3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
molecule keywords Protein kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
4UXIA 1TBNA 3UGLA 3UGDA 2J87A 2ORWA 2UZ3A 1FARA 3E2IA 1R79A 4UXHA 2QQ0A 2VRWB 3BJIA 5FUVA 3UFFA 1XA6A 5FUXA 2ENZA 1KBEA 2FNFX 4L9MA 2ELIA 2ORVA 4FKDA 2QPOA 1PTQA 4UXJA 1FAQA 1TBOA 5FUYA 2WVJA 1KBFA 2J9RA 2ROWA 1XBTA 2B8TA 3UGIA 1W4RA 3UEJA 2QQEA 1XX6A 2GVIA 2JA1A 1Y8FA 2DB6A 2YUUA 4B6DA 1PTRA 3KY9A 3CXLA 5FUWA 2ENNA 2E73A 3UEYA 1RFHA
chains in the Genus database with same CATH superfamily
2X3TA 2X52A 2YQPA 2WGCA 4UXIA 1P9GA 1UVGA 2B0UC 2N1AB 2KMRA 3FSYA 1M8CA 1WTJA 1TIHA 2CWHA 3FSXA 4GI3C 2L8EA 3UOEA 2LEOA 1R0RI 2NU0I 2UZ3A 2NU4I 2KMPA 2SGDI 1UHAA 3TJQA 5HI7A 1AN1I 1Z7KB 1MT1A 5CCLA 1LR8A 1KBEA 4SGBI 2PQ8A 2QPOA 5E3RA 1N13A 1TBOA 1CHOI 2ERWA 3VE5A 1SGEI 2QQCA 2ROWA 2V53A 1FY7A 1OMTA 2JYYA 1CSOI 2OZUA 1TOTA 1LR7A 1W4RA 1V1HA 3HH2C 2SGFI 2QQEA 2LB7A 2SGQI 3B4VC 5EX0A 2DB6A 2CWFA 4E1RA 2V1CC 1OMUA 2GKRI 3TO7A 1M8BA 1KMAA 1IY5A 5E3QA 3OXLA 1MJAA 1Q9BA 1OVOA 2XRCA 1TGSI 1DS3I 1Y1CA 2ENNA 2E73A 3OXFA 1TBRR 2P6AC 3UEYA 1YTPA 1TBNA 2SGEI 3UGLA 1SGNI 2V1CA 3QTLD 3QWPA 2J87A 5E3PA 2ORWA 1S20A 1R79A 2M5XA 2KCXA 2RC4A 2VRWB 1UVFA 3OXGA 3SGQI 2A20A 1SGYI 3OVOA 1YU6C 2N17A 1XA6A 4HGUA 3RU0A 2ENZA 1FYBA 1SGPI 4UXJA 1SGRI 2ORVA 4L9MA 3TOBA 2WVJA 1KBFA 1X4SA 1CT4I 1OYVI 2NU1I 2DIPA 1TUSA 4JCVE 5J8FA 1NXUA 2B8TA 4E1PA 1IY6A 1HJAI 2KMOA 3QAHA 5J8CA 1UUCA 1U5KA 3R5BA 1HDLA 3MEKA 2QQDA 4DNCA 1Z2IA 4MPIA 3TO9A 4WP4A 3KY9A 4A24A 9WGAA 3GOXA 4AMLA 2ODDA 1HEVA 1LR9A 5DAEA 1RFHA 1ULNA 3PDNA 5EX3A 2CWGA 5CCMA 5HQ8A 1BMOA 1WGTA 1HPTA 2W0TA 1P9ZA 2WCYA 3E2IA 4UXHA 3BJIA 3UFFA 3FC3A 3SGBI 3TOAA 2GKTI 5FUXA 1PPFI 2FNFX 2ELIA 4FKDA 3R5DA 1PTQA 2RIJA 1FAQA 5FUYA 2E5RA 1V1IA 1CT0I 7WGAA 1WGCA 2JZMA 3E59A 1XBTA 1MJBA 2Y0MA 1BUSA 3UEJA 3D00A 1TURA 1ULKA 1XX6A 1W3SA 1ULMA 1X74A 2BUSA 2GVIA 1Y8FA 3TO6A 2YUUA 3VDUA 2F3CI 2N71A 1CE3A 1CGII 5JHWC 5FUWA 1K7UA 3UGIA 2JW6A 1DS2I 1SGQI 1CGJI 2DKVA 1PCEA 1VDDA 2ARPF 2SGPI 3R5CA 3UGDA 1IW4A 2LUYA 1FARA 2QQ0A 2OU2A 2GKVA 5FUVA 2CJSC 1CT2I 1NUBA 2L7XA 2NU2I 1K7VA 1K7TA 2J9RA 2UVOA 2JXDA 2OVOA 1PJUA 1SGDI 2N52A 1WKXA 3SEKC 2NU3I 2JA1A 3R5AA 2K9HA 1MJ9A 2KMQA 3VDPA 2OD1A 4B6DA 1PTRA 4OVOA 3OL0A 3CXLA 1TBQR 1H0ZA 2GIVA 1Y1BA
chains in the Genus database with same CATH topology
4UXIA 1H0ZA 2YQPA 2B0UC 1UVGA 2N1AB 2KMRA 1M8CA 1TIHA 4GI3C 2L8EA 2LEOA 1R0RI 2NU0I 2UZ3A 2NU4I 2KMPA 2SGDI 3TJQA 5HI7A 1AN1I 1Z7KB 1MT1A 5CCLA 1LR8A 1KBEA 4SGBI 2QPOA 1N13A 1TBOA 1CHOI 2ERWA 3VE5A 1SGEI 2QQCA 2ROWA 2V53A 1OMTA 2JYYA 1CSOI 3HH2C 1TOTA 1LR7A 1W4RA 1V1HA 2SGFI 2QQEA 2SGQI 3B4VC 5EX0A 2DB6A 4E1RA 2V1CC 1OMUA 2GKRI 1KMAA 1M8BA 1IY5A 3OXLA 1OVOA 2XRCA 1TGSI 1Y1CA 1DS3I 2ENNA 2E73A 3OXFA 1TBRR 2P6AC 3UEYA 1YTPA 1TBNA 2SGEI 3UGLA 1SGNI 2V1CA 3QTLD 3QWPA 2J87A 2ORWA 1R79A 2M5XA 2KCXA 2VRWB 3OXGA 1UVFA 3SGQI 3SGBI 2A20A 1SGYI 3OVOA 1YU6C 2N17A 1XA6A 4HGUA 3RU0A 2ENZA 1FYBA 1SGPI 4UXJA 1SGRI 2ORVA 4L9MA 2WVJA 1KBFA 1X4SA 1CT4I 1OYVI 2NU1I 2DIPA 1TUSA 4JCVE 2B8TA 4E1PA 1IY6A 1HJAI 2KMOA 1UUCA 1U5KA 1HDLA 3MEKA 2QQDA 3KY9A 4A24A 3GOXA 2ODDA 1LR9A 5DAEA 1RFHA 3PDNA 5EX3A 5CCMA 5HQ8A 1BMOA 2WCYA 1HPTA 2W0TA 3E2IA 4UXHA 3BJIA 3UFFA 3FC3A 2GKTI 5FUXA 1PPFI 2FNFX 2ELIA 4FKDA 1PTQA 1FAQA 5FUYA 2E5RA 1V1IA 1CT0I 2JZMA 3E59A 1XBTA 1BUSA 3UEJA 3D00A 1TURA 1XX6A 1W3SA 1X74A 2BUSA 2GVIA 1Y8FA 2YUUA 3VDUA 2F3CI 2N71A 1CE3A 1CGII 5JHWC 5FUWA 3UGIA 2JW6A 1DS2I 1SGQI 1CGJI 1PCEA 1VDDA 2ARPF 2SGPI 3UGDA 1IW4A 2LUYA 1FARA 2QQ0A 5FUVA 2GKVA 2CJSC 1CT2I 1NUBA 2L7XA 2NU2I 2J9RA 2JXDA 2OVOA 1PJUA 1SGDI 2N52A 3SEKC 2NU3I 2JA1A 2K9HA 3VDPA 2KMQA 2OD1A 4B6DA 1PTRA 4OVOA 3OL0A 3CXLA 1TBQR 1Y1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXI A;  1TBN A;  3UGL A;  3UGD A;  2J87 A;  2ORW A;  2UZ3 A;  1FAR A;  3E2I A;  1R79 A;  4UXH A;  2QQ0 A;  2VRW B;  3BJI A;  5FUV A;  3UFF A;  1XA6 A;  5FUX A;  2ENZ A;  1KBE A;  2FNF X;  4L9M A;  2ELI A;  2ORV A;  4FKD A;  2QPO A;  1PTQ A;  4UXJ A;  1FAQ A;  1TBO A;  5FUY A;  2WVJ A;  1KBF A;  2J9R A;  2ROW A;  1XBT A;  2B8T A;  3UGI A;  1W4R A;  3UEJ A;  2QQE A;  1XX6 A;  2GVI A;  2JA1 A;  1Y8F A;  2DB6 A;  2YUU A;  4B6D A;  1PTR A;  3KY9 A;  3CXL A;  5FUW A;  2ENN A;  2E73 A;  3UEY A;  1RFH A; 
#chains in the Genus database with same CATH topology
 2X3T A;  2X52 A;  2YQP A;  2WGC A;  4UXI A;  1P9G A;  1UVG A;  2B0U C;  2N1A B;  2KMR A;  3FSY A;  1M8C A;  1WTJ A;  1TIH A;  2CWH A;  3FSX A;  4GI3 C;  2L8E A;  3UOE A;  2LEO A;  1R0R I;  2NU0 I;  2UZ3 A;  2NU4 I;  2KMP A;  2SGD I;  1UHA A;  3TJQ A;  5HI7 A;  1AN1 I;  1Z7K B;  1MT1 A;  5CCL A;  1LR8 A;  1KBE A;  4SGB I;  2PQ8 A;  2QPO A;  5E3R A;  1N13 A;  1TBO A;  1CHO I;  2ERW A;  3VE5 A;  1SGE I;  2QQC A;  2ROW A;  2V53 A;  1FY7 A;  1OMT A;  2JYY A;  1CSO I;  2OZU A;  1TOT A;  1LR7 A;  1W4R A;  1V1H A;  3HH2 C;  2SGF I;  2QQE A;  2LB7 A;  2SGQ I;  3B4V C;  5EX0 A;  2DB6 A;  2CWF A;  4E1R A;  2V1C C;  1OMU A;  2GKR I;  3TO7 A;  1M8B A;  1KMA A;  1IY5 A;  5E3Q A;  3OXL A;  1MJA A;  1Q9B A;  1OVO A;  2XRC A;  1TGS I;  1DS3 I;  1Y1C A;  2ENN A;  2E73 A;  3OXF A;  1TBR R;  2P6A C;  3UEY A;  1YTP A;  1TBN A;  2SGE I;  3UGL A;  1SGN I;  2V1C A;  3QTL D;  3QWP A;  2J87 A;  5E3P A;  2ORW A;  1S20 A;  1R79 A;  2M5X A;  2KCX A;  2RC4 A;  2VRW B;  1UVF A;  3OXG A;  3SGQ I;  2A20 A;  1SGY I;  3OVO A;  1YU6 C;  2N17 A;  1XA6 A;  4HGU A;  3RU0 A;  2ENZ A;  1FYB A;  1SGP I;  4UXJ A;  1SGR I;  2ORV A;  4L9M A;  3TOB A;  2WVJ A;  1KBF A;  1X4S A;  1CT4 I;  1OYV I;  2NU1 I;  2DIP A;  1TUS A;  4JCV E;  5J8F A;  1NXU A;  2B8T A;  4E1P A;  1IY6 A;  1HJA I;  2KMO A;  3QAH A;  5J8C A;  1UUC A;  1U5K A;  3R5B A;  1HDL A;  3MEK A;  2QQD A;  4DNC A;  1Z2I A;  4MPI A;  3TO9 A;  4WP4 A;  3KY9 A;  4A24 A;  9WGA A;  3GOX A;  4AML A;  2ODD A;  1HEV A;  1LR9 A;  5DAE A;  1RFH A;  1ULN A;  3PDN A;  5EX3 A;  2CWG A;  5CCM A;  5HQ8 A;  1BMO A;  1WGT A;  1HPT A;  2W0T A;  1P9Z A;  2WCY A;  3E2I A;  4UXH A;  3BJI A;  3UFF A;  3FC3 A;  3SGB I;  3TOA A;  2GKT I;  5FUX A;  1PPF I;  2FNF X;  2ELI A;  4FKD A;  3R5D A;  1PTQ A;  2RIJ A;  1FAQ A;  5FUY A;  2E5R A;  1V1I A;  1CT0 I;  7WGA A;  1WGC A;  2JZM A;  3E59 A;  1XBT A;  1MJB A;  2Y0M A;  1BUS A;  3UEJ A;  3D00 A;  1TUR A;  1ULK A;  1XX6 A;  1W3S A;  1ULM A;  1X74 A;  2BUS A;  2GVI A;  1Y8F A;  3TO6 A;  2YUU A;  3VDU A;  2F3C I;  2N71 A;  1CE3 A;  1CGI I;  5JHW C;  5FUW A;  1K7U A;  3UGI A;  2JW6 A;  1DS2 I;  1SGQ I;  1CGJ I;  2DKV A;  1PCE A;  1VDD A;  2ARP F;  2SGP I;  3R5C A;  3UGD A;  1IW4 A;  2LUY A;  1FAR A;  2QQ0 A;  2OU2 A;  2GKV A;  5FUV A;  2CJS C;  1CT2 I;  1NUB A;  2L7X A;  2NU2 I;  1K7V A;  1K7T A;  2J9R A;  2UVO A;  2JXD A;  2OVO A;  1PJU A;  1SGD I;  2N52 A;  1WKX A;  3SEK C;  2NU3 I;  2JA1 A;  3R5A A;  2K9H A;  1MJ9 A;  2KMQ A;  3VDP A;  2OD1 A;  4B6D A;  1PTR A;  4OVO A;  3OL0 A;  3CXL A;  1TBQ R;  1H0Z A;  2GIV A;  1Y1B A; 
#chains in the Genus database with same CATH homology
 4UXI A;  1H0Z A;  2YQP A;  2B0U C;  1UVG A;  2N1A B;  2KMR A;  1M8C A;  1TIH A;  4GI3 C;  2L8E A;  2LEO A;  1R0R I;  2NU0 I;  2UZ3 A;  2NU4 I;  2KMP A;  2SGD I;  3TJQ A;  5HI7 A;  1AN1 I;  1Z7K B;  1MT1 A;  5CCL A;  1LR8 A;  1KBE A;  4SGB I;  2QPO A;  1N13 A;  1TBO A;  1CHO I;  2ERW A;  3VE5 A;  1SGE I;  2QQC A;  2ROW A;  2V53 A;  1OMT A;  2JYY A;  1CSO I;  3HH2 C;  1TOT A;  1LR7 A;  1W4R A;  1V1H A;  2SGF I;  2QQE A;  2SGQ I;  3B4V C;  5EX0 A;  2DB6 A;  4E1R A;  2V1C C;  1OMU A;  2GKR I;  1KMA A;  1M8B A;  1IY5 A;  3OXL A;  1OVO A;  2XRC A;  1TGS I;  1Y1C A;  1DS3 I;  2ENN A;  2E73 A;  3OXF A;  1TBR R;  2P6A C;  3UEY A;  1YTP A;  1TBN A;  2SGE I;  3UGL A;  1SGN I;  2V1C A;  3QTL D;  3QWP A;  2J87 A;  2ORW A;  1R79 A;  2M5X A;  2KCX A;  2VRW B;  3OXG A;  1UVF A;  3SGQ I;  3SGB I;  2A20 A;  1SGY I;  3OVO A;  1YU6 C;  2N17 A;  1XA6 A;  4HGU A;  3RU0 A;  2ENZ A;  1FYB A;  1SGP I;  4UXJ A;  1SGR I;  2ORV A;  4L9M A;  2WVJ A;  1KBF A;  1X4S A;  1CT4 I;  1OYV I;  2NU1 I;  2DIP A;  1TUS A;  4JCV E;  2B8T A;  4E1P A;  1IY6 A;  1HJA I;  2KMO A;  1UUC A;  1U5K A;  1HDL A;  3MEK A;  2QQD A;  3KY9 A;  4A24 A;  3GOX A;  2ODD A;  1LR9 A;  5DAE A;  1RFH A;  3PDN A;  5EX3 A;  5CCM A;  5HQ8 A;  1BMO A;  2WCY A;  1HPT A;  2W0T A;  3E2I A;  4UXH A;  3BJI A;  3UFF A;  3FC3 A;  2GKT I;  5FUX A;  1PPF I;  2FNF X;  2ELI A;  4FKD A;  1PTQ A;  1FAQ A;  5FUY A;  2E5R A;  1V1I A;  1CT0 I;  2JZM A;  3E59 A;  1XBT A;  1BUS A;  3UEJ A;  3D00 A;  1TUR A;  1XX6 A;  1W3S A;  1X74 A;  2BUS A;  2GVI A;  1Y8F A;  2YUU A;  3VDU A;  2F3C I;  2N71 A;  1CE3 A;  1CGI I;  5JHW C;  5FUW A;  3UGI A;  2JW6 A;  1DS2 I;  1SGQ I;  1CGJ I;  1PCE A;  1VDD A;  2ARP F;  2SGP I;  3UGD A;  1IW4 A;  2LUY A;  1FAR A;  2QQ0 A;  5FUV A;  2GKV A;  2CJS C;  1CT2 I;  1NUB A;  2L7X A;  2NU2 I;  2J9R A;  2JXD A;  2OVO A;  1PJU A;  1SGD I;  2N52 A;  3SEK C;  2NU3 I;  2JA1 A;  2K9H A;  3VDP A;  2KMQ A;  2OD1 A;  4B6D A;  1PTR A;  4OVO A;  3OL0 A;  3CXL A;  1TBQ R;  1Y1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...