3UFFA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVTNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
molecule keywords Protein kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uffA01
1W4RA 2ENNA 5FUWA 3BJIA 1KBEA 1PTQA 2ORWA 4FKDA 5FUYA 1Y8FA 5FUXA 5FUVA 3CXLA 3UGDA 2ELIA 1R79A 1TBOA 1XA6A 1XBTA 2E73A 2QPOA 2GVIA 4UXHA 1KBFA 4UXJA 1XX6A 2QQ0A 2WVJA 2J9RA 2JA1A 2B8TA 2FNFX 2YUUA 1TBNA 2VRWB 2UZ3A 1RFHA 3UEJA 2DB6A 2ORVA 4UXIA 1PTRA 1FARA 1FAQA 3UFFA 2ENZA 4L9MA 3UEYA 2QQEA 3UGIA 4B6DA 2ROWA 3E2IA 3UGLA 2J87A 3KY9A
chains in the Genus database with same CATH superfamily
3SEKC 2OU2A 2JZMA 5HI7A 4A24A 5JHWC 1MJAA 5DAEA 1CE3A 5J8FA 1P9GA 1Z7KB 4WP4A 1LR7A 5EX3A 5FUVA 1MT1A 1UHAA 1V1HA 5FUXA 3UGDA 4UXHA 3FSXA 2SGDI 2ODDA 1XX6A 1K7TA 2JA1A 2B8TA 2KMQA 3OVOA 2BUSA 1TBNA 1YTPA 2KMPA 3OXFA 2VRWB 1NUBA 4OVOA 1RFHA 1TUSA 2N52A 3RU0A 3TOBA 2KMRA 3B4VC 1SGQI 2OVOA 2X52A 2XRCA 1KBFA 3SGQI 2JYYA 5E3RA 3OXLA 3UEYA 3E59A 3R5CA 3HH2C 2GKRI 4GI3C 1WKXA 2JW6A 4DNCA 1OMTA 2K9HA 2X3TA 1DS2I 1Y1BA 2L7XA 1KMAA 1PPFI 3TO7A 2ENNA 5FUWA 2A20A 2QQCA 4AMLA 5CCLA 2ORWA 1HPTA 2SGPI 4FKDA 2V1CA 1FYBA 2N71A 5FUYA 3CXLA 1AN1I 2ELIA 1XBTA 2L8EA 3TO6A 2YUUA 2WVJA 1NXUA 2J9RA 4SGBI 1Z2IA 2ERWA 2N1AB 1HDLA 1CSOI 2CWFA 1UVGA 5E3QA 1YU6C 3PDNA 4HGUA 2RC4A 1VDDA 2ORVA 1X74A 2LUYA 4UXIA 1FAQA 4MPIA 1MJBA 1BUSA 1TBQR 2ENZA 2PQ8A 3R5DA 2F3CI 2ROWA 1SGPI 2YQPA 3MEKA 1IY5A 1M8BA 2B0UC 2RIJA 1TURA 4E1PA 2N17A 1SGDI 2NU4I 3BJIA 1K7UA 1KBEA 3VDUA 1WTJA 5J8CA 1UVFA 5HQ8A 1M8CA 2NU0I 3TOAA 1CT4I 2CJSC 1SGYI 2UVOA 2LB7A 2E73A 1TBOA 1XA6A 2DIPA 2GIVA 5E3PA 5EX0A 1LR8A 3QTLD 1OMUA 1W3SA 3R5BA 4UXJA 1MJ9A 3TJQA 2CWHA 2LEOA 2OZUA 3R5AA 2NU2I 2WCYA 3TO9A 1BMOA 2V1CC 1HEVA 1OVOA 3UEJA 1OYVI 1ULMA 1Y1CA 2NU1I 1FARA 1FY7A 2GKTI 3UFFA 2DKVA 2KCXA 4L9MA 1IW4A 2QQDA 1CGII 1LR9A 2QQEA 2JXDA 3UGIA 1UUCA 1U5KA 2CWGA 1CGJI 2OD1A 3E2IA 4JCVE 3UGLA 1X4SA 2E5RA 2J87A 1S20A 3KY9A 1SGRI 1V1IA 1ULKA 1W4RA 1TOTA 2V53A 3UOEA 3VE5A 2GKVA 1TIHA 1PTQA 1N13A 1TGSI 3QAHA 1PCEA 1CT2I 2WGCA 2W0TA 3FC3A 1IY6A 1H0ZA 1Y8FA 3GOXA 1R79A 1SGNI 2QPOA 1R0RI 2GVIA 1P9ZA 2SGFI 2QQ0A 2FNFX 1TBRR 4E1RA 1HJAI 2Y0MA 1DS3I 2SGQI 1K7VA 1WGCA 2UZ3A 5CCMA 1Q9BA 3D00A 3OXGA 2DB6A 9WGAA 1PTRA 1PJUA 3OL0A 3FSYA 1CHOI 1SGEI 2M5XA 7WGAA 1CT0I 3QWPA 2P6AC 3SGBI 3VDPA 4B6DA 2ARPF 2NU3I 2KMOA 1WGTA 1ULNA 2SGEI
chains in the Genus database with same CATH topology
3SEKC 2JZMA 5HI7A 4A24A 5JHWC 5DAEA 1CE3A 1Z7KB 1LR7A 5EX3A 5FUVA 1MT1A 1V1HA 5FUXA 3UGDA 4UXHA 2SGDI 2ODDA 1XX6A 2JA1A 2KMQA 2B8TA 3OVOA 2BUSA 1TBNA 1YTPA 2KMPA 3OXFA 2VRWB 1NUBA 4OVOA 1RFHA 1TUSA 2N52A 3RU0A 2KMRA 3B4VC 1SGQI 2OVOA 2XRCA 3SGQI 2JYYA 3OXLA 3UEYA 3E59A 3HH2C 2GKRI 4GI3C 2JW6A 1OMTA 2K9HA 1DS2I 1Y1BA 2L7XA 1KMAA 1PPFI 2ENNA 5FUWA 2A20A 2QQCA 5CCLA 2ORWA 1HPTA 2SGPI 4FKDA 2V1CA 1FYBA 2N71A 5FUYA 3CXLA 1AN1I 2ELIA 1XBTA 2L8EA 2YUUA 2WVJA 2J9RA 4SGBI 2N1AB 2ERWA 1HDLA 1CSOI 1UVGA 1YU6C 3PDNA 4HGUA 1VDDA 2ORVA 1X74A 2LUYA 4UXIA 1FAQA 1BUSA 1TBQR 2ENZA 2F3CI 2ROWA 1SGPI 2YQPA 3MEKA 1IY5A 1M8BA 2B0UC 1TURA 4E1PA 2N17A 1SGDI 2NU4I 3BJIA 1KBEA 3VDUA 1UVFA 5HQ8A 1M8CA 2NU0I 1CT4I 2CJSC 1SGYI 1KBFA 2E73A 1TBOA 1XA6A 2DIPA 5EX0A 1LR8A 3QTLD 1OMUA 1W3SA 4UXJA 3TJQA 2LEOA 2NU2I 2WCYA 1BMOA 2V1CC 1OVOA 3UEJA 1OYVI 1Y1CA 2NU1I 1FARA 2GKTI 3UFFA 2KCXA 4L9MA 1IW4A 2QQDA 1CGII 1LR9A 2QQEA 2JXDA 3UGIA 1UUCA 1U5KA 3E2IA 1CGJI 2OD1A 4JCVE 3UGLA 1X4SA 2E5RA 2J87A 3KY9A 1SGRI 1V1IA 1W4RA 1TOTA 2V53A 3VE5A 2GKVA 1TIHA 1PTQA 1N13A 1TGSI 1PCEA 1CT2I 3FC3A 2W0TA 1H0ZA 1IY6A 1Y8FA 3GOXA 1R79A 1SGNI 2QPOA 1R0RI 2GVIA 2SGFI 2QQ0A 2FNFX 1TBRR 4E1RA 1HJAI 1DS3I 2SGQI 2UZ3A 5CCMA 3D00A 3OXGA 2DB6A 1PTRA 1PJUA 3OL0A 1CHOI 1SGEI 2M5XA 1CT0I 3QWPA 2P6AC 3SGBI 3VDPA 4B6DA 2ARPF 2NU3I 2KMOA 2SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4R A;  2ENN A;  5FUW A;  3BJI A;  1KBE A;  1PTQ A;  2ORW A;  4FKD A;  5FUY A;  1Y8F A;  5FUX A;  5FUV A;  3CXL A;  3UGD A;  2ELI A;  1R79 A;  1TBO A;  1XA6 A;  1XBT A;  2E73 A;  2QPO A;  2GVI A;  4UXH A;  1KBF A;  4UXJ A;  1XX6 A;  2QQ0 A;  2WVJ A;  2J9R A;  2JA1 A;  2B8T A;  2FNF X;  2YUU A;  1TBN A;  2VRW B;  2UZ3 A;  1RFH A;  3UEJ A;  2DB6 A;  2ORV A;  4UXI A;  1PTR A;  1FAR A;  1FAQ A;  3UFF A;  2ENZ A;  4L9M A;  3UEY A;  2QQE A;  3UGI A;  4B6D A;  2ROW A;  3E2I A;  3UGL A;  2J87 A;  3KY9 A; 
#chains in the Genus database with same CATH topology
 3SEK C;  2OU2 A;  2JZM A;  5HI7 A;  4A24 A;  5JHW C;  1MJA A;  5DAE A;  1CE3 A;  5J8F A;  1P9G A;  1Z7K B;  4WP4 A;  1LR7 A;  5EX3 A;  5FUV A;  1MT1 A;  1UHA A;  1V1H A;  5FUX A;  3UGD A;  4UXH A;  3FSX A;  2SGD I;  2ODD A;  1XX6 A;  1K7T A;  2JA1 A;  2B8T A;  2KMQ A;  3OVO A;  2BUS A;  1TBN A;  1YTP A;  2KMP A;  3OXF A;  2VRW B;  1NUB A;  4OVO A;  1RFH A;  1TUS A;  2N52 A;  3RU0 A;  3TOB A;  2KMR A;  3B4V C;  1SGQ I;  2OVO A;  2X52 A;  2XRC A;  1KBF A;  3SGQ I;  2JYY A;  5E3R A;  3OXL A;  3UEY A;  3E59 A;  3R5C A;  3HH2 C;  2GKR I;  4GI3 C;  1WKX A;  2JW6 A;  4DNC A;  1OMT A;  2K9H A;  2X3T A;  1DS2 I;  1Y1B A;  2L7X A;  1KMA A;  1PPF I;  3TO7 A;  2ENN A;  5FUW A;  2A20 A;  2QQC A;  4AML A;  5CCL A;  2ORW A;  1HPT A;  2SGP I;  4FKD A;  2V1C A;  1FYB A;  2N71 A;  5FUY A;  3CXL A;  1AN1 I;  2ELI A;  1XBT A;  2L8E A;  3TO6 A;  2YUU A;  2WVJ A;  1NXU A;  2J9R A;  4SGB I;  1Z2I A;  2ERW A;  2N1A B;  1HDL A;  1CSO I;  2CWF A;  1UVG A;  5E3Q A;  1YU6 C;  3PDN A;  4HGU A;  2RC4 A;  1VDD A;  2ORV A;  1X74 A;  2LUY A;  4UXI A;  1FAQ A;  4MPI A;  1MJB A;  1BUS A;  1TBQ R;  2ENZ A;  2PQ8 A;  3R5D A;  2F3C I;  2ROW A;  1SGP I;  2YQP A;  3MEK A;  1IY5 A;  1M8B A;  2B0U C;  2RIJ A;  1TUR A;  4E1P A;  2N17 A;  1SGD I;  2NU4 I;  3BJI A;  1K7U A;  1KBE A;  3VDU A;  1WTJ A;  5J8C A;  1UVF A;  5HQ8 A;  1M8C A;  2NU0 I;  3TOA A;  1CT4 I;  2CJS C;  1SGY I;  2UVO A;  2LB7 A;  2E73 A;  1TBO A;  1XA6 A;  2DIP A;  2GIV A;  5E3P A;  5EX0 A;  1LR8 A;  3QTL D;  1OMU A;  1W3S A;  3R5B A;  4UXJ A;  1MJ9 A;  3TJQ A;  2CWH A;  2LEO A;  2OZU A;  3R5A A;  2NU2 I;  2WCY A;  3TO9 A;  1BMO A;  2V1C C;  1HEV A;  1OVO A;  3UEJ A;  1OYV I;  1ULM A;  1Y1C A;  2NU1 I;  1FAR A;  1FY7 A;  2GKT I;  3UFF A;  2DKV A;  2KCX A;  4L9M A;  1IW4 A;  2QQD A;  1CGI I;  1LR9 A;  2QQE A;  2JXD A;  3UGI A;  1UUC A;  1U5K A;  2CWG A;  1CGJ I;  2OD1 A;  3E2I A;  4JCV E;  3UGL A;  1X4S A;  2E5R A;  2J87 A;  1S20 A;  3KY9 A;  1SGR I;  1V1I A;  1ULK A;  1W4R A;  1TOT A;  2V53 A;  3UOE A;  3VE5 A;  2GKV A;  1TIH A;  1PTQ A;  1N13 A;  1TGS I;  3QAH A;  1PCE A;  1CT2 I;  2WGC A;  2W0T A;  3FC3 A;  1IY6 A;  1H0Z A;  1Y8F A;  3GOX A;  1R79 A;  1SGN I;  2QPO A;  1R0R I;  2GVI A;  1P9Z A;  2SGF I;  2QQ0 A;  2FNF X;  1TBR R;  4E1R A;  1HJA I;  2Y0M A;  1DS3 I;  2SGQ I;  1K7V A;  1WGC A;  2UZ3 A;  5CCM A;  1Q9B A;  3D00 A;  3OXG A;  2DB6 A;  9WGA A;  1PTR A;  1PJU A;  3OL0 A;  3FSY A;  1CHO I;  1SGE I;  2M5X A;  7WGA A;  1CT0 I;  3QWP A;  2P6A C;  3SGB I;  3VDP A;  4B6D A;  2ARP F;  2NU3 I;  2KMO A;  1WGT A;  1ULN A;  2SGE I; 
#chains in the Genus database with same CATH homology
 3SEK C;  2JZM A;  5HI7 A;  4A24 A;  5JHW C;  5DAE A;  1CE3 A;  1Z7K B;  1LR7 A;  5EX3 A;  5FUV A;  1MT1 A;  1V1H A;  5FUX A;  3UGD A;  4UXH A;  2SGD I;  2ODD A;  1XX6 A;  2JA1 A;  2KMQ A;  2B8T A;  3OVO A;  2BUS A;  1TBN A;  1YTP A;  2KMP A;  3OXF A;  2VRW B;  1NUB A;  4OVO A;  1RFH A;  1TUS A;  2N52 A;  3RU0 A;  2KMR A;  3B4V C;  1SGQ I;  2OVO A;  2XRC A;  3SGQ I;  2JYY A;  3OXL A;  3UEY A;  3E59 A;  3HH2 C;  2GKR I;  4GI3 C;  2JW6 A;  1OMT A;  2K9H A;  1DS2 I;  1Y1B A;  2L7X A;  1KMA A;  1PPF I;  2ENN A;  5FUW A;  2A20 A;  2QQC A;  5CCL A;  2ORW A;  1HPT A;  2SGP I;  4FKD A;  2V1C A;  1FYB A;  2N71 A;  5FUY A;  3CXL A;  1AN1 I;  2ELI A;  1XBT A;  2L8E A;  2YUU A;  2WVJ A;  2J9R A;  4SGB I;  2N1A B;  2ERW A;  1HDL A;  1CSO I;  1UVG A;  1YU6 C;  3PDN A;  4HGU A;  1VDD A;  2ORV A;  1X74 A;  2LUY A;  4UXI A;  1FAQ A;  1BUS A;  1TBQ R;  2ENZ A;  2F3C I;  2ROW A;  1SGP I;  2YQP A;  3MEK A;  1IY5 A;  1M8B A;  2B0U C;  1TUR A;  4E1P A;  2N17 A;  1SGD I;  2NU4 I;  3BJI A;  1KBE A;  3VDU A;  1UVF A;  5HQ8 A;  1M8C A;  2NU0 I;  1CT4 I;  2CJS C;  1SGY I;  1KBF A;  2E73 A;  1TBO A;  1XA6 A;  2DIP A;  5EX0 A;  1LR8 A;  3QTL D;  1OMU A;  1W3S A;  4UXJ A;  3TJQ A;  2LEO A;  2NU2 I;  2WCY A;  1BMO A;  2V1C C;  1OVO A;  3UEJ A;  1OYV I;  1Y1C A;  2NU1 I;  1FAR A;  2GKT I;  3UFF A;  2KCX A;  4L9M A;  1IW4 A;  2QQD A;  1CGI I;  1LR9 A;  2QQE A;  2JXD A;  3UGI A;  1UUC A;  1U5K A;  3E2I A;  1CGJ I;  2OD1 A;  4JCV E;  3UGL A;  1X4S A;  2E5R A;  2J87 A;  3KY9 A;  1SGR I;  1V1I A;  1W4R A;  1TOT A;  2V53 A;  3VE5 A;  2GKV A;  1TIH A;  1PTQ A;  1N13 A;  1TGS I;  1PCE A;  1CT2 I;  3FC3 A;  2W0T A;  1H0Z A;  1IY6 A;  1Y8F A;  3GOX A;  1R79 A;  1SGN I;  2QPO A;  1R0R I;  2GVI A;  2SGF I;  2QQ0 A;  2FNF X;  1TBR R;  4E1R A;  1HJA I;  1DS3 I;  2SGQ I;  2UZ3 A;  5CCM A;  3D00 A;  3OXG A;  2DB6 A;  1PTR A;  1PJU A;  3OL0 A;  1CHO I;  1SGE I;  2M5X A;  1CT0 I;  3QWP A;  2P6A C;  3SGB I;  3VDP A;  4B6D A;  2ARP F;  2NU3 I;  2KMO A;  2SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...