3UGLA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
molecule keywords Proteine kinase C delta type
molecule tags Metal binding protein
source organism Mus musculus
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uglA01
1RFHA 2QQ0A 4L9MA 2J9RA 3BJIA 2FNFX 2B8TA 1TBOA 2E73A 3UGIA 2QQEA 3UGLA 4UXJA 5FUXA 2ELIA 5FUYA 1PTRA 1R79A 3UEYA 3UGDA 1XA6A 4FKDA 1XX6A 1FARA 2VRWB 2YUUA 1Y8FA 2QPOA 3CXLA 4UXHA 2GVIA 5FUVA 1KBEA 2DB6A 2ENZA 1W4RA 2ROWA 4B6DA 1XBTA 5FUWA 1FAQA 2ORVA 2ENNA 2ORWA 3E2IA 2UZ3A 2J87A 2WVJA 1TBNA 1KBFA 3UEJA 3UFFA 2JA1A 1PTQA 3KY9A 4UXIA
chains in the Genus database with same CATH superfamily
1OVOA 3FSXA 1K7VA 4DNCA 1SGDI 3TO9A 1Z2IA 3QWPA 2PQ8A 3PDNA 1TBOA 4SGBI 1PCEA 3KY9A 3UGLA 2JW6A 4UXJA 1WGCA 2CWFA 1CSOI 2WCYA 3MEKA 2ERWA 1WTJA 2K9HA 3R5BA 1X74A 4E1PA 1WKXA 2KMRA 5HQ8A 2V1CC 1OMTA 4UXHA 2GVIA 3D00A 1P9ZA 1WGTA 2DB6A 2GKTI 1YTPA 4B6DA 2BUSA 5FUWA 3RU0A 1S20A 2ORWA 2NU1I 1N13A 2UZ3A 1OMUA 3OXFA 2LEOA 1W3SA 1BMOA 1NUBA 2X52A 3TOAA 1HEVA 3UEJA 2CWHA 1HJAI 5E3PA 1TBQR 1BUSA 2LUYA 2QQ0A 1H0ZA 2CWGA 2J9RA 2NU3I 1TUSA 3HH2C 2FNFX 5CCMA 2B8TA 7WGAA 5EX3A 3OVOA 1UVFA 3VDPA 2KMOA 2OVOA 2L8EA 2GKRI 5FUYA 1Y1CA 2ODDA 1FYBA 1SGEI 1XA6A 1XX6A 2N1AB 2WGCA 1FARA 2KMPA 1IY6A 1SGYI 3VE5A 1KBEA 2XRCA 3QAHA 2JZMA 2KMQA 1UVGA 1W4RA 2A20A 4E1RA 1XBTA 1CE3A 3SGQI 2ORVA 2ENNA 3FC3A 5E3RA 4OVOA 1OYVI 1MJAA 1MJ9A 1CHOI 2N52A 2WVJA 3TOBA 1DS3I 1LR7A 5DAEA 1K7UA 1PPFI 2GIVA 1SGNI 1TBRR 2JA1A 2LB7A 2NU0I 2RIJA 1RFHA 2DKVA 2YQPA 1IW4A 1FAQA 4L9MA 9WGAA 3BJIA 3R5CA 1HPTA 2E73A 1V1IA 2N71A 3OL0A 3UGIA 3GOXA 1HDLA 1P9GA 2QQEA 1ULKA 1YU6C 2KCXA 2ELIA 5FUXA 1PTRA 1Y1BA 3UEYA 2NU2I 4MPIA 3E59A 3VDUA 2E5RA 4FKDA 1IY5A 1KMAA 1TIHA 3OXLA 3B4VC 2VRWB 2YUUA 1Y8FA 1K7TA 1TURA 2L7XA 2N17A 3CXLA 5FUVA 1ULNA 1SGRI 1X4SA 2ROWA 1U5KA 2JYYA 2QQCA 2SGEI 2UVOA 2CJSC 2Y0MA 3OXGA 4HGUA 3E2IA 2SGDI 1CGJI 1SGPI 2W0TA 3FSYA 1LR8A 3SGBI 3R5AA 4GI3C 5E3QA 5EX0A 2OU2A 4AMLA 1V1HA 1KBFA 2V53A 5CCLA 3UFFA 1M8CA 2DIPA 5J8FA 1VDDA 3TO6A 5J8CA 2OD1A 2QQDA 1DS2I 1Z7KB 2NU4I 2F3CI 1TGSI 1MJBA 2X3TA 3SEKC 1CT4I 1NXUA 2SGPI 3UOEA 2JXDA 4WP4A 1UHAA 4JCVE 1CGII 1SGQI 2B0UC 1CT0I 2GKVA 2M5XA 3TO7A 5JHWC 1R79A 1TOTA 1CT2I 3UGDA 1FY7A 2ARPF 3TJQA 2QPOA 1MT1A 1R0RI 2ENZA 2SGQI 1LR9A 1M8BA 1Q9BA 1UUCA 2V1CA 3QTLD 5HI7A 4A24A 2P6AC 2J87A 1ULMA 1AN1I 1TBNA 2RC4A 2SGFI 3R5DA 1PTQA 2OZUA 1PJUA 4UXIA
chains in the Genus database with same CATH topology
1OVOA 1SGDI 3QWPA 3PDNA 1TBOA 4SGBI 1PCEA 3UGLA 2JW6A 4UXJA 2WCYA 3MEKA 1CSOI 2ERWA 2K9HA 1X74A 4E1PA 2KMRA 5HQ8A 2V1CC 1OMTA 4UXHA 2GVIA 3D00A 2DB6A 2GKTI 1YTPA 4B6DA 2BUSA 5FUWA 3RU0A 2ORWA 2NU1I 1N13A 2UZ3A 1OMUA 3OXFA 2LEOA 1BMOA 1NUBA 1W3SA 3UEJA 1HJAI 1TBQR 1BUSA 2LUYA 2QQ0A 1H0ZA 2J9RA 2NU3I 1TUSA 3HH2C 2FNFX 5CCMA 2B8TA 5EX3A 3OVOA 1UVFA 3VDPA 2KMOA 2OVOA 2L8EA 2GKRI 5FUYA 1Y1CA 2ODDA 1FYBA 1SGEI 1XA6A 1XX6A 2N1AB 1FARA 2KMPA 1IY6A 1SGYI 3VE5A 1KBEA 2XRCA 2JZMA 2KMQA 1UVGA 1W4RA 2A20A 4E1RA 1XBTA 1CE3A 3SGQI 2ORVA 2ENNA 3FC3A 4OVOA 1OYVI 1CHOI 2N52A 2WVJA 1DS3I 1LR7A 5DAEA 1PPFI 2JA1A 1SGNI 1TBRR 2NU0I 1RFHA 2YQPA 1IW4A 4L9MA 3BJIA 1HPTA 2E73A 1V1IA 2N71A 3OL0A 3UGIA 3GOXA 1HDLA 2QQEA 1YU6C 2KCXA 2ELIA 5FUXA 1PTRA 1Y1BA 3UEYA 2NU2I 3VDUA 3E59A 1IY5A 2E5RA 4FKDA 1KMAA 1TIHA 3OXLA 3B4VC 2VRWB 2YUUA 1Y8FA 1TURA 2L7XA 2N17A 3CXLA 5FUVA 1SGRI 1X4SA 2ROWA 1U5KA 2JYYA 2QQCA 2SGEI 3OXGA 2CJSC 4HGUA 1FAQA 3E2IA 2SGDI 1CGJI 1SGPI 2W0TA 3SGBI 1LR8A 4GI3C 5EX0A 1V1HA 1KBFA 2V53A 5CCLA 3UFFA 1M8CA 2DIPA 1VDDA 2OD1A 2QQDA 1DS2I 1Z7KB 2NU4I 2F3CI 1TGSI 3SEKC 1CT4I 2SGPI 2JXDA 4JCVE 1CGII 1SGQI 2B0UC 1CT0I 2GKVA 2M5XA 5JHWC 1R79A 1TOTA 1CT2I 3UGDA 2ARPF 3TJQA 2QPOA 1MT1A 1R0RI 2ENZA 2SGQI 1LR9A 1M8BA 1UUCA 2V1CA 3QTLD 5HI7A 4A24A 2P6AC 2J87A 1AN1I 1TBNA 2SGFI 1PTQA 3KY9A 1PJUA 4UXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFH A;  2QQ0 A;  4L9M A;  2J9R A;  3BJI A;  2FNF X;  2B8T A;  1TBO A;  2E73 A;  3UGI A;  2QQE A;  3UGL A;  4UXJ A;  5FUX A;  2ELI A;  5FUY A;  1PTR A;  1R79 A;  3UEY A;  3UGD A;  1XA6 A;  4FKD A;  1XX6 A;  1FAR A;  2VRW B;  2YUU A;  1Y8F A;  2QPO A;  3CXL A;  4UXH A;  2GVI A;  5FUV A;  1KBE A;  2DB6 A;  2ENZ A;  1W4R A;  2ROW A;  4B6D A;  1XBT A;  5FUW A;  1FAQ A;  2ORV A;  2ENN A;  2ORW A;  3E2I A;  2UZ3 A;  2J87 A;  2WVJ A;  1TBN A;  1KBF A;  3UEJ A;  3UFF A;  2JA1 A;  1PTQ A;  3KY9 A;  4UXI A; 
#chains in the Genus database with same CATH topology
 1OVO A;  3FSX A;  1K7V A;  4DNC A;  1SGD I;  3TO9 A;  1Z2I A;  3QWP A;  2PQ8 A;  3PDN A;  1TBO A;  4SGB I;  1PCE A;  3KY9 A;  3UGL A;  2JW6 A;  4UXJ A;  1WGC A;  2CWF A;  1CSO I;  2WCY A;  3MEK A;  2ERW A;  1WTJ A;  2K9H A;  3R5B A;  1X74 A;  4E1P A;  1WKX A;  2KMR A;  5HQ8 A;  2V1C C;  1OMT A;  4UXH A;  2GVI A;  3D00 A;  1P9Z A;  1WGT A;  2DB6 A;  2GKT I;  1YTP A;  4B6D A;  2BUS A;  5FUW A;  3RU0 A;  1S20 A;  2ORW A;  2NU1 I;  1N13 A;  2UZ3 A;  1OMU A;  3OXF A;  2LEO A;  1W3S A;  1BMO A;  1NUB A;  2X52 A;  3TOA A;  1HEV A;  3UEJ A;  2CWH A;  1HJA I;  5E3P A;  1TBQ R;  1BUS A;  2LUY A;  2QQ0 A;  1H0Z A;  2CWG A;  2J9R A;  2NU3 I;  1TUS A;  3HH2 C;  2FNF X;  5CCM A;  2B8T A;  7WGA A;  5EX3 A;  3OVO A;  1UVF A;  3VDP A;  2KMO A;  2OVO A;  2L8E A;  2GKR I;  5FUY A;  1Y1C A;  2ODD A;  1FYB A;  1SGE I;  1XA6 A;  1XX6 A;  2N1A B;  2WGC A;  1FAR A;  2KMP A;  1IY6 A;  1SGY I;  3VE5 A;  1KBE A;  2XRC A;  3QAH A;  2JZM A;  2KMQ A;  1UVG A;  1W4R A;  2A20 A;  4E1R A;  1XBT A;  1CE3 A;  3SGQ I;  2ORV A;  2ENN A;  3FC3 A;  5E3R A;  4OVO A;  1OYV I;  1MJA A;  1MJ9 A;  1CHO I;  2N52 A;  2WVJ A;  3TOB A;  1DS3 I;  1LR7 A;  5DAE A;  1K7U A;  1PPF I;  2GIV A;  1SGN I;  1TBR R;  2JA1 A;  2LB7 A;  2NU0 I;  2RIJ A;  1RFH A;  2DKV A;  2YQP A;  1IW4 A;  1FAQ A;  4L9M A;  9WGA A;  3BJI A;  3R5C A;  1HPT A;  2E73 A;  1V1I A;  2N71 A;  3OL0 A;  3UGI A;  3GOX A;  1HDL A;  1P9G A;  2QQE A;  1ULK A;  1YU6 C;  2KCX A;  2ELI A;  5FUX A;  1PTR A;  1Y1B A;  3UEY A;  2NU2 I;  4MPI A;  3E59 A;  3VDU A;  2E5R A;  4FKD A;  1IY5 A;  1KMA A;  1TIH A;  3OXL A;  3B4V C;  2VRW B;  2YUU A;  1Y8F A;  1K7T A;  1TUR A;  2L7X A;  2N17 A;  3CXL A;  5FUV A;  1ULN A;  1SGR I;  1X4S A;  2ROW A;  1U5K A;  2JYY A;  2QQC A;  2SGE I;  2UVO A;  2CJS C;  2Y0M A;  3OXG A;  4HGU A;  3E2I A;  2SGD I;  1CGJ I;  1SGP I;  2W0T A;  3FSY A;  1LR8 A;  3SGB I;  3R5A A;  4GI3 C;  5E3Q A;  5EX0 A;  2OU2 A;  4AML A;  1V1H A;  1KBF A;  2V53 A;  5CCL A;  3UFF A;  1M8C A;  2DIP A;  5J8F A;  1VDD A;  3TO6 A;  5J8C A;  2OD1 A;  2QQD A;  1DS2 I;  1Z7K B;  2NU4 I;  2F3C I;  1TGS I;  1MJB A;  2X3T A;  3SEK C;  1CT4 I;  1NXU A;  2SGP I;  3UOE A;  2JXD A;  4WP4 A;  1UHA A;  4JCV E;  1CGI I;  1SGQ I;  2B0U C;  1CT0 I;  2GKV A;  2M5X A;  3TO7 A;  5JHW C;  1R79 A;  1TOT A;  1CT2 I;  3UGD A;  1FY7 A;  2ARP F;  3TJQ A;  2QPO A;  1MT1 A;  1R0R I;  2ENZ A;  2SGQ I;  1LR9 A;  1M8B A;  1Q9B A;  1UUC A;  2V1C A;  3QTL D;  5HI7 A;  4A24 A;  2P6A C;  2J87 A;  1ULM A;  1AN1 I;  1TBN A;  2RC4 A;  2SGF I;  3R5D A;  1PTQ A;  2OZU A;  1PJU A;  4UXI A; 
#chains in the Genus database with same CATH homology
 1OVO A;  1SGD I;  3QWP A;  3PDN A;  1TBO A;  4SGB I;  1PCE A;  3UGL A;  2JW6 A;  4UXJ A;  2WCY A;  3MEK A;  1CSO I;  2ERW A;  2K9H A;  1X74 A;  4E1P A;  2KMR A;  5HQ8 A;  2V1C C;  1OMT A;  4UXH A;  2GVI A;  3D00 A;  2DB6 A;  2GKT I;  1YTP A;  4B6D A;  2BUS A;  5FUW A;  3RU0 A;  2ORW A;  2NU1 I;  1N13 A;  2UZ3 A;  1OMU A;  3OXF A;  2LEO A;  1BMO A;  1NUB A;  1W3S A;  3UEJ A;  1HJA I;  1TBQ R;  1BUS A;  2LUY A;  2QQ0 A;  1H0Z A;  2J9R A;  2NU3 I;  1TUS A;  3HH2 C;  2FNF X;  5CCM A;  2B8T A;  5EX3 A;  3OVO A;  1UVF A;  3VDP A;  2KMO A;  2OVO A;  2L8E A;  2GKR I;  5FUY A;  1Y1C A;  2ODD A;  1FYB A;  1SGE I;  1XA6 A;  1XX6 A;  2N1A B;  1FAR A;  2KMP A;  1IY6 A;  1SGY I;  3VE5 A;  1KBE A;  2XRC A;  2JZM A;  2KMQ A;  1UVG A;  1W4R A;  2A20 A;  4E1R A;  1XBT A;  1CE3 A;  3SGQ I;  2ORV A;  2ENN A;  3FC3 A;  4OVO A;  1OYV I;  1CHO I;  2N52 A;  2WVJ A;  1DS3 I;  1LR7 A;  5DAE A;  1PPF I;  2JA1 A;  1SGN I;  1TBR R;  2NU0 I;  1RFH A;  2YQP A;  1IW4 A;  4L9M A;  3BJI A;  1HPT A;  2E73 A;  1V1I A;  2N71 A;  3OL0 A;  3UGI A;  3GOX A;  1HDL A;  2QQE A;  1YU6 C;  2KCX A;  2ELI A;  5FUX A;  1PTR A;  1Y1B A;  3UEY A;  2NU2 I;  3VDU A;  3E59 A;  1IY5 A;  2E5R A;  4FKD A;  1KMA A;  1TIH A;  3OXL A;  3B4V C;  2VRW B;  2YUU A;  1Y8F A;  1TUR A;  2L7X A;  2N17 A;  3CXL A;  5FUV A;  1SGR I;  1X4S A;  2ROW A;  1U5K A;  2JYY A;  2QQC A;  2SGE I;  3OXG A;  2CJS C;  4HGU A;  1FAQ A;  3E2I A;  2SGD I;  1CGJ I;  1SGP I;  2W0T A;  3SGB I;  1LR8 A;  4GI3 C;  5EX0 A;  1V1H A;  1KBF A;  2V53 A;  5CCL A;  3UFF A;  1M8C A;  2DIP A;  1VDD A;  2OD1 A;  2QQD A;  1DS2 I;  1Z7K B;  2NU4 I;  2F3C I;  1TGS I;  3SEK C;  1CT4 I;  2SGP I;  2JXD A;  4JCV E;  1CGI I;  1SGQ I;  2B0U C;  1CT0 I;  2GKV A;  2M5X A;  5JHW C;  1R79 A;  1TOT A;  1CT2 I;  3UGD A;  2ARP F;  3TJQ A;  2QPO A;  1MT1 A;  1R0R I;  2ENZ A;  2SGQ I;  1LR9 A;  1M8B A;  1UUC A;  2V1C A;  3QTL D;  5HI7 A;  4A24 A;  2P6A C;  2J87 A;  1AN1 I;  1TBN A;  2SGF I;  1PTQ A;  3KY9 A;  1PJU A;  4UXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...