3UGDA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
pubmed doi rcsb
molecule keywords Protein kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ugdA01
2DB6A 2J87A 1XA6A 2GVIA 2ORWA 2VRWB 4UXJA 3UEYA 1PTQA 2QPOA 2ENNA 1TBOA 2J9RA 2YUUA 3UEJA 1PTRA 2E73A 3CXLA 4UXIA 2B8TA 2QQ0A 3UGIA 3KY9A 2ELIA 4B6DA 3UGDA 2WVJA 4L9MA 1W4RA 1XX6A 3UGLA 2ROWA 3BJIA 3E2IA 1XBTA 1R79A 2ENZA 2QQEA 5FUVA 1FARA 5FUWA 1RFHA 2ORVA 3UFFA 4FKDA 1TBNA 1FAQA 2UZ3A 2JA1A 2FNFX 1Y8FA 4UXHA 1KBFA 1KBEA 5FUYA 5FUXA
chains in the Genus database with same CATH superfamily
3UEYA 2B0UC 2QPOA 3PDNA 3R5BA 2J9RA 2RIJA 3VE5A 2E73A 5JHWC 2K9HA 3KY9A 3TO9A 2OZUA 3FSYA 3R5CA 2V53A 4B6DA 1HJAI 1WTJA 1IW4A 1MJ9A 1MJBA 1CT0I 1OYVI 1SGEI 2ROWA 1LR8A 2KMPA 2LB7A 1CGII 4MPIA 2ENZA 1H0ZA 2QQEA 1WGCA 2ERWA 2DIPA 1MJAA 1FARA 1TIHA 5E3QA 2JYYA 2ORVA 4SGBI 1FY7A 4GI3C 1TBRR 3R5DA 1V1IA 1WKXA 2NU1I 2JW6A 1SGPI 1TBNA 1TURA 2JXDA 2ODDA 1ULMA 5EX0A 3UOEA 1CGJI 2CWHA 2JZMA 1NXUA 2V1CA 4JCVE 5EX3A 5FUYA 2DKVA 2L7XA 2N17A 2SGPI 2SGQI 2L8EA 2W0TA 2GKVA 1S20A 1BMOA 2ENNA 1TBOA 3OVOA 1PJUA 2YUUA 1TBQR 1YTPA 1CHOI 3CXLA 2PQ8A 2B8TA 5CCMA 2QQ0A 1HPTA 2RC4A 3UGIA 3E59A 4WP4A 2ELIA 2NU0I 2QQDA 2WVJA 3GOXA 1W4RA 1XX6A 2NU3I 3UGLA 1CSOI 3OXFA 2X3TA 5J8FA 1UVGA 3E2IA 1K7TA 1CE3A 2WCYA 1ULKA 3OL0A 5E3PA 5FUVA 4DNCA 1IY6A 1P9ZA 1RFHA 1KMAA 2NU4I 2N52A 2YQPA 1SGQI 3UFFA 1TOTA 2GIVA 2KCXA 4FKDA 4AMLA 3VDPA 9WGAA 2LUYA 2UZ3A 1PCEA 2LEOA 2GKTI 2E5RA 1KBEA 2N1AB 3QTLD 5CCLA 2SGFI 2F3CI 2BUSA 1NUBA 2ORWA 2GVIA 4UXJA 2VRWB 1U5KA 2OVOA 2NU2I 3RU0A 2KMQA 1TUSA 4OVOA 3UEJA 1W3SA 1X4SA 1OMUA 1PTRA 1R0RI 4UXIA 1MT1A 2A20A 1K7VA 4HGUA 1BUSA 1LR7A 3UGDA 1SGRI 4L9MA 3SGBI 1LR9A 2X52A 1OVOA 3BJIA 3TJQA 1XBTA 5E3RA 1UHAA 1M8CA 1R79A 3MEKA 1Z7KB 3SGQI 2CWGA 1FYBA 3TO7A 2WGCA 3FC3A 1UVFA 2Y0MA 3VDUA 1FAQA 1CT4I 2JA1A 1Y8FA 2QQCA 4UXHA 1KBFA 1Q9BA 1SGDI 3QWPA 5HQ8A 2UVOA 4E1PA 2SGEI 1AN1I 1ULNA 2OU2A 5FUXA 2V1CC 2DB6A 2J87A 1XA6A 5DAEA 1K7UA 1OMTA 1PTQA 1VDDA 2CJSC 3B4VC 1Y1BA 1HEVA 2N71A 3OXGA 5HI7A 1M8BA 1Y1CA 2XRCA 5J8CA 1YU6C 1UUCA 2M5XA 3FSXA 1N13A 1P9GA 2KMRA 1Z2IA 3OXLA 3R5AA 3TO6A 3TOBA 3TOAA 3D00A 2OD1A 2P6AC 7WGAA 1CT2I 3HH2C 1PPFI 5FUWA 1HDLA 4E1RA 1IY5A 3SEKC 2ARPF 2KMOA 1TGSI 3QAHA 1X74A 1WGTA 2FNFX 1SGYI 4A24A 1V1HA 2GKRI 2SGDI 1DS2I 1SGNI 1DS3I 2CWFA
chains in the Genus database with same CATH topology
3UEYA 2B0UC 2QPOA 3PDNA 3VE5A 2J9RA 2E73A 5JHWC 2K9HA 3KY9A 4B6DA 2V53A 1HJAI 1IW4A 1OYVI 2ROWA 1CT0I 1SGEI 1LR8A 2KMPA 1CGII 1H0ZA 2ENZA 2QQEA 2ERWA 2DIPA 1FARA 1TIHA 2JYYA 2ORVA 4SGBI 4GI3C 1TBRR 1V1IA 2ODDA 2NU1I 2JW6A 1SGPI 1TBNA 1TURA 2JXDA 5EX0A 1CGJI 2V1CA 2JZMA 4JCVE 5EX3A 5FUYA 2L7XA 2N17A 2SGPI 2SGQI 2L8EA 2W0TA 2GKVA 1BMOA 2ENNA 1TBOA 3OVOA 1PJUA 2YUUA 1TBQR 1YTPA 1CHOI 3CXLA 2B8TA 5CCMA 2QQ0A 1HPTA 3UGIA 3E59A 2ELIA 2NU0I 2QQDA 2WVJA 3GOXA 1W4RA 1XX6A 2NU3I 3UGLA 1CSOI 3OXFA 1UVGA 3E2IA 1CE3A 2WCYA 3OL0A 5FUVA 1IY6A 1KMAA 1RFHA 2NU4I 2N52A 2YQPA 1SGQI 3UFFA 1TOTA 2KCXA 4FKDA 3VDPA 2LUYA 2UZ3A 1PCEA 2LEOA 2GKTI 2E5RA 1KBEA 2N1AB 3QTLD 5CCLA 2SGFI 2F3CI 2BUSA 1NUBA 2ORWA 2GVIA 4UXJA 2VRWB 1U5KA 2OVOA 2NU2I 3RU0A 2KMQA 1TUSA 4OVOA 3UEJA 1W3SA 1X4SA 1OMUA 1PTRA 1R0RI 4UXIA 1MT1A 2A20A 4HGUA 1BUSA 1LR7A 3UGDA 1SGRI 4L9MA 3SGBI 1LR9A 3BJIA 1OVOA 3TJQA 1XBTA 1M8CA 1R79A 3MEKA 3SGQI 1FYBA 1SGNI 3FC3A 1UVFA 3VDUA 1FAQA 1CT4I 2JA1A 1Y8FA 2QQCA 4UXHA 1KBFA 1SGDI 5HQ8A 3QWPA 4E1PA 2SGEI 1AN1I 5FUXA 2V1CC 2DB6A 2J87A 1XA6A 5DAEA 3B4VC 1OMTA 1PTQA 1VDDA 2CJSC 1Y1BA 2N71A 3OXGA 5HI7A 1M8BA 1Y1CA 2XRCA 1YU6C 1UUCA 2M5XA 1N13A 2KMRA 3OXLA 3D00A 2OD1A 2P6AC 1CT2I 3HH2C 1PPFI 5FUWA 1HDLA 4E1RA 1IY5A 3SEKC 2ARPF 2KMOA 1TGSI 1X74A 2FNFX 1SGYI 4A24A 1V1HA 2GKRI 2SGDI 1DS2I 1Z7KB 1DS3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB6 A;  2J87 A;  1XA6 A;  2GVI A;  2ORW A;  2VRW B;  4UXJ A;  3UEY A;  1PTQ A;  2QPO A;  2ENN A;  1TBO A;  2J9R A;  2YUU A;  3UEJ A;  1PTR A;  2E73 A;  3CXL A;  4UXI A;  2B8T A;  2QQ0 A;  3UGI A;  3KY9 A;  2ELI A;  4B6D A;  3UGD A;  2WVJ A;  4L9M A;  1W4R A;  1XX6 A;  3UGL A;  2ROW A;  3BJI A;  3E2I A;  1XBT A;  1R79 A;  2ENZ A;  2QQE A;  5FUV A;  1FAR A;  5FUW A;  1RFH A;  2ORV A;  3UFF A;  4FKD A;  1TBN A;  1FAQ A;  2UZ3 A;  2JA1 A;  2FNF X;  1Y8F A;  4UXH A;  1KBF A;  1KBE A;  5FUY A;  5FUX A; 
#chains in the Genus database with same CATH topology
 3UEY A;  2B0U C;  2QPO A;  3PDN A;  3R5B A;  2J9R A;  2RIJ A;  3VE5 A;  2E73 A;  5JHW C;  2K9H A;  3KY9 A;  3TO9 A;  2OZU A;  3FSY A;  3R5C A;  2V53 A;  4B6D A;  1HJA I;  1WTJ A;  1IW4 A;  1MJ9 A;  1MJB A;  1CT0 I;  1OYV I;  1SGE I;  2ROW A;  1LR8 A;  2KMP A;  2LB7 A;  1CGI I;  4MPI A;  2ENZ A;  1H0Z A;  2QQE A;  1WGC A;  2ERW A;  2DIP A;  1MJA A;  1FAR A;  1TIH A;  5E3Q A;  2JYY A;  2ORV A;  4SGB I;  1FY7 A;  4GI3 C;  1TBR R;  3R5D A;  1V1I A;  1WKX A;  2NU1 I;  2JW6 A;  1SGP I;  1TBN A;  1TUR A;  2JXD A;  2ODD A;  1ULM A;  5EX0 A;  3UOE A;  1CGJ I;  2CWH A;  2JZM A;  1NXU A;  2V1C A;  4JCV E;  5EX3 A;  5FUY A;  2DKV A;  2L7X A;  2N17 A;  2SGP I;  2SGQ I;  2L8E A;  2W0T A;  2GKV A;  1S20 A;  1BMO A;  2ENN A;  1TBO A;  3OVO A;  1PJU A;  2YUU A;  1TBQ R;  1YTP A;  1CHO I;  3CXL A;  2PQ8 A;  2B8T A;  5CCM A;  2QQ0 A;  1HPT A;  2RC4 A;  3UGI A;  3E59 A;  4WP4 A;  2ELI A;  2NU0 I;  2QQD A;  2WVJ A;  3GOX A;  1W4R A;  1XX6 A;  2NU3 I;  3UGL A;  1CSO I;  3OXF A;  2X3T A;  5J8F A;  1UVG A;  3E2I A;  1K7T A;  1CE3 A;  2WCY A;  1ULK A;  3OL0 A;  5E3P A;  5FUV A;  4DNC A;  1IY6 A;  1P9Z A;  1RFH A;  1KMA A;  2NU4 I;  2N52 A;  2YQP A;  1SGQ I;  3UFF A;  1TOT A;  2GIV A;  2KCX A;  4FKD A;  4AML A;  3VDP A;  9WGA A;  2LUY A;  2UZ3 A;  1PCE A;  2LEO A;  2GKT I;  2E5R A;  1KBE A;  2N1A B;  3QTL D;  5CCL A;  2SGF I;  2F3C I;  2BUS A;  1NUB A;  2ORW A;  2GVI A;  4UXJ A;  2VRW B;  1U5K A;  2OVO A;  2NU2 I;  3RU0 A;  2KMQ A;  1TUS A;  4OVO A;  3UEJ A;  1W3S A;  1X4S A;  1OMU A;  1PTR A;  1R0R I;  4UXI A;  1MT1 A;  2A20 A;  1K7V A;  4HGU A;  1BUS A;  1LR7 A;  3UGD A;  1SGR I;  4L9M A;  3SGB I;  1LR9 A;  2X52 A;  1OVO A;  3BJI A;  3TJQ A;  1XBT A;  5E3R A;  1UHA A;  1M8C A;  1R79 A;  3MEK A;  1Z7K B;  3SGQ I;  2CWG A;  1FYB A;  3TO7 A;  2WGC A;  3FC3 A;  1UVF A;  2Y0M A;  3VDU A;  1FAQ A;  1CT4 I;  2JA1 A;  1Y8F A;  2QQC A;  4UXH A;  1KBF A;  1Q9B A;  1SGD I;  3QWP A;  5HQ8 A;  2UVO A;  4E1P A;  2SGE I;  1AN1 I;  1ULN A;  2OU2 A;  5FUX A;  2V1C C;  2DB6 A;  2J87 A;  1XA6 A;  5DAE A;  1K7U A;  1OMT A;  1PTQ A;  1VDD A;  2CJS C;  3B4V C;  1Y1B A;  1HEV A;  2N71 A;  3OXG A;  5HI7 A;  1M8B A;  1Y1C A;  2XRC A;  5J8C A;  1YU6 C;  1UUC A;  2M5X A;  3FSX A;  1N13 A;  1P9G A;  2KMR A;  1Z2I A;  3OXL A;  3R5A A;  3TO6 A;  3TOB A;  3TOA A;  3D00 A;  2OD1 A;  2P6A C;  7WGA A;  1CT2 I;  3HH2 C;  1PPF I;  5FUW A;  1HDL A;  4E1R A;  1IY5 A;  3SEK C;  2ARP F;  2KMO A;  1TGS I;  3QAH A;  1X74 A;  1WGT A;  2FNF X;  1SGY I;  4A24 A;  1V1H A;  2GKR I;  2SGD I;  1DS2 I;  1SGN I;  1DS3 I;  2CWF A; 
#chains in the Genus database with same CATH homology
 3UEY A;  2B0U C;  2QPO A;  3PDN A;  3VE5 A;  2J9R A;  2E73 A;  5JHW C;  2K9H A;  3KY9 A;  4B6D A;  2V53 A;  1HJA I;  1IW4 A;  1OYV I;  2ROW A;  1CT0 I;  1SGE I;  1LR8 A;  2KMP A;  1CGI I;  1H0Z A;  2ENZ A;  2QQE A;  2ERW A;  2DIP A;  1FAR A;  1TIH A;  2JYY A;  2ORV A;  4SGB I;  4GI3 C;  1TBR R;  1V1I A;  2ODD A;  2NU1 I;  2JW6 A;  1SGP I;  1TBN A;  1TUR A;  2JXD A;  5EX0 A;  1CGJ I;  2V1C A;  2JZM A;  4JCV E;  5EX3 A;  5FUY A;  2L7X A;  2N17 A;  2SGP I;  2SGQ I;  2L8E A;  2W0T A;  2GKV A;  1BMO A;  2ENN A;  1TBO A;  3OVO A;  1PJU A;  2YUU A;  1TBQ R;  1YTP A;  1CHO I;  3CXL A;  2B8T A;  5CCM A;  2QQ0 A;  1HPT A;  3UGI A;  3E59 A;  2ELI A;  2NU0 I;  2QQD A;  2WVJ A;  3GOX A;  1W4R A;  1XX6 A;  2NU3 I;  3UGL A;  1CSO I;  3OXF A;  1UVG A;  3E2I A;  1CE3 A;  2WCY A;  3OL0 A;  5FUV A;  1IY6 A;  1KMA A;  1RFH A;  2NU4 I;  2N52 A;  2YQP A;  1SGQ I;  3UFF A;  1TOT A;  2KCX A;  4FKD A;  3VDP A;  2LUY A;  2UZ3 A;  1PCE A;  2LEO A;  2GKT I;  2E5R A;  1KBE A;  2N1A B;  3QTL D;  5CCL A;  2SGF I;  2F3C I;  2BUS A;  1NUB A;  2ORW A;  2GVI A;  4UXJ A;  2VRW B;  1U5K A;  2OVO A;  2NU2 I;  3RU0 A;  2KMQ A;  1TUS A;  4OVO A;  3UEJ A;  1W3S A;  1X4S A;  1OMU A;  1PTR A;  1R0R I;  4UXI A;  1MT1 A;  2A20 A;  4HGU A;  1BUS A;  1LR7 A;  3UGD A;  1SGR I;  4L9M A;  3SGB I;  1LR9 A;  3BJI A;  1OVO A;  3TJQ A;  1XBT A;  1M8C A;  1R79 A;  3MEK A;  3SGQ I;  1FYB A;  1SGN I;  3FC3 A;  1UVF A;  3VDU A;  1FAQ A;  1CT4 I;  2JA1 A;  1Y8F A;  2QQC A;  4UXH A;  1KBF A;  1SGD I;  5HQ8 A;  3QWP A;  4E1P A;  2SGE I;  1AN1 I;  5FUX A;  2V1C C;  2DB6 A;  2J87 A;  1XA6 A;  5DAE A;  3B4V C;  1OMT A;  1PTQ A;  1VDD A;  2CJS C;  1Y1B A;  2N71 A;  3OXG A;  5HI7 A;  1M8B A;  1Y1C A;  2XRC A;  1YU6 C;  1UUC A;  2M5X A;  1N13 A;  2KMR A;  3OXL A;  3D00 A;  2OD1 A;  2P6A C;  1CT2 I;  3HH2 C;  1PPF I;  5FUW A;  1HDL A;  4E1R A;  1IY5 A;  3SEK C;  2ARP F;  2KMO A;  1TGS I;  1X74 A;  2FNF X;  1SGY I;  4A24 A;  1V1H A;  2GKR I;  2SGD I;  1DS2 I;  1Z7K B;  1DS3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...