA 5LH9A 5HDMA 3FSLA 3R9AA 5D5SA 2EPJA 1AAMA 7AATA 1H1CA 2BI9A 2JG2A 1UU1A 3PGYA 1DJEA 4RM1A 1QGNA 4W1WA 5BJ3A 2VMTA 5EUDA 5G09A 2YCPA 4BMKA 3DYDA 3KE3A 2W7DA 1V2EA 2DR1A 3WCNA 3FZ7A 1SVVA 2HOYA 2WK7A 3PDBB 4R8DA 4ZLVA 2W7MA 3ASAA 3PDXA 4AOAA 4EB5A 4TN4A 2QMAA 1AMQA 1M0QA 2G6WA 2VLFA 4OBVA 1J04A 4CXQA 1D7VA 3LWSA 1AIAA 3RCHB 2JJEA 1ZOBA 1JS3A 5E4ZA 4RIZA 5M49A 2ZY4A 1EG5A 1KMKA 2AY1A 3II0A 1TOEA 4Y0HA 2DGMA 5AX8A 2VI9A 1GBNA 3ZRRA 4H63Q 2VMYA 4OTLA 1H0CA 1CZCA 1ARHA 2JJGA 3TFUA 4PVFA 4JE5A 1EJIA 2VMWA 2X5FA 3A9XA 3LVJA 9AATA 3DODA 4AO9A 4K2IA 1LC8A 4W1XA 1N31A 3L44A 3LY1A 2D63A 2X8UA 1M0NA 4BA5A 1D7SA 2F8JA 1WKHA 4MQRA 1FC4A 2BWNA 2W7LA 3VAXA 2BHXA 1AHFA 2AY8A 1IAXA 2Z9XA 3R4TA 3B1EA 4TV7A 2W7JA 2AY5A 3FDBA 4F5MA 2EGYA 3BWOA 1TOKA 4ZDPA 1M0OA 3DZZA 1BJ4A 1BQAA 2NMPA 3EI7A 2DGKA 4IW7A 2ZUKA 4JF1A 1LK9A 1Z3ZA 3KGXA 4WYEA 5F8VA 3LG0A 2O1BA 3FFRA 3COGA 5LHAA 2W8TA 1OHVA 1B9HA 1M32A 1AHEA 5K8BA 1DTYA 1YJYA 2O0RA 4Q31A 4OCAA 4AZJA 3NYUA 4L0OA 1YOOA 3EI5A 4OMAA 2G7JA 2HUIA 5KTBA 1TOJA 1QITA 2ZYJA 3NTJA 5I92A 4HVKA 2YHKA 1TARA 1V72A 3IHJA 2BYJA 1MLYA 1AX4A 1GC2A 2BKWA 4E3RA 5BJ4A 4DBCA 2Z9UA 4UHNA 4IXSA 4RJ0A 2WK9A 4ZM4A 1UU2A 4RKCA 1BJNA 2VMOA 3GSBA 5G4IA 3RUYA 1CQ8A 1OATA 3P6KA 4IYOA 5J8QA 2EH6A 1B5OA 2D61A 3MEBA 1B5PA 3DRDA 4GDYA 4UQVA 1D2FA 1S07A 2BIGA 3EUCA 3QI6A 1QJ3A 4OT8A 1RV3A 1GEYA 4GEBA 1I48A 3PPLA 5FT5A 3AEJC 1YAAA 1EQBA 4F5JA 3PD6A 3MKJA 4ISYA 3GWPA 1TASA 2XH1A 3DR4A 5IWQA 3GZCA 3JTXA 4U2HA 3PJ0A 1X0MA 3EZ1A 1IJIA 2OGEA 2E54A 1OHYA 2D65A 3BCAA 3VK2A 1V2FA 1WYTA 2WKAA 4JEYA 4XJOA 4ADBA 3WKSA 4ZSWA 1JF9A 1N8PA 3BC8A 2VMNA 2VMPA 2Z9WA 3AOWA 3CBFA 1TATA 3F6TA 4XAUA 1ASLA 2HOZA 1C0NA 1ORDA 2VLHA 3DXWA 1WYTB 3FVSA 1W7MA 1X28A 4R5FA 4GRXA 3RBLA 2BWPA 2PB0A 1UU0A 4GE4A 5FT4A 1CQ7A 1T3IA 1W23A 3JU7A 3CQ6A 1O62A 4JEVA 3WCOA 1MAQA 1GEWA 4LNJA 1IX6A 3BN1A 2BIEA 1ECXA 5E3KA 2C44A 1DGDA 1SZSA 3GETA 5EQCA 3VK3A 3RI6A 3RCHA 3E9KA 3LVLB 5DX5A 3NU7A 4P3MA 4MGRA 5FT8A 2VGZA 1AJRA 1GCKA 2VGWA 3H7FA 3NYSA 1AHGA 3I4JA 1LC7A 3LVKA 4EU1A 1MAPA 2W8UA 4A00A 1CZEA 1WSTA 2EZ2A 2CJDA 2W7FA 3F0HA 4LNLA 4UOYA 4BA4A 4BHDA 2CH1A 3NNKA 1S09A 1AY5A 2AY7A 3FRKA 3N5MA 2YCTA 2VGSA 1GC0A 2EO5A 1BW0A 5DJ1A 4ADDA 1ASNA 2CFBA 1I29A 2VYCA 4GE9A 3MADA 3GJUA 4IY7A 1AAWA 3N75A 2OQXA 3W1HA 4TMRA 3WX9A 4MKKA 3D6KA 3AEJA 3E6GA 2BI3A 1MDZA 2HZPA 1FG7A 3EZSA 3MC6C 4J8LA 2AY6A 5E5IA 3ZZKA 4DQ6A 3HT4A 2Z61A 3AEPA 3KKIA 1SF2A 4W5KA 3H14A 2ZSLA 1VEFA 1BQDA 3GBXA 4ZDLA 4WD2A 4LNMA 1SFFA 1VP4A 1O69A 2CSTA 5HHYA 3FQ7A 1LW5A 1LS3A 2QLRA 2VI8A 4WBTA 1YIYA 3ZRPA 2BYLA 1ARIA 5M46A 4N0WA 3WZFA 4JF0A 2HP1A 4KAMA 1CL1A 1S08A 4ATQA 4WP0A 4AO4A 4WXBA 2CTZA 1CJ0A 1AIBA 4RLGA 4A0FA 1WYVB 4KYOA 8AATA 1MDXA 3N4RA 1OXPA 4LW4A 1KKJA 1GC4A 2D64A 3FVXA 1ZC9A 3AENB 1MGVA 1G7XA 2O7CA 2W8JA 4B98A 2V0YA 4FL0A 2AATA 1DFOA 2R5CA 3HBXA 3N0LA 2EYQA 3CQ4A 2VMSA 3G8MA 3L8AA 1V2DA 2JGTA 3ELPA 4MY5A 1IUGA 1W3UA 3GZDC 2CANA 2CJGA 2OKJA 1CS1A 4F4EA 3AATA 4PIWA 1D7RA 3PIUA 2X3LA 2W7HA 3IF2A 4R5ZA 2GMSA 2R5CB 4GE7A 2GMUA 2W8VA 3ELEA 1TOGA 4BQ0A 3FD0A 1KKPA 2PB2A 2YKYA 3B8XA 4EFFA 2AY3A 2YCNA 2FKIA 2HORA 2ZP7A 1M0PA 4KXKA 3ZZJA 4PFFA 1DKAA 1GC3A 1AICA 4XJMA 1M4NA 4WYGA 2D7ZA 1QIRA 3FZ8A 4WYDA 5M4BA 2CB1A 1TOIA 3QHXA 5G2PA 4JEZA 3TATA 4JEXA 1WYUB 4K05A 2WK8A 3OP7A 1S06A 2DOUA 3WLXA 4W91A 4EMYA 1O4SA 3JW9A 3RBFA 3DU4A 3MC6A 4OYTA 3E2FA 1OHWA 4RKDA 5EAAA 3VOMA 3W1IA 4NOGA 5C6UA 3NU8A 3PA9A 4CVQA 3CQ5A 3FQAA 2VMZA 4GSAA 4WXFA 3EI6A 4ADCA 4ADEA 1G4VA 2ZSMA 2RFVA 4F5FA 1Z7DA 3VK4A 2HUUA 1ZODA 3B1DA 2BWOA 5DJ9A 1SZUA 3ATHA 3AEOA 3MBBA 4JEWA 5F9SA 4ZAHA 1IX8A 3QGUA 4ZSYA 3QM2A 4EB7A 1AKBA 1E5EA 1KL1A 4WYCA 3BV0A 4HF8A 3G0TA 3I5TA 4E77A 1UKJA 3MAFA 4ZWMA 2QA3A 3E2ZA 4CXRA 1LC5A 2ZJGA 3WKRA 4W8IA 4WYAA 1ASCA 4ITXA 3A8UX 4IX8A 1I43A 3H9XA 2E7UA 3QN6A 1SPAA 2Z1ZA 3ECDA 2ZY3A 1P3WA 2Z67A 1ASFA 4RAEA 2VIBA 2VGTA 1ASGA 3BB8A 2XBNA 3GZDA 3MAFB 4A72A 1BJOA 3E2ZB 2A1VA 4M2JA 3DC1A 4UHMA 3FTBA 3G7QA 4M2KA 1KMJA 1AY4A 1PG8A 3UE8A 2D7YA 3NRAA 1C9CA 4E3QA 4ZM3A 3EIAA 2AY4A 2FNIA 4R2NA 4JE5D 2GSAA 1C7NA 2Z1YA 3I16A 1IBJA 2VMUA 4WB0A 5G4JA 3K28A 4F5HA 4OC9A 1BJOB 2VMRA 3TFTA 2AY2A 3QBOA 3QPGA 3ZRQA 4U1TA 4ITGA 4RJYA 1XI9A 1CL2A 2JJHA 2WB6A 1GD9A 5G0AA 4LW2A 2HOXA 4WB0B 2TPLA 4RITA 2FYFA 4WLHA 3FFHA 3JWBA 1AKAA 1BT4A 3Q8NA 3TQXA 3N4XA 5TF5A 1C4KA 1YJSA 1AY8A 4F5GA 1ARTA 1YNUA 4I8AA 4CBRA 1RVUA 4O6ZA 2E7JA 4AH3A 1QZ9A 4MSOA 4ZDOA 3NUIA 2VGVA 1B4XA 3TCMA 2ORDA 1IVRA 3AOVA 3GR9A 1YIZA 2QBTA 2YOBA 1Y4IA 1G7WA 1M6SA 1ELUA 3CAIA 4A0GA 2HP2A 1ARSA 1WYVA 5EUEA 1S0AA 2W7EA 4Y0IA 1U08A 1ASMA 1MDOA 3FCRA 3AEMC 1AHXA 4F5IA 1M7YA 3AENA 3ACZA 4A6TA 4IXZA 3AV7A 3W1JA 4F5KA 3LVMA 4DGTA 1QJ5A 1IAYA 2AY9A 3BCXA 2D5YA 4N0BA 4Q75A 4XQ2A 2X5DA 4E1OA 2C7TA 4OBUA 1DGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJP A;  3PAA A;  3WGB A;  4J5U A;  2CH2 A;  4ZWV A;  1MLZ A;  4A0H A;  4MQP A;  5D95 A;  2CIN A;  1IX7 A;  3DXV A;  4UHO A;  3B1C A;  3JZL A;  4ZAS A;  2W8W A;  4A0R A;  1C7G A;  1ASE A;  1X29 A;  2W7G A;  1C7O A;  2R0T A;  1ARG A;  2DKB A;  2PO3 A;  3KGW A;  3WGC A;  3WY7 A;  1ASA A;  1WKG A;  5HXX A;  2YRR A;  2AEU A;  4AZK A;  3ASB A;  1VJO A;  2CJH A;  3BWN C;  3E2Y A;  3EI9 A;  2YKX A;  4WYF A;  2C81 A;  2AEV A;  5DB5 A;  2BI5 A;  1JS6 A;  5EIG A;  1GEX A;  1WYU A;  2YKU A;  3EIB A;  4W1V A;  4ATP A;  5JAY A;  2EZ1 A;  2VMX A;  3DR7 A;  2FM1 A;  3F9T A;  3FQ8 A;  1FG3 A;  1W7N A;  1LW4 A;  3VP6 A;  2QB3 A;  2Z20 A;  3A9Y A;  2VIA A;  3NDN A;  2OKK A;  1AMS A;  3FZ6 A;  1W7L A;  2R5E A;  4M2M A;  2R2N A;  3UAK A;  2FN6 A;  3NUB A;  5EIG B;  1QIS A;  4FFC A;  2ZY2 A;  1PMM A;  1AMA A;  3EI8 A;  2ZY5 A;  2VMV A;  5FT6 A;  1PMO A;  1OXO A;  4F5L A;  1YJZ A;  3A9Z A;  4Q76 A;  1AJS A;  3USF A;  1CQ6 A;  1ELQ A;  2C0R A;  2W7I A;  2GB3 A;  3BCB A;  3LV2 A;  1TPL A;  2BI1 A;  3JWA A;  1N2T A;  3AEM A;  1KL2 A;  1BKG A;  5EFS A;  1X2A A;  1AHY A;  1B8G A;  3FKD A;  2Z9V A;  3HDO A;  1AJS B;  1I41 A;  2FQ6 A;  2V1P A;  2HUF A;  2W7K A;  3ISL A;  1DJU A;  3HQT A;  3NX3 A;  3K7Y A;  2DKJ A;  3MAU A;  1ASD A;  1LKC A;  1PFF A;  3UWC A;  3AEL A;  4B9B A;  3HVY A;  4QGR A;  4WLJ A;  3M5U A;  5G2Q A;  4IYO B;  1RV4 A;  2OAT A;  5EAV A;  1SZK A;  2OGA A;  3E77 A;  3T32 A;  2E7I A;  2FNU A;  4K2M A;  3HLM A;  4Y0D A;  4LC3 A;  3FDD A;  2VGU A;  1J32 A;  2JJF A;  2BIA A;  4MKJ A;  2QB2 A;  2VMQ A;  4WXG A;  1E5F A;  1AMR A;  3B46 A;  4IXO A;  2GQN A;  3PD6 B;  1DJ9 A;  1JG8 A;  1RVY A;  2YRI A;  3A2B A;  3BWN A;  1BJW A;  1XEY A;  3HMU A;  4A6R A;  5EUN A;  5M4D A;  3RQ1 A;  1B9I A;  2YKV A;  4Q6R A;  2D66 A;  4MQQ A;  3HL2 A;  3K40 A;  3OKS A;  3FVU A;  3BS8 A;  1AKC A;  3P1T A;  1G4X A;  2CY8 A;  1BS0 A;  4H51 A;  4A6U A;  2Q7W A;  4XJL A;  3NYT A;  4K2B A;  2JIS A;  4CBS A;  4P7Y A;  1GDE A;  2DGL A;  4XK1 A;  3PDB A;  1O61 A;  2ZC0 A;  4PFN A;  1ASB A;  1D7U A;  2BI2 A;  4XEW A;  5LH9 A;  5HDM A;  3FSL A;  3R9A A;  5D5S A;  2EPJ A;  1AAM A;  7AAT A;  1H1C A;  2BI9 A;  2JG2 A;  1UU1 A;  3PGY A;  1DJE A;  4RM1 A;  1QGN A;  4W1W A;  5BJ3 A;  2VMT A;  5EUD A;  5G09 A;  2YCP A;  4BMK A;  3DYD A;  3KE3 A;  2W7D A;  1V2E A;  2DR1 A;  3WCN A;  3FZ7 A;  1SVV A;  2HOY A;  2WK7 A;  3PDB B;  4R8D A;  4ZLV A;  2W7M A;  3ASA A;  3PDX A;  4AOA A;  4EB5 A;  4TN4 A;  2QMA A;  1AMQ A;  1M0Q A;  2G6W A;  2VLF A;  4OBV A;  1J04 A;  4CXQ A;  1D7V A;  3LWS A;  1AIA A;  3RCH B;  2JJE A;  1ZOB A;  1JS3 A;  5E4Z A;  4RIZ A;  5M49 A;  2ZY4 A;  1EG5 A;  1KMK A;  2AY1 A;  3II0 A;  1TOE A;  4Y0H A;  2DGM A;  5AX8 A;  2VI9 A;  1GBN A;  3ZRR A;  2VMY A;  4OTL A;  1H0C A;  1CZC A;  1ARH A;  2JJG A;  3TFU A;  4PVF A;  4JE5 A;  1EJI A;  2VMW A;  2X5F A;  3A9X A;  3LVJ A;  9AAT A;  3DOD A;  4AO9 A;  4K2I A;  1LC8 A;  4W1X A;  1N31 A;  3L44 A;  3LY1 A;  2D63 A;  2X8U A;  1M0N A;  4BA5 A;  1D7S A;  2F8J A;  1WKH A;  4MQR A;  1FC4 A;  2BWN A;  2W7L A;  3VAX A;  2BHX A;  1AHF A;  2AY8 A;  1IAX A;  2Z9X A;  3R4T A;  3B1E A;  4TV7 A;  2W7J A;  2AY5 A;  3FDB A;  4F5M A;  2EGY A;  3BWO A;  1TOK A;  4ZDP A;  1M0O A;  3DZZ A;  1BJ4 A;  1BQA A;  2NMP A;  3EI7 A;  2DGK A;  4IW7 A;  2ZUK A;  4JF1 A;  1LK9 A;  1Z3Z A;  3KGX A;  4WYE A;  5F8V A;  3LG0 A;  2O1B A;  3FFR A;  3COG A;  5LHA A;  2W8T A;  1OHV A;  1B9H A;  1M32 A;  1AHE A;  5K8B A;  1DTY A;  1YJY A;  2O0R A;  4Q31 A;  4OCA A;  4AZJ A;  3NYU A;  4L0O A;  1YOO A;  3EI5 A;  4OMA A;  2HUI A;  1TOJ A;  1QIT A;  2ZYJ A;  3NTJ A;  5I92 A;  4HVK A;  2YHK A;  1TAR A;  1V72 A;  3IHJ A;  2BYJ A;  1MLY A;  1AX4 A;  1GC2 A;  2BKW A;  4E3R A;  5BJ4 A;  4DBC A;  2Z9U A;  4UHN A;  4IXS A;  4RJ0 A;  2WK9 A;  4ZM4 A;  1UU2 A;  4RKC A;  1BJN A;  2VMO A;  3GSB A;  5G4I A;  3RUY A;  1CQ8 A;  1OAT A;  3P6K A;  4IYO A;  5J8Q A;  2EH6 A;  1B5O A;  2D61 A;  3MEB A;  1B5P A;  3DRD A;  4GDY A;  4UQV A;  1D2F A;  1S07 A;  2BIG A;  3EUC A;  3QI6 A;  1QJ3 A;  4OT8 A;  1RV3 A;  1GEY A;  4GEB A;  1I48 A;  3PPL A;  5FT5 A;  3AEJ C;  1YAA A;  1EQB A;  4F5J A;  3PD6 A;  3MKJ A;  4ISY A;  3GWP A;  1TAS A;  2XH1 A;  3DR4 A;  5IWQ A;  3GZC A;  3JTX A;  4U2H A;  3PJ0 A;  1X0M A;  3EZ1 A;  1IJI A;  2OGE A;  2E54 A;  1OHY A;  2D65 A;  3BCA A;  3VK2 A;  1V2F A;  1WYT A;  2WKA A;  4JEY A;  4XJO A;  4ADB A;  3WKS A;  4ZSW A;  1JF9 A;  1N8P A;  3BC8 A;  2VMN A;  2VMP A;  2Z9W A;  3AOW A;  3CBF A;  1TAT A;  3F6T A;  4XAU A;  1ASL A;  2HOZ A;  1C0N A;  1ORD A;  2VLH A;  3DXW A;  1WYT B;  3FVS A;  1W7M A;  1X28 A;  4R5F A;  4GRX A;  3RBL A;  2BWP A;  2PB0 A;  1UU0 A;  4GE4 A;  5FT4 A;  1CQ7 A;  1T3I A;  1W23 A;  3JU7 A;  3CQ6 A;  1O62 A;  4JEV A;  3WCO A;  1MAQ A;  1GEW A;  4LNJ A;  1IX6 A;  3BN1 A;  2BIE A;  1ECX A;  5E3K A;  2C44 A;  1DGD A;  1SZS A;  3GET A;  5EQC A;  3VK3 A;  3RI6 A;  3RCH A;  3E9K A;  3LVL B;  5DX5 A;  3NU7 A;  4P3M A;  4MGR A;  5FT8 A;  2VGZ A;  1AJR A;  1GCK A;  2VGW A;  3H7F A;  3NYS A;  1AHG A;  3I4J A;  1LC7 A;  3LVK A;  4EU1 A;  1MAP A;  2W8U A;  4A00 A;  1CZE A;  1WST A;  2EZ2 A;  2CJD A;  2W7F A;  3F0H A;  4LNL A;  4UOY A;  4BA4 A;  4BHD A;  2CH1 A;  3NNK A;  1S09 A;  1AY5 A;  2AY7 A;  3FRK A;  3N5M A;  2YCT A;  2VGS A;  1GC0 A;  2EO5 A;  1BW0 A;  5DJ1 A;  4ADD A;  1ASN A;  2CFB A;  1I29 A;  2VYC A;  4GE9 A;  3MAD A;  3GJU A;  4IY7 A;  1AAW A;  3N75 A;  2OQX A;  3W1H A;  4TMR A;  3WX9 A;  4MKK A;  3D6K A;  3AEJ A;  3E6G A;  2BI3 A;  1MDZ A;  2HZP A;  1FG7 A;  3EZS A;  3MC6 C;  4J8L A;  2AY6 A;  5E5I A;  3ZZK A;  4DQ6 A;  3HT4 A;  2Z61 A;  3AEP A;  3KKI A;  1SF2 A;  4W5K A;  3H14 A;  2ZSL A;  1VEF A;  1BQD A;  3GBX A;  4ZDL A;  4WD2 A;  4LNM A;  1SFF A;  1VP4 A;  1O69 A;  2CST A;  5HHY A;  3FQ7 A;  1LW5 A;  1LS3 A;  2QLR A;  2VI8 A;  4WBT A;  1YIY A;  3ZRP A;  2BYL A;  1ARI A;  5M46 A;  4N0W A;  3WZF A;  4JF0 A;  2HP1 A;  4KAM A;  1CL1 A;  1S08 A;  4ATQ A;  4WP0 A;  4AO4 A;  4WXB A;  2CTZ A;  1CJ0 A;  1AIB A;  4RLG A;  4A0F A;  1WYV B;  4KYO A;  8AAT A;  1MDX A;  1OXP A;  4LW4 A;  1KKJ A;  1GC4 A;  2D64 A;  3FVX A;  1ZC9 A;  3AEN B;  1MGV A;  1G7X A;  2O7C A;  2W8J A;  4B98 A;  2V0Y A;  4FL0 A;  2AAT A;  1DFO A;  2R5C A;  3HBX A;  3N0L A;  3CQ4 A;  2VMS A;  3G8M A;  3L8A A;  1V2D A;  2JGT A;  3ELP A;  4MY5 A;  1IUG A;  1W3U A;  3GZD C;  2CAN A;  2CJG A;  2OKJ A;  1CS1 A;  4F4E A;  3AAT A;  4PIW A;  1D7R A;  3PIU A;  2X3L A;  2W7H A;  3IF2 A;  4R5Z A;  2GMS A;  2R5C B;  4GE7 A;  2GMU A;  2W8V A;  3ELE A;  1TOG A;  4BQ0 A;  3FD0 A;  1KKP A;  2PB2 A;  2YKY A;  3B8X A;  4EFF A;  2AY3 A;  2YCN A;  2HOR A;  2ZP7 A;  1M0P A;  4KXK A;  3ZZJ A;  4PFF A;  1DKA A;  1GC3 A;  1AIC A;  4XJM A;  1M4N A;  4WYG A;  2D7Z A;  1QIR A;  3FZ8 A;  4WYD A;  5M4B A;  2CB1 A;  1TOI A;  3QHX A;  5G2P A;  4JEZ A;  3TAT A;  4JEX A;  1WYU B;  2WK8 A;  3OP7 A;  1S06 A;  2DOU A;  3WLX A;  4W91 A;  4EMY A;  1O4S A;  3JW9 A;  3RBF A;  3DU4 A;  3MC6 A;  4OYT A;  3E2F A;  1OHW A;  4RKD A;  5EAA A;  3VOM A;  3W1I A;  4NOG A;  5C6U A;  3NU8 A;  3PA9 A;  4CVQ A;  3CQ5 A;  3FQA A;  2VMZ A;  4GSA A;  4WXF A;  3EI6 A;  4ADC A;  4ADE A;  1G4V A;  2ZSM A;  2RFV A;  4F5F A;  1Z7D A;  3VK4 A;  2HUU A;  1ZOD A;  3B1D A;  2BWO A;  5DJ9 A;  1SZU A;  3ATH A;  3AEO A;  3MBB A;  4JEW A;  5F9S A;  4ZAH A;  1IX8 A;  3QGU A;  4ZSY A;  3QM2 A;  4EB7 A;  1AKB A;  1E5E A;  1KL1 A;  4WYC A;  3BV0 A;  4HF8 A;  3G0T A;  3I5T A;  4E77 A;  1UKJ A;  3MAF A;  4ZWM A;  2QA3 A;  3E2Z A;  4CXR A;  1LC5 A;  2ZJG A;  3WKR A;  4W8I A;  4WYA A;  1ASC A;  4ITX A;  3A8U X;  4IX8 A;  1I43 A;  2E7U A;  3QN6 A;  1SPA A;  2Z1Z A;  3ECD A;  2ZY3 A;  1P3W A;  2Z67 A;  1ASF A;  4RAE A;  2VIB A;  2VGT A;  1ASG A;  3BB8 A;  2XBN A;  3GZD A;  3MAF B;  4A72 A;  1BJO A;  3E2Z B;  4M2J A;  3DC1 A;  4UHM A;  3FTB A;  3G7Q A;  4M2K A;  1KMJ A;  1AY4 A;  1PG8 A;  3UE8 A;  2D7Y A;  3NRA A;  1C9C A;  4E3Q A;  4ZM3 A;  3EIA A;  2AY4 A;  2FNI A;  4R2N A;  4JE5 D;  2GSA A;  1C7N A;  2Z1Y A;  3I16 A;  1IBJ A;  2VMU A;  4WB0 A;  5G4J A;  3K28 A;  4F5H A;  4OC9 A;  1BJO B;  2VMR A;  3TFT A;  2AY2 A;  3QBO A;  3QPG A;  3ZRQ A;  4U1T A;  4ITG A;  4RJY A;  1XI9 A;  1CL2 A;  2JJH A;  1GD9 A;  5G0A A;  4LW2 A;  2HOX A;  4WB0 B;  2TPL A;  4RIT A;  2FYF A;  4WLH A;  3FFH A;  3JWB A;  1AKA A;  1BT4 A;  3Q8N A;  3TQX A;  5TF5 A;  1C4K A;  1YJS A;  1AY8 A;  4F5G A;  1ART A;  1YNU A;  4I8A A;  4CBR A;  1RVU A;  4O6Z A;  2E7J A;  4AH3 A;  1QZ9 A;  4MSO A;  4ZDO A;  3NUI A;  2VGV A;  1B4X A;  3TCM A;  2ORD A;  1IVR A;  3AOV A;  3GR9 A;  1YIZ A;  2QBT A;  2YOB A;  1Y4I A;  1G7W A;  1M6S A;  1ELU A;  3CAI A;  4A0G A;  2HP2 A;  1ARS A;  1WYV A;  5EUE A;  1S0A A;  2W7E A;  4Y0I A;  1U08 A;  1ASM A;  1MDO A;  3FCR A;  3AEM C;  1AHX A;  4F5I A;  1M7Y A;  3AEN A;  3ACZ A;  4A6T A;  4IXZ A;  3AV7 A;  3W1J A;  4F5K A;  3LVM A;  4DGT A;  1QJ5 A;  1IAY A;  2AY9 A;  3BCX A;  2D5Y A;  4N0B A;  4Q75 A;  4XQ2 A;  2X5D A;  4E1O A;  2C7T A;  4OBU A;  1DGE A; 
#chains in the Genus database with same CATH topology
 4XJP A;  3PAA A;  3WGB A;  4J5U A;  2CH2 A;  4ZWV A;  1MLZ A;  4A0H A;  4MQP A;  5D95 A;  2CIN A;  1IX7 A;  3DXV A;  4UHO A;  3B1C A;  3JZL A;  4ZAS A;  2W8W A;  4A0R A;  1C7G A;  1ASE A;  1X29 A;  2W7G A;  1C7O A;  2R0T A;  1ARG A;  2DKB A;  2PO3 A;  3KGW A;  3WGC A;  3WY7 A;  1ASA A;  1WKG A;  5HXX A;  2YRR A;  2AEU A;  4AZK A;  3ASB A;  1VJO A;  2CJH A;  3BWN C;  3E2Y A;  3EI9 A;  2YKX A;  4WYF A;  2C81 A;  2AEV A;  5DB5 A;  2BI5 A;  1JS6 A;  5EIG A;  1GEX A;  1WYU A;  2YKU A;  3EIB A;  4W1V A;  4ATP A;  5JAY A;  2EZ1 A;  2VMX A;  3DR7 A;  2FM1 A;  3F9T A;  3FQ8 A;  1FG3 A;  1W7N A;  1LW4 A;  3VP6 A;  2QB3 A;  2Z20 A;  3A9Y A;  2VIA A;  3NDN A;  2OKK A;  1AMS A;  2QSR A;  3FZ6 A;  1W7L A;  2R5E A;  4M2M A;  2R2N A;  3UAK A;  3N7N A;  2FN6 A;  3NUB A;  5EIG B;  1QIS A;  4FFC A;  2ZY2 A;  1PMM A;  1AMA A;  3EI8 A;  2ZY5 A;  2VMV A;  5FT6 A;  1PMO A;  1OXO A;  4F5L A;  1YJZ A;  3A9Z A;  4Q76 A;  1AJS A;  3USF A;  1CQ6 A;  1ELQ A;  2C0R A;  2W7I A;  2GB3 A;  3BCB A;  3LV2 A;  1TPL A;  2BI1 A;  3JWA A;  1N2T A;  3AEM A;  1KL2 A;  1BKG A;  5EFS A;  1X2A A;  1AHY A;  1B8G A;  3FKD A;  2Z9V A;  3HDO A;  1AJS B;  1I41 A;  2FQ6 A;  2V1P A;  2HUF A;  2W7K A;  3ISL A;  1DJU A;  3HQT A;  3NX3 A;  3K7Y A;  2DKJ A;  3MAU A;  2KFP A;  1ASD A;  1LKC A;  1PFF A;  3UWC A;  3AEL A;  4B9B A;  3HVY A;  4QGR A;  4WLJ A;  3M5U A;  5G2Q A;  4IYO B;  1RV4 A;  2OAT A;  5EAV A;  1SZK A;  2OGA A;  3E77 A;  3T32 A;  2E7I A;  2FNU A;  4K2M A;  3HLM A;  4Y0D A;  4LC3 A;  3FDD A;  2VGU A;  1J32 A;  2JJF A;  2BIA A;  4MKJ A;  2QB2 A;  2VMQ A;  4WXG A;  1E5F A;  1AMR A;  3B46 A;  4IXO A;  2GQN A;  3PD6 B;  1DJ9 A;  1JG8 A;  1RVY A;  2YRI A;  3A2B A;  3BWN A;  1BJW A;  1XEY A;  3HMU A;  4A6R A;  5EUN A;  5M4D A;  3RQ1 A;  1B9I A;  2YKV A;  4Q6R A;  2D66 A;  4MQQ A;  3HL2 A;  3K40 A;  3OKS A;  3N4S A;  3FVU A;  3BS8 A;  1AKC A;  3P1T A;  1G4X A;  2CY8 A;  1BS0 A;  4H51 A;  4A6U A;  2Q7W A;  4XJL A;  3NYT A;  4K2B A;  2JIS A;  4CBS A;  4P7Y A;  1GDE A;  2DGL A;  4XK1 A;  3PDB A;  1O61 A;  2ZC0 A;  4PFN A;  1ASB A;  1D7U A;  2BI2 A;  4XEW A;  5LH9 A;  5HDM A;  3FSL A;  3R9A A;  5D5S A;  2EPJ A;  1AAM A;  7AAT A;  1H1C A;  2BI9 A;  2JG2 A;  1UU1 A;  3PGY A;  1DJE A;  4RM1 A;  1QGN A;  4W1W A;  5BJ3 A;  2VMT A;  5EUD A;  5G09 A;  2YCP A;  4BMK A;  3DYD A;  3KE3 A;  2W7D A;  1V2E A;  2DR1 A;  3WCN A;  3FZ7 A;  1SVV A;  2HOY A;  2WK7 A;  3PDB B;  4R8D A;  4ZLV A;  2W7M A;  3ASA A;  3PDX A;  4AOA A;  4EB5 A;  4TN4 A;  2QMA A;  1AMQ A;  1M0Q A;  2G6W A;  2VLF A;  4OBV A;  1J04 A;  4CXQ A;  1D7V A;  3LWS A;  1AIA A;  3RCH B;  2JJE A;  1ZOB A;  1JS3 A;  5E4Z A;  4RIZ A;  5M49 A;  2ZY4 A;  1EG5 A;  1KMK A;  2AY1 A;  3II0 A;  1TOE A;  4Y0H A;  2DGM A;  5AX8 A;  2VI9 A;  1GBN A;  3ZRR A;  4H63 Q;  2VMY A;  4OTL A;  1H0C A;  1CZC A;  1ARH A;  2JJG A;  3TFU A;  4PVF A;  4JE5 A;  1EJI A;  2VMW A;  2X5F A;  3A9X A;  3LVJ A;  9AAT A;  3DOD A;  4AO9 A;  4K2I A;  1LC8 A;  4W1X A;  1N31 A;  3L44 A;  3LY1 A;  2D63 A;  2X8U A;  1M0N A;  4BA5 A;  1D7S A;  2F8J A;  1WKH A;  4MQR A;  1FC4 A;  2BWN A;  2W7L A;  3VAX A;  2BHX A;  1AHF A;  2AY8 A;  1IAX A;  2Z9X A;  3R4T A;  3B1E A;  4TV7 A;  2W7J A;  2AY5 A;  3FDB A;  4F5M A;  2EGY A;  3BWO A;  1TOK A;  4ZDP A;  1M0O A;  3DZZ A;  1BJ4 A;  1BQA A;  2NMP A;  3EI7 A;  2DGK A;  4IW7 A;  2ZUK A;  4JF1 A;  1LK9 A;  1Z3Z A;  3KGX A;  4WYE A;  5F8V A;  3LG0 A;  2O1B A;  3FFR A;  3COG A;  5LHA A;  2W8T A;  1OHV A;  1B9H A;  1M32 A;  1AHE A;  5K8B A;  1DTY A;  1YJY A;  2O0R A;  4Q31 A;  4OCA A;  4AZJ A;  3NYU A;  4L0O A;  1YOO A;  3EI5 A;  4OMA A;  2G7J A;  2HUI A;  5KTB A;  1TOJ A;  1QIT A;  2ZYJ A;  3NTJ A;  5I92 A;  4HVK A;  2YHK A;  1TAR A;  1V72 A;  3IHJ A;  2BYJ A;  1MLY A;  1AX4 A;  1GC2 A;  2BKW A;  4E3R A;  5BJ4 A;  4DBC A;  2Z9U A;  4UHN A;  4IXS A;  4RJ0 A;  2WK9 A;  4ZM4 A;  1UU2 A;  4RKC A;  1BJN A;  2VMO A;  3GSB A;  5G4I A;  3RUY A;  1CQ8 A;  1OAT A;  3P6K A;  4IYO A;  5J8Q A;  2EH6 A;  1B5O A;  2D61 A;  3MEB A;  1B5P A;  3DRD A;  4GDY A;  4UQV A;  1D2F A;  1S07 A;  2BIG A;  3EUC A;  3QI6 A;  1QJ3 A;  4OT8 A;  1RV3 A;  1GEY A;  4GEB A;  1I48 A;  3PPL A;  5FT5 A;  3AEJ C;  1YAA A;  1EQB A;  4F5J A;  3PD6 A;  3MKJ A;  4ISY A;  3GWP A;  1TAS A;  2XH1 A;  3DR4 A;  5IWQ A;  3GZC A;  3JTX A;  4U2H A;  3PJ0 A;  1X0M A;  3EZ1 A;  1IJI A;  2OGE A;  2E54 A;  1OHY A;  2D65 A;  3BCA A;  3VK2 A;  1V2F A;  1WYT A;  2WKA A;  4JEY A;  4XJO A;  4ADB A;  3WKS A;  4ZSW A;  1JF9 A;  1N8P A;  3BC8 A;  2VMN A;  2VMP A;  2Z9W A;  3AOW A;  3CBF A;  1TAT A;  3F6T A;  4XAU A;  1ASL A;  2HOZ A;  1C0N A;  1ORD A;  2VLH A;  3DXW A;  1WYT B;  3FVS A;  1W7M A;  1X28 A;  4R5F A;  4GRX A;  3RBL A;  2BWP A;  2PB0 A;  1UU0 A;  4GE4 A;  5FT4 A;  1CQ7 A;  1T3I A;  1W23 A;  3JU7 A;  3CQ6 A;  1O62 A;  4JEV A;  3WCO A;  1MAQ A;  1GEW A;  4LNJ A;  1IX6 A;  3BN1 A;  2BIE A;  1ECX A;  5E3K A;  2C44 A;  1DGD A;  1SZS A;  3GET A;  5EQC A;  1KAF A;  3VK3 A;  3RI6 A;  3RCH A;  3E9K A;  3LVL B;  5DX5 A;  3NU7 A;  4P3M A;  4MGR A;  5FT8 A;  2VGZ A;  1AJR A;  1GCK A;  2VGW A;  3H7F A;  3NYS A;  1AHG A;  3I4J A;  1LC7 A;  3LVK A;  4EU1 A;  1MAP A;  2W8U A;  4A00 A;  1CZE A;  1WST A;  2EZ2 A;  2CJD A;  2W7F A;  3F0H A;  4LNL A;  4UOY A;  4BA4 A;  4BHD A;  2CH1 A;  3NNK A;  1S09 A;  1AY5 A;  2AY7 A;  3FRK A;  3N5M A;  2YCT A;  2VGS A;  1GC0 A;  2EO5 A;  1BW0 A;  5DJ1 A;  4ADD A;  1ASN A;  2CFB A;  1I29 A;  2VYC A;  4GE9 A;  3MAD A;  3GJU A;  4IY7 A;  1AAW A;  3N75 A;  2OQX A;  3W1H A;  4TMR A;  3WX9 A;  4MKK A;  3D6K A;  3AEJ A;  3E6G A;  2BI3 A;  1MDZ A;  2HZP A;  1FG7 A;  3EZS A;  3MC6 C;  4J8L A;  2AY6 A;  5E5I A;  3ZZK A;  4DQ6 A;  3HT4 A;  2Z61 A;  3AEP A;  3KKI A;  1SF2 A;  4W5K A;  3H14 A;  2ZSL A;  1VEF A;  1BQD A;  3GBX A;  4ZDL A;  4WD2 A;  4LNM A;  1SFF A;  1VP4 A;  1O69 A;  2CST A;  5HHY A;  3FQ7 A;  1LW5 A;  1LS3 A;  2QLR A;  2VI8 A;  4WBT A;  1YIY A;  3ZRP A;  2BYL A;  1ARI A;  5M46 A;  4N0W A;  3WZF A;  4JF0 A;  2HP1 A;  4KAM A;  1CL1 A;  1S08 A;  4ATQ A;  4WP0 A;  4AO4 A;  4WXB A;  2CTZ A;  1CJ0 A;  1AIB A;  4RLG A;  4A0F A;  1WYV B;  4KYO A;  8AAT A;  1MDX A;  3N4R A;  1OXP A;  4LW4 A;  1KKJ A;  1GC4 A;  2D64 A;  3FVX A;  1ZC9 A;  3AEN B;  1MGV A;  1G7X A;  2O7C A;  2W8J A;  4B98 A;  2V0Y A;  4FL0 A;  2AAT A;  1DFO A;  2R5C A;  3HBX A;  3N0L A;  2EYQ A;  3CQ4 A;  2VMS A;  3G8M A;  3L8A A;  1V2D A;  2JGT A;  3ELP A;  4MY5 A;  1IUG A;  1W3U A;  3GZD C;  2CAN A;  2CJG A;  2OKJ A;  1CS1 A;  4F4E A;  3AAT A;  4PIW A;  1D7R A;  3PIU A;  2X3L A;  2W7H A;  3IF2 A;  4R5Z A;  2GMS A;  2R5C B;  4GE7 A;  2GMU A;  2W8V A;  3ELE A;  1TOG A;  4BQ0 A;  3FD0 A;  1KKP A;  2PB2 A;  2YKY A;  3B8X A;  4EFF A;  2AY3 A;  2YCN A;  2FKI A;  2HOR A;  2ZP7 A;  1M0P A;  4KXK A;  3ZZJ A;  4PFF A;  1DKA A;  1GC3 A;  1AIC A;  4XJM A;  1M4N A;  4WYG A;  2D7Z A;  1QIR A;  3FZ8 A;  4WYD A;  5M4B A;  2CB1 A;  1TOI A;  3QHX A;  5G2P A;  4JEZ A;  3TAT A;  4JEX A;  1WYU B;  4K05 A;  2WK8 A;  3OP7 A;  1S06 A;  2DOU A;  3WLX A;  4W91 A;  4EMY A;  1O4S A;  3JW9 A;  3RBF A;  3DU4 A;  3MC6 A;  4OYT A;  3E2F A;  1OHW A;  4RKD A;  5EAA A;  3VOM A;  3W1I A;  4NOG A;  5C6U A;  3NU8 A;  3PA9 A;  4CVQ A;  3CQ5 A;  3FQA A;  2VMZ A;  4GSA A;  4WXF A;  3EI6 A;  4ADC A;  4ADE A;  1G4V A;  2ZSM A;  2RFV A;  4F5F A;  1Z7D A;  3VK4 A;  2HUU A;  1ZOD A;  3B1D A;  2BWO A;  5DJ9 A;  1SZU A;  3ATH A;  3AEO A;  3MBB A;  4JEW A;  5F9S A;  4ZAH A;  1IX8 A;  3QGU A;  4ZSY A;  3QM2 A;  4EB7 A;  1AKB A;  1E5E A;  1KL1 A;  4WYC A;  3BV0 A;  4HF8 A;  3G0T A;  3I5T A;  4E77 A;  1UKJ A;  3MAF A;  4ZWM A;  2QA3 A;  3E2Z A;  4CXR A;  1LC5 A;  2ZJG A;  3WKR A;  4W8I A;  4WYA A;  1ASC A;  4ITX A;  3A8U X;  4IX8 A;  1I43 A;  3H9X A;  2E7U A;  3QN6 A;  1SPA A;  2Z1Z A;  3ECD A;  2ZY3 A;  1P3W A;  2Z67 A;  1ASF A;  4RAE A;  2VIB A;  2VGT A;  1ASG A;  3BB8 A;  2XBN A;  3GZD A;  3MAF B;  4A72 A;  1BJO A;  3E2Z B;  2A1V A;  4M2J A;  3DC1 A;  4UHM A;  3FTB A;  3G7Q A;  4M2K A;  1KMJ A;  1AY4 A;  1PG8 A;  3UE8 A;  2D7Y A;  3NRA A;  1C9C A;  4E3Q A;  4ZM3 A;  3EIA A;  2AY4 A;  2FNI A;  4R2N A;  4JE5 D;  2GSA A;  1C7N A;  2Z1Y A;  3I16 A;  1IBJ A;  2VMU A;  4WB0 A;  5G4J A;  3K28 A;  4F5H A;  4OC9 A;  1BJO B;  2VMR A;  3TFT A;  2AY2 A;  3QBO A;  3QPG A;  3ZRQ A;  4U1T A;  4ITG A;  4RJY A;  1XI9 A;  1CL2 A;  2JJH A;  2WB6 A;  1GD9 A;  5G0A A;  4LW2 A;  2HOX A;  4WB0 B;  2TPL A;  4RIT A;  2FYF A;  4WLH A;  3FFH A;  3JWB A;  1AKA A;  1BT4 A;  3Q8N A;  3TQX A;  3N4X A;  5TF5 A;  1C4K A;  1YJS A;  1AY8 A;  4F5G A;  1ART A;  1YNU A;  4I8A A;  4CBR A;  1RVU A;  4O6Z A;  2E7J A;  4AH3 A;  1QZ9 A;  4MSO A;  4ZDO A;  3NUI A;  2VGV A;  1B4X A;  3TCM A;  2ORD A;  1IVR A;  3AOV A;  3GR9 A;  1YIZ A;  2QBT A;  2YOB A;  1Y4I A;  1G7W A;  1M6S A;  1ELU A;  3CAI A;  4A0G A;  2HP2 A;  1ARS A;  1WYV A;  5EUE A;  1S0A A;  2W7E A;  4Y0I A;  1U08 A;  1ASM A;  1MDO A;  3FCR A;  3AEM C;  1AHX A;  4F5I A;  1M7Y A;  3AEN A;  3ACZ A;  4A6T A;  4IXZ A;  3AV7 A;  3W1J A;  4F5K A;  3LVM A;  4DGT A;  1QJ5 A;  1IAY A;  2AY9 A;  3BCX A;  2D5Y A;  4N0B A;  4Q75 A;  4XQ2 A;  2X5D A;  4E1O A;  2C7T A;  4OBU A;  1DGE A; 
#chains in the Genus database with same CATH homology
 4XJP A;  3PAA A;  3WGB A;  4J5U A;  2CH2 A;  4ZWV A;  1MLZ A;  4A0H A;  4MQP A;  5D95 A;  2CIN A;  1IX7 A;  3DXV A;  4UHO A;  3B1C A;  3JZL A;  4ZAS A;  2W8W A;  4A0R A;  1C7G A;  1ASE A;  1X29 A;  2W7G A;  1C7O A;  2R0T A;  1ARG A;  2DKB A;  2PO3 A;  3KGW A;  3WGC A;  3WY7 A;  1ASA A;  1WKG A;  5HXX A;  2YRR A;  2AEU A;  4AZK A;  3ASB A;  1VJO A;  2CJH A;  3BWN C;  3E2Y A;  3EI9 A;  2YKX A;  4WYF A;  2C81 A;  2AEV A;  5DB5 A;  2BI5 A;  1JS6 A;  5EIG A;  1GEX A;  1WYU A;  2YKU A;  3EIB A;  4W1V A;  4ATP A;  5JAY A;  2EZ1 A;  2VMX A;  3DR7 A;  2FM1 A;  3F9T A;  3FQ8 A;  1FG3 A;  1W7N A;  1LW4 A;  3VP6 A;  2QB3 A;  2Z20 A;  3A9Y A;  2VIA A;  3NDN A;  2OKK A;  1AMS A;  2QSR A;  3FZ6 A;  1W7L A;  2R5E A;  4M2M A;  2R2N A;  3UAK A;  3N7N A;  2FN6 A;  3NUB A;  5EIG B;  1QIS A;  4FFC A;  2ZY2 A;  1PMM A;  1AMA A;  3EI8 A;  2ZY5 A;  2VMV A;  5FT6 A;  1PMO A;  1OXO A;  4F5L A;  1YJZ A;  3A9Z A;  4Q76 A;  1AJS A;  3USF A;  1CQ6 A;  1ELQ A;  2C0R A;  2W7I A;  2GB3 A;  3BCB A;  3LV2 A;  1TPL A;  2BI1 A;  3JWA A;  1N2T A;  3AEM A;  1KL2 A;  1BKG A;  5EFS A;  1X2A A;  1AHY A;  1B8G A;  3FKD A;  2Z9V A;  3HDO A;  1AJS B;  1I41 A;  2FQ6 A;  2V1P A;  2HUF A;  2W7K A;  3ISL A;  1DJU A;  3HQT A;  3NX3 A;  3K7Y A;  2DKJ A;  3MAU A;  2KFP A;  1ASD A;  1LKC A;  1PFF A;  3UWC A;  3AEL A;  4B9B A;  3HVY A;  4QGR A;  4WLJ A;  3M5U A;  5G2Q A;  4IYO B;  1RV4 A;  2OAT A;  5EAV A;  1SZK A;  2OGA A;  3E77 A;  3T32 A;  2E7I A;  2FNU A;  4K2M A;  3HLM A;  4Y0D A;  4LC3 A;  3FDD A;  2VGU A;  1J32 A;  2JJF A;  2BIA A;  4MKJ A;  2QB2 A;  2VMQ A;  4WXG A;  1E5F A;  1AMR A;  3B46 A;  4IXO A;  2GQN A;  3PD6 B;  1DJ9 A;  1JG8 A;  1RVY A;  2YRI A;  3A2B A;  3BWN A;  1BJW A;  1XEY A;  3HMU A;  4A6R A;  5EUN A;  5M4D A;  3RQ1 A;  1B9I A;  2YKV A;  4Q6R A;  2D66 A;  4MQQ A;  3HL2 A;  3K40 A;  3OKS A;  3N4S A;  3FVU A;  3BS8 A;  1AKC A;  3P1T A;  1G4X A;  2CY8 A;  1BS0 A;  4H51 A;  4A6U A;  2Q7W A;  4XJL A;  3NYT A;  4K2B A;  2JIS A;  4CBS A;  4P7Y A;  1GDE A;  2DGL A;  4XK1 A;  3PDB A;  1O61 A;  2ZC0 A;  4PFN A;  1ASB A;  1D7U A;  2BI2 A;  4XEW A;  5LH9 A;  5HDM A;  3FSL A;  3R9A A;  5D5S A;  2EPJ A;  1AAM A;  7AAT A;  1H1C A;  2BI9 A;  2JG2 A;  1UU1 A;  3PGY A;  1DJE A;  4RM1 A;  1QGN A;  4W1W A;  5BJ3 A;  2VMT A;  5EUD A;  5G09 A;  2YCP A;  4BMK A;  3DYD A;  3KE3 A;  2W7D A;  1V2E A;  2DR1 A;  3WCN A;  3FZ7 A;  1SVV A;  2HOY A;  2WK7 A;  3PDB B;  4R8D A;  4ZLV A;  2W7M A;  3ASA A;  3PDX A;  4AOA A;  4EB5 A;  4TN4 A;  2QMA A;  1AMQ A;  1M0Q A;  2G6W A;  2VLF A;  4OBV A;  1J04 A;  4CXQ A;  1D7V A;  3LWS A;  1AIA A;  3RCH B;  2JJE A;  1ZOB A;  1JS3 A;  5E4Z A;  4RIZ A;  5M49 A;  2ZY4 A;  1EG5 A;  1KMK A;  2AY1 A;  3II0 A;  1TOE A;  4Y0H A;  2DGM A;  5AX8 A;  2VI9 A;  1GBN A;  3ZRR A;  4H63 Q;  2VMY A;  4OTL A;  1H0C A;  1CZC A;  1ARH A;  2JJG A;  3TFU A;  4PVF A;  4JE5 A;  1EJI A;  2VMW A;  2X5F A;  3A9X A;  3LVJ A;  9AAT A;  3DOD A;  4AO9 A;  4K2I A;  1LC8 A;  4W1X A;  1N31 A;  3L44 A;  3LY1 A;  2D63 A;  2X8U A;  1M0N A;  4BA5 A;  1D7S A;  2F8J A;  1WKH A;  4MQR A;  1FC4 A;  2BWN A;  2W7L A;  3VAX A;  2BHX A;  1AHF A;  2AY8 A;  1IAX A;  2Z9X A;  3R4T A;  3B1E A;  4TV7 A;  2W7J A;  2AY5 A;  3FDB A;  4F5M A;  2EGY A;  3BWO A;  1TOK A;  4ZDP A;  1M0O A;  3DZZ A;  1BJ4 A;  1BQA A;  2NMP A;  3EI7 A;  2DGK A;  4IW7 A;  2ZUK A;  4JF1 A;  1LK9 A;  1Z3Z A;  3KGX A;  4WYE A;  5F8V A;  3LG0 A;  2O1B A;  3FFR A;  3COG A;  5LHA A;  2W8T A;  1OHV A;  1B9H A;  1M32 A;  1AHE A;  5K8B A;  1DTY A;  1YJY A;  2O0R A;  4Q31 A;  4OCA A;  4AZJ A;  3NYU A;  4L0O A;  1YOO A;  3EI5 A;  4OMA A;  2G7J A;  2HUI A;  5KTB A;  1TOJ A;  1QIT A;  2ZYJ A;  3NTJ A;  5I92 A;  4HVK A;  2YHK A;  1TAR A;  1V72 A;  3IHJ A;  2BYJ A;  1MLY A;  1AX4 A;  1GC2 A;  2BKW A;  4E3R A;  5BJ4 A;  4DBC A;  2Z9U A;  4UHN A;  4IXS A;  4RJ0 A;  2WK9 A;  4ZM4 A;  1UU2 A;  4RKC A;  1BJN A;  2VMO A;  3GSB A;  5G4I A;  3RUY A;  1CQ8 A;  1OAT A;  3P6K A;  4IYO A;  5J8Q A;  2EH6 A;  1B5O A;  2D61 A;  3MEB A;  1B5P A;  3DRD A;  4GDY A;  4UQV A;  1D2F A;  1S07 A;  2BIG A;  3EUC A;  3QI6 A;  1QJ3 A;  4OT8 A;  1RV3 A;  1GEY A;  4GEB A;  1I48 A;  3PPL A;  5FT5 A;  3AEJ C;  1YAA A;  1EQB A;  4F5J A;  3PD6 A;  3MKJ A;  4ISY A;  3GWP A;  1TAS A;  2XH1 A;  3DR4 A;  5IWQ A;  3GZC A;  3JTX A;  4U2H A;  3PJ0 A;  1X0M A;  3EZ1 A;  1IJI A;  2OGE A;  2E54 A;  1OHY A;  2D65 A;  3BCA A;  3VK2 A;  1V2F A;  1WYT A;  2WKA A;  4JEY A;  4XJO A;  4ADB A;  3WKS A;  4ZSW A;  1JF9 A;  1N8P A;  3BC8 A;  2VMN A;  2VMP A;  2Z9W A;  3AOW A;  3CBF A;  1TAT A;  3F6T A;  4XAU A;  1ASL A;  2HOZ A;  1C0N A;  1ORD A;  2VLH A;  3DXW A;  1WYT B;  3FVS A;  1W7M A;  1X28 A;  4R5F A;  4GRX A;  3RBL A;  2BWP A;  2PB0 A;  1UU0 A;  4GE4 A;  5FT4 A;  1CQ7 A;  1T3I A;  1W23 A;  3JU7 A;  3CQ6 A;  1O62 A;  4JEV A;  3WCO A;  1MAQ A;  1GEW A;  4LNJ A;  1IX6 A;  3BN1 A;  2BIE A;  1ECX A;  5E3K A;  2C44 A;  1DGD A;  1SZS A;  3GET A;  5EQC A;  3VK3 A;  3RI6 A;  3RCH A;  3E9K A;  3LVL B;  5DX5 A;  3NU7 A;  4P3M A;  4MGR A;  5FT8 A;  2VGZ A;  1AJR A;  1GCK A;  2VGW A;  3H7F A;  3NYS A;  1AHG A;  3I4J A;  1LC7 A;  3LVK A;  4EU1 A;  1MAP A;  2W8U A;  4A00 A;  1CZE A;  1WST A;  2EZ2 A;  2CJD A;  2W7F A;  3F0H A;  4LNL A;  4UOY A;  4BA4 A;  4BHD A;  2CH1 A;  3NNK A;  1S09 A;  1AY5 A;  2AY7 A;  3FRK A;  3N5M A;  2YCT A;  2VGS A;  1GC0 A;  2EO5 A;  1BW0 A;  5DJ1 A;  4ADD A;  1ASN A;  2CFB A;  1I29 A;  2VYC A;  4GE9 A;  3MAD A;  3GJU A;  4IY7 A;  1AAW A;  3N75 A;  2OQX A;  3W1H A;  4TMR A;  3WX9 A;  4MKK A;  3D6K A;  3AEJ A;  3E6G A;  2BI3 A;  1MDZ A;  2HZP A;  1FG7 A;  3EZS A;  3MC6 C;  4J8L A;  2AY6 A;  5E5I A;  3ZZK A;  4DQ6 A;  3HT4 A;  2Z61 A;  3AEP A;  3KKI A;  1SF2 A;  4W5K A;  3H14 A;  2ZSL A;  1VEF A;  1BQD A;  3GBX A;  4ZDL A;  4WD2 A;  4LNM A;  1SFF A;  1VP4 A;  1O69 A;  2CST A;  5HHY A;  3FQ7 A;  1LW5 A;  1LS3 A;  2QLR A;  2VI8 A;  4WBT A;  1YIY A;  3ZRP A;  2BYL A;  1ARI A;  5M46 A;  4N0W A;  3WZF A;  4JF0 A;  2HP1 A;  4KAM A;  1CL1 A;  1S08 A;  4ATQ A;  4WP0 A;  4AO4 A;  4WXB A;  2CTZ A;  1CJ0 A;  1AIB A;  4RLG A;  4A0F A;  1WYV B;  4KYO A;  8AAT A;  1MDX A;  3N4R A;  1OXP A;  4LW4 A;  1KKJ A;  1GC4 A;  2D64 A;  3FVX A;  1ZC9 A;  3AEN B;  1MGV A;  1G7X A;  2O7C A;  2W8J A;  4B98 A;  2V0Y A;  4FL0 A;  2AAT A;  1DFO A;  2R5C A;  3HBX A;  3N0L A;  2EYQ A;  3CQ4 A;  2VMS A;  3G8M A;  3L8A A;  1V2D A;  2JGT A;  3ELP A;  4MY5 A;  1IUG A;  1W3U A;  3GZD C;  2CAN A;  2CJG A;  2OKJ A;  1CS1 A;  4F4E A;  3AAT A;  4PIW A;  1D7R A;  3PIU A;  2X3L A;  2W7H A;  3IF2 A;  4R5Z A;  2GMS A;  2R5C B;  4GE7 A;  2GMU A;  2W8V A;  3ELE A;  1TOG A;  4BQ0 A;  3FD0 A;  1KKP A;  2PB2 A;  2YKY A;  3B8X A;  4EFF A;  2AY3 A;  2YCN A;  2FKI A;  2HOR A;  2ZP7 A;  1M0P A;  4KXK A;  3ZZJ A;  4PFF A;  1DKA A;  1GC3 A;  1AIC A;  4XJM A;  1M4N A;  4WYG A;  2D7Z A;  1QIR A;  3FZ8 A;  4WYD A;  5M4B A;  2CB1 A;  1TOI A;  3QHX A;  5G2P A;  4JEZ A;  3TAT A;  4JEX A;  1WYU B;  4K05 A;  2WK8 A;  3OP7 A;  1S06 A;  2DOU A;  3WLX A;  4W91 A;  4EMY A;  1O4S A;  3JW9 A;  3RBF A;  3DU4 A;  3MC6 A;  4OYT A;  3E2F A;  1OHW A;  4RKD A;  5EAA A;  3VOM A;  3W1I A;  4NOG A;  5C6U A;  3NU8 A;  3PA9 A;  4CVQ A;  3CQ5 A;  3FQA A;  2VMZ A;  4GSA A;  4WXF A;  3EI6 A;  4ADC A;  4ADE A;  1G4V A;  2ZSM A;  2RFV A;  4F5F A;  1Z7D A;  3VK4 A;  2HUU A;  1ZOD A;  3B1D A;  2BWO A;  5DJ9 A;  1SZU A;  3ATH A;  3AEO A;  3MBB A;  4JEW A;  5F9S A;  4ZAH A;  1IX8 A;  3QGU A;  4ZSY A;  3QM2 A;  4EB7 A;  1AKB A;  1E5E A;  1KL1 A;  4WYC A;  3BV0 A;  4HF8 A;  3G0T A;  3I5T A;  4E77 A;  1UKJ A;  3MAF A;  4ZWM A;  2QA3 A;  3E2Z A;  4CXR A;  1LC5 A;  2ZJG A;  3WKR A;  4W8I A;  4WYA A;  1ASC A;  4ITX A;  3A8U X;  4IX8 A;  1I43 A;  3H9X A;  2E7U A;  3QN6 A;  1SPA A;  2Z1Z A;  3ECD A;  2ZY3 A;  1P3W A;  2Z67 A;  1ASF A;  4RAE A;  2VIB A;  2VGT A;  1ASG A;  3BB8 A;  2XBN A;  3GZD A;  3MAF B;  4A72 A;  1BJO A;  3E2Z B;  2A1V A;  4M2J A;  3DC1 A;  4UHM A;  3FTB A;  3G7Q A;  4M2K A;  1KMJ A;  1AY4 A;  1PG8 A;  3UE8 A;  2D7Y A;  3NRA A;  1C9C A;  4E3Q A;  4ZM3 A;  3EIA A;  2AY4 A;  2FNI A;  4R2N A;  4JE5 D;  2GSA A;  1C7N A;  2Z1Y A;  3I16 A;  1IBJ A;  2VMU A;  4WB0 A;  5G4J A;  3K28 A;  4F5H A;  4OC9 A;  1BJO B;  2VMR A;  3TFT A;  2AY2 A;  3QBO A;  3QPG A;  3ZRQ A;  4U1T A;  4ITG A;  4RJY A;  1XI9 A;  1CL2 A;  2JJH A;  2WB6 A;  1GD9 A;  5G0A A;  4LW2 A;  2HOX A;  4WB0 B;  2TPL A;  4RIT A;  2FYF A;  4WLH A;  3FFH A;  3JWB A;  1AKA A;  1BT4 A;  3Q8N A;  3TQX A;  3N4X A;  5TF5 A;  1C4K A;  1YJS A;  1AY8 A;  4F5G A;  1ART A;  1YNU A;  4I8A A;  4CBR A;  1RVU A;  4O6Z A;  2E7J A;  4AH3 A;  1QZ9 A;  4MSO A;  4ZDO A;  3NUI A;  2VGV A;  1B4X A;  3TCM A;  2ORD A;  1IVR A;  3AOV A;  3GR9 A;  1YIZ A;  2QBT A;  2YOB A;  1Y4I A;  1G7W A;  1M6S A;  1ELU A;  3CAI A;  4A0G A;  2HP2 A;  1ARS A;  1WYV A;  5EUE A;  1S0A A;  2W7E A;  4Y0I A;  1U08 A;  1ASM A;  1MDO A;  3FCR A;  3AEM C;  1AHX A;  4F5I A;  1M7Y A;  3AEN A;  3ACZ A;  4A6T A;  4IXZ A;  3AV7 A;  3W1J A;  4F5K A;  3LVM A;  4DGT A;  1QJ5 A;  1IAY A;  2AY9 A;  3BCX A;  2D5Y A;  4N0B A;  4Q75 A;  4XQ2 A;  2X5D A;  4E1O A;  2C7T A;  4OBU A;  1DGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...