3UITA

Overall structure of patj/pals1/mals complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
EKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords InaD-like protein, MAGUK p55 subfamily member 5, Protein lin
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
A PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.460 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3uitA02
1.20.1440.360 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3uitA01
3UITA
chains in the Genus database with same CATH superfamily
5E84A 4GXTA 2YL5A 3DPOA 4JWCA 4U6RA 4FZOA 1GNTA 2OZNB 2FICA 2EFKA 1SJ8A 3HAIA 2QZGA 4EZVA 3KAVA 3OWGA 4UDXX 1YO7A 1YWMA 4Z7HA 3DX0A 2MI7A 2O0I1 2MJFB 1W3SA 3QNJA 2BL8A 3ABHA 4OAUC 2V0OA 4BNEA 1DKZA 3EJUA 2KHOA 3G9GA 4HYBA 3VEBA 3B53X 4AKVA 3VKHA 1U5KA 3D2FA 2QXLA 4IW0A 3O3NB 3BUQA 2X3XA 2JB2A 4O1OA 1JQOA 2F6MB 5FIGA 1X03A 4EZXA 4AS2A 2QFFA 1TQSA 4WPEA 2NCZA 4DWLA 1SU8A 3BVUA 2ALWA 4JWDA 4HEA1 2QKWA 2Q13A 1E1DA 4NPHA 3O3MB 2BL7A 1TQTA 3D4ZA 3Q84A 4JWEA 1HXKA 2FU2A 3FD9A 3Q0KA 4JWIA 4JLCA 2RADA 3CZSA 3DPQA 4AZCA 3KDRA 2D1LA 2Z0NA 4F00A 3Q8DA 2YLAA 2F1AA 2YLLA 3O3OB 1DKXA 4R5KA 3A98A 2RAJA 3UITA 4NQIA 4IM3A 2F18A 3LVTA 1QX1A 1R33A 4AZ6A 2F7PA 2WYHA 2PY6A 4G75A 3KP9A 2L1LB 4O1PA 3BUPA 3DO9A 2FYVA 2N3KA 2YKTA 2OO2A 5KBPA 3BVWA 3ACOA 4FZPA 4F01A 1TQUA 3I01A 2WYIA 3HAHA 1TQWA 3LJ1A 1LQ7A 4KIKA 4EZQA 2OW7A 4JNFA 4DCNC 1O7DC 2KKMA 3F4MA 3LJ0A 3ER8C 2IP6A 2OBLA 1UPXA 1X04A 2V1CC 3OHXM 3L3PA 1I4TA 4JN4A 1ZWWA 2RIOA 4IM2A 2YIAA 2X5CA 2XTQA 1TQVA 3T47A 3L0IA 2X3WA 2QGMA 4HR1B 4AZBA 1I4LA 3RV0A 4DYLA 2YL9A 3FVVA 2QSBA 2WINM 4G6QA 3QNIA 2ETDA 3T4AG 2JBWA 3BVTA 3DYTA 4EZSA 4AZCB 4JCVE 2EWFA 1O7DB 4EZPA 3D2EA 3D52A 1JQKA 3IAM1 3JSBA 4AZ7A 4Z7GA 1R5EA 2JB3A 5FLEX 4R5LA 2EX3B 3KAWA 4I1QA 3DX2A 2F7QA 2F7RA 2ELBA 3DA4A 2YL8A 2A2DA 4NSWA 2ZRRA 3BUBA 3QWEA 4FM3A 1SUFA 2RAKA 3L3OM 2RAIA 2XMXA 2Z8YA 1SU6A 2C08A 3FNBA 2YL6A 3CKDA 1HTYA 2JAEA 1E2UA 3C7NA 4NV5A 2EFLA 4HY9A 3DA3A 3EJRA 2E8GA 2FUG1 4YZCA 2P22B 2OBMA 3P23A 2FEFA 2ZXQA 4IWOA 2YFBA 2ND1A 4D8JA 2ZW3A 3DPPA 2YIBA 2XTRA 1OA0A 3DX4A 1Y2OA 3T49A 3ZEDA 4PL5A 5HGIA 3SOGA 4Q9VA 3SYVA 4IM0A 3FBVA 1TDPA 2Z0VA 4JNEA 2JNKA 4G76A 4I1TA 1SU7A 3GI7A 2CAZB 2YI9A 3B55A 4FZSA 3T46A 4H6HA 1PS3A 4E3CA 2LM0A 4M0MA 4EZNA 2RLDA 5C5BA 4EZRA 1GN9A 5TKYA 4E81A 4H6IA 4ATMA 3EJSA 2Q12A 2RT6A 3QA8A 4B9QA 3D51A 3EJQA 2GA9D 4EZTA 4NV2A 3LJ2A 3BVXA 4R5IA 3CV5A 2Z0OA 4AS3A 3LLLA 4PO2A 3B52X 4H8SA 4PL3A 5C5BB 3M3WA 3ERCC 4EZYA 3CVRA 2F1BA 1WDZA 3VA9A 3I9V1 2ND0A 3BUDA 4JL9A 3BVVA 1I4DA 4EZOA 1OA1A 4YZDA 1GNLA 2D4CA 3F7WA 3SDJA 3AJFA 1DKYA 2JNSA 1U00A 4EZZA 3EJPA 3D4YA 4EZUA 4KIKB 3ER9B 3QE6A 1OAOA 3PLTA 4PL4A 3BUIA 4YZ9A 2GF4A 3VEAA 1QWUA 1QWNA 2PMRA 3D50A 1URUA 3DX1A 4EZWA 3LMFA 2A2CA 4R5GA 2YIVX 3I39X 3I04A 4WPCA 4AZGA 1W9MA 4AZ5A 2GAFD 2LXYA 3DX3A 2YFAA 4AZHA 2GSCA 3HAJA 3RPMA 3BLBA 3IAS1 1ZYLA 5LNK1 2V6EA 3OK8A 4IWPA 4OAVB 4UDYX 3DDFA 2F7OA 2K19A 2X3VA 4AZIA 2OW6A 1R34A 1HWWA 3B51X 4R5JA 1MJGA 2F66B 4AVMA 3RV1A 2JB1A 3CZNA 1I49A 4HR1A 4IWQA 3T48A 2HGKA 3I2WA 3CAZA 1E9VA 3EJTA 4HFVA 3DDGA 2YI8A
chains in the Genus database with same CATH topology
4R5KA 5E84A 1JQKA 3A98A 3IAM1 3JSBA 4PO2A 4GXTA 3B52X 3UITA 4Z7GA 4PL3A 4IM3A 2YI8A 4JWCA 3DPOA 2JB3A 5FLEX 3ERCC 4U6RA 4EZYA 1GNTA 4R5LA 2EX3B 3KAWA 1SJ8A 3DA4A 3VA9A 4EZVA 3KAVA 2ND0A 2A2DA 3I9V1 2PY6A 3OWGA 4JL9A 4UDXX 1OA1A 4EZOA 2ZRRA 4G75A 4YZDA 1YO7A 4FM3A 4Z7HA 1GNLA 1SUFA 3KP9A 2L1LB 4O1PA 3F7WA 3L3OM 2MJFB 1W3SA 2XMXA 3QNJA 3AJFA 3SDJA 4OAUC 2Z8YA 1DKYA 2JNSA 1SU6A 1U00A 4EZZA 1DKZA 3DO9A 2JAEA 2KHOA 1E2UA 2N3KA 4HYBA 4KIKB 4EZUA 3ER9B 3C7NA 3VEBA 1OAOA 3B53X 4HY9A 3DA3A 4NV5A 4PL4A 2E8GA 3VKHA 2FUG1 4YZCA 4YZ9A 1U5KA 3D2FA 2P22B 2OBMA 2QXLA 3P23A 3VEAA 4IWOA 2YFBA 2ND1A 4D8JA 4IW0A 3DPPA 2YIBA 4F01A 3O3NB 4EZWA 3I01A 3LMFA 2A2CA 2XTRA 4R5GA 3LJ1A 1OA0A 2JB2A 4O1OA 2YIVX 3I39X 4KIKA 3T49A 2F6MB 3I04A 4EZQA 5FIGA 3ZEDA 4PL5A 5HGIA 1W9MA 2GAFD 4EZXA 4Q9VA 2QFFA 4JNFA 4AS2A 2KKMA 2YFAA 4IM0A 3FBVA 3F4MA 2NCZA 3LJ0A 3ER8C 4DWLA 4JNEA 4G76A 4I1TA 1SU8A 1SU7A 1DKXA 3GI7A 3IAS1 1ZYLA 4JWDA 5LNK1 2V6EA 2CAZB 2IP6A 2OBLA 4HEA1 1UPXA 4IWPA 2YI9A 1E1DA 2V1CC 4NPHA 4OAVB 4UDYX 3OHXM 3O3MB 2K19A 4JN4A 2RIOA 4IM2A 4JWEA 3B51X 4R5JA 2YIAA 2X5CA 1MJGA 3T47A 2F66B 2XTQA 3L0IA 3FD9A 4H6HA 4HR1B 3T46A 2LM0A 4JWIA 4E3CA 4JLCA 4M0MA 4EZNA 4EZRA 3DPQA 3RV1A 3RV0A 1GN9A 5TKYA 4E81A 4H6IA 2JB1A 2RT6A 3KDRA 3QA8A 2WINM 4G6QA 4B9QA 4HR1A 4IWQA 3T4AG 3T48A 4F00A 2GA9D 4JCVE 4EZSA 3Q8DA 4EZTA 4NV2A 2EWFA 3LJ2A 1E9VA 4EZPA 4HFVA 4R5IA 3O3OB 4AS3A 3D2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIT A; 
#chains in the Genus database with same CATH topology
 5E84 A;  4GXT A;  2YL5 A;  3DPO A;  4JWC A;  4U6R A;  4FZO A;  1GNT A;  2OZN B;  2FIC A;  2EFK A;  1SJ8 A;  3HAI A;  2QZG A;  4EZV A;  3KAV A;  3OWG A;  4UDX X;  1YO7 A;  1YWM A;  4Z7H A;  3DX0 A;  2MI7 A;  2O0I 1;  2MJF B;  1W3S A;  3QNJ A;  2BL8 A;  3ABH A;  4OAU C;  2V0O A;  4BNE A;  1DKZ A;  3EJU A;  2KHO A;  3G9G A;  4HYB A;  3VEB A;  3B53 X;  4AKV A;  3VKH A;  1U5K A;  3D2F A;  2QXL A;  4IW0 A;  3O3N B;  3BUQ A;  2X3X A;  2JB2 A;  4O1O A;  1JQO A;  2F6M B;  5FIG A;  1X03 A;  4EZX A;  4AS2 A;  2QFF A;  1TQS A;  4WPE A;  2NCZ A;  4DWL A;  1SU8 A;  3BVU A;  2ALW A;  4JWD A;  4HEA 1;  2QKW A;  2Q13 A;  1E1D A;  4NPH A;  3O3M B;  2BL7 A;  1TQT A;  3D4Z A;  3Q84 A;  4JWE A;  1HXK A;  2FU2 A;  3FD9 A;  3Q0K A;  4JWI A;  4JLC A;  2RAD A;  3CZS A;  3DPQ A;  4AZC A;  3KDR A;  2D1L A;  2Z0N A;  4F00 A;  3Q8D A;  2YLA A;  2F1A A;  2YLL A;  3O3O B;  1DKX A;  4R5K A;  3A98 A;  2RAJ A;  3UIT A;  4NQI A;  4IM3 A;  2F18 A;  3LVT A;  1QX1 A;  1R33 A;  4AZ6 A;  2F7P A;  2WYH A;  2PY6 A;  4G75 A;  3KP9 A;  2L1L B;  4O1P A;  3BUP A;  3DO9 A;  2FYV A;  2N3K A;  2YKT A;  2OO2 A;  5KBP A;  3BVW A;  3ACO A;  4FZP A;  4F01 A;  1TQU A;  3I01 A;  2WYI A;  3HAH A;  1TQW A;  3LJ1 A;  1LQ7 A;  4KIK A;  4EZQ A;  2OW7 A;  4JNF A;  4DCN C;  1O7D C;  2KKM A;  3F4M A;  3LJ0 A;  3ER8 C;  2IP6 A;  2OBL A;  1UPX A;  1X04 A;  2V1C C;  3OHX M;  3L3P A;  1I4T A;  4JN4 A;  1ZWW A;  2RIO A;  4IM2 A;  2YIA A;  2X5C A;  2XTQ A;  1TQV A;  3T47 A;  3L0I A;  2X3W A;  2QGM A;  4HR1 B;  4AZB A;  1I4L A;  3RV0 A;  4DYL A;  2YL9 A;  3FVV A;  2QSB A;  2WIN M;  4G6Q A;  3QNI A;  2ETD A;  3T4A G;  2JBW A;  3BVT A;  3DYT A;  4EZS A;  4AZC B;  4JCV E;  2EWF A;  1O7D B;  4EZP A;  3D2E A;  3D52 A;  1JQK A;  3IAM 1;  3JSB A;  4AZ7 A;  4Z7G A;  1R5E A;  2JB3 A;  5FLE X;  4R5L A;  2EX3 B;  3KAW A;  4I1Q A;  3DX2 A;  2F7Q A;  2F7R A;  2ELB A;  3DA4 A;  2YL8 A;  2A2D A;  4NSW A;  2ZRR A;  3BUB A;  3QWE A;  4FM3 A;  1SUF A;  2RAK A;  3L3O M;  2RAI A;  2XMX A;  2Z8Y A;  1SU6 A;  2C08 A;  3FNB A;  2YL6 A;  3CKD A;  1HTY A;  2JAE A;  1E2U A;  3C7N A;  4NV5 A;  2EFL A;  4HY9 A;  3DA3 A;  3EJR A;  2E8G A;  2FUG 1;  4YZC A;  2P22 B;  2OBM A;  3P23 A;  2FEF A;  2ZXQ A;  4IWO A;  2YFB A;  2ND1 A;  4D8J A;  2ZW3 A;  3DPP A;  2YIB A;  2XTR A;  1OA0 A;  3DX4 A;  1Y2O A;  3T49 A;  3ZED A;  4PL5 A;  5HGI A;  3SOG A;  4Q9V A;  3SYV A;  4IM0 A;  3FBV A;  1TDP A;  2Z0V A;  4JNE A;  2JNK A;  4G76 A;  4I1T A;  1SU7 A;  3GI7 A;  2CAZ B;  2YI9 A;  3B55 A;  4FZS A;  3T46 A;  4H6H A;  1PS3 A;  4E3C A;  2LM0 A;  4M0M A;  4EZN A;  2RLD A;  5C5B A;  4EZR A;  1GN9 A;  5TKY A;  4E81 A;  4H6I A;  4ATM A;  3EJS A;  2Q12 A;  2RT6 A;  3QA8 A;  4B9Q A;  3D51 A;  3EJQ A;  2GA9 D;  4EZT A;  4NV2 A;  3LJ2 A;  3BVX A;  4R5I A;  3CV5 A;  2Z0O A;  4AS3 A;  3LLL A;  4PO2 A;  3B52 X;  4H8S A;  4PL3 A;  5C5B B;  3M3W A;  3ERC C;  4EZY A;  3CVR A;  2F1B A;  1WDZ A;  3VA9 A;  3I9V 1;  2ND0 A;  3BUD A;  4JL9 A;  3BVV A;  1I4D A;  4EZO A;  1OA1 A;  4YZD A;  1GNL A;  2D4C A;  3F7W A;  3SDJ A;  3AJF A;  1DKY A;  2JNS A;  1U00 A;  4EZZ A;  3EJP A;  3D4Y A;  4EZU A;  4KIK B;  3ER9 B;  3QE6 A;  1OAO A;  3PLT A;  4PL4 A;  3BUI A;  4YZ9 A;  2GF4 A;  3VEA A;  1QWU A;  1QWN A;  2PMR A;  3D50 A;  1URU A;  3DX1 A;  4EZW A;  3LMF A;  2A2C A;  4R5G A;  2YIV X;  3I39 X;  3I04 A;  4WPC A;  4AZG A;  1W9M A;  4AZ5 A;  2GAF D;  2LXY A;  3DX3 A;  2YFA A;  4AZH A;  2GSC A;  3HAJ A;  3RPM A;  3BLB A;  3IAS 1;  1ZYL A;  5LNK 1;  2V6E A;  3OK8 A;  4IWP A;  4OAV B;  4UDY X;  3DDF A;  2F7O A;  2K19 A;  2X3V A;  4AZI A;  2OW6 A;  1R34 A;  1HWW A;  3B51 X;  4R5J A;  1MJG A;  2F66 B;  4AVM A;  3RV1 A;  2JB1 A;  3CZN A;  1I49 A;  4HR1 A;  4IWQ A;  3T48 A;  2HGK A;  3I2W A;  3CAZ A;  1E9V A;  3EJT A;  4HFV A;  3DDG A;  2YI8 A; 
#chains in the Genus database with same CATH homology
 4R5K A;  5E84 A;  1JQK A;  3A98 A;  3IAM 1;  3JSB A;  4PO2 A;  4GXT A;  3B52 X;  3UIT A;  4Z7G A;  4PL3 A;  4IM3 A;  2YI8 A;  4JWC A;  3DPO A;  2JB3 A;  5FLE X;  3ERC C;  4U6R A;  4EZY A;  1GNT A;  4R5L A;  2EX3 B;  3KAW A;  1SJ8 A;  3DA4 A;  3VA9 A;  4EZV A;  3KAV A;  2ND0 A;  2A2D A;  3I9V 1;  2PY6 A;  3OWG A;  4JL9 A;  4UDX X;  1OA1 A;  4EZO A;  2ZRR A;  4G75 A;  4YZD A;  1YO7 A;  4FM3 A;  4Z7H A;  1GNL A;  1SUF A;  3KP9 A;  2L1L B;  4O1P A;  3F7W A;  3L3O M;  2MJF B;  1W3S A;  2XMX A;  3QNJ A;  3AJF A;  3SDJ A;  4OAU C;  2Z8Y A;  1DKY A;  2JNS A;  1SU6 A;  1U00 A;  4EZZ A;  1DKZ A;  3DO9 A;  2JAE A;  2KHO A;  1E2U A;  2N3K A;  4HYB A;  4KIK B;  4EZU A;  3ER9 B;  3C7N A;  3VEB A;  1OAO A;  3B53 X;  4HY9 A;  3DA3 A;  4NV5 A;  4PL4 A;  2E8G A;  3VKH A;  2FUG 1;  4YZC A;  4YZ9 A;  1U5K A;  3D2F A;  2P22 B;  2OBM A;  2QXL A;  3P23 A;  3VEA A;  4IWO A;  2YFB A;  2ND1 A;  4D8J A;  4IW0 A;  3DPP A;  2YIB A;  4F01 A;  3O3N B;  4EZW A;  3I01 A;  3LMF A;  2A2C A;  2XTR A;  4R5G A;  3LJ1 A;  1OA0 A;  2JB2 A;  4O1O A;  2YIV X;  3I39 X;  4KIK A;  3T49 A;  2F6M B;  3I04 A;  4EZQ A;  5FIG A;  3ZED A;  4PL5 A;  5HGI A;  1W9M A;  2GAF D;  4EZX A;  4Q9V A;  2QFF A;  4JNF A;  4AS2 A;  2KKM A;  2YFA A;  4IM0 A;  3FBV A;  3F4M A;  2NCZ A;  3LJ0 A;  3ER8 C;  4DWL A;  4JNE A;  4G76 A;  4I1T A;  1SU8 A;  1SU7 A;  1DKX A;  3GI7 A;  3IAS 1;  1ZYL A;  4JWD A;  5LNK 1;  2V6E A;  2CAZ B;  2IP6 A;  2OBL A;  4HEA 1;  1UPX A;  4IWP A;  2YI9 A;  1E1D A;  2V1C C;  4NPH A;  4OAV B;  4UDY X;  3OHX M;  3O3M B;  2K19 A;  4JN4 A;  2RIO A;  4IM2 A;  4JWE A;  3B51 X;  4R5J A;  2YIA A;  2X5C A;  1MJG A;  3T47 A;  2F66 B;  2XTQ A;  3L0I A;  3FD9 A;  4H6H A;  4HR1 B;  3T46 A;  2LM0 A;  4JWI A;  4E3C A;  4JLC A;  4M0M A;  4EZN A;  4EZR A;  3DPQ A;  3RV1 A;  3RV0 A;  1GN9 A;  5TKY A;  4E81 A;  4H6I A;  2JB1 A;  2RT6 A;  3KDR A;  3QA8 A;  2WIN M;  4G6Q A;  4B9Q A;  4HR1 A;  4IWQ A;  3T4A G;  3T48 A;  4F00 A;  2GA9 D;  4JCV E;  4EZS A;  3Q8D A;  4EZT A;  4NV2 A;  2EWF A;  3LJ2 A;  1E9V A;  4EZP A;  4HFV A;  4R5I A;  3O3O B;  4AS3 A;  3D2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...