3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
3NKOA 3WAWA 5LIAA 1HJKA 3UN5A 1ZEFA 3E2DA 4GTWA 3BDGA 1O99A 1URAA 4UPKA 3SZYA 5AJ9A 3CMRA 4GTXA 3IGZB 1P49A 4ZG7A 4NWJA 4KJGA 3T00A 5DLVA 3SZZA 2QZUA 1SHQA 3NKMA 1AUKA 1AJCA 4TN0A 4KJDA 4MHXA 1KHJA 4LRCA 1ED8A 4CXKA 4LQYA 3M7VA 1O98A 3KD8A 2RH6A 4KAVA 3NKPA 3WAVA 1Y7AA 1ELXA 2W5SA 4LR7A 5DLWA 5KXAA 4MIVA 3NKRA 4KM4A 4MY4A 3LXQA 5GOVA 4UOOA 1ANIA 5HRTA 1KH7A 4UPLA 3NVLA 2W5WA 4YR1A 5DLTA 3A52A 1KH9A 5EGEA 4LRDA 1E33P 4FDJA 1KHLA 4LR2A 1B8JA 1EQJA 4LRFA 1KH5A 2W5RA 3MK1A 2W5VA 4KAYA 3OT9A 4ZG9A 1EJJA 1ELZA 4LREA 2XRGA 3T02A 3DPCA 3UN3A 1ZEDA 1ZEBA 3WAYA 1ED9A 4N7TA 2W5QA 5L0EA 4ZGAA 5LQQA 4FDIA 4LRAA 1ALIA 3NKQA 3B5QA 3DYCA 4NWXA 4UPIA 1KHKA 2W8DA 1HQAA 4UPHA 3M8YA 1E1ZP 3M8ZA 1EW9A 4CYRA 3T01A 1K7HA 1N2KA 4LR9A 2IFYA 4GTYA 1Y6VA 1AJAA 5GRRA 5INHA 1E3CP 5EGHA 3Q3QA 3TG0A 5LRMA 2IUCB 3UNYA 2G9YA 5L0KA 1HDHA 1ALHA 3BDFA 5K4PA 1ELYA 2GSOA 5LRNA 3BDGB 1KH4A 4CXSA 1EW2A 1FSUA 4UOPA 4B56A 5TJ3A 1AJDA 3WBHA 3M8WA 2W5XA 3UO0A 3BDHA 4UORA 3ED4A 1AJBA 5IJSA 2D1GA 5IJQA 4ZG6A 1N2LA 2ANHA 1URBA 2XR9A 1EI6A 5L0BA 2W8SA 2X98A 2W5TA 4CYSA 1ALKA 1SHNA 1ALJA 2ZKTA 2GSNA 5C66A 4CXUA 4LRBA 3MK2A 4QAXA 3NKNA 3IGYB 3TX0A 2GLQA 4GTZA 3WAXA 3UN2A 2GSUA 1ANJA 4LR8A 1EW8A 2GA3A 1KHNA 2VQRA 1E2SP 3MK0A 3IDDA 3TWZA 2IUCA
chains in the Genus database with same CATH superfamily
2WAQD 3SZYA 2BJ1A 4LF7J 1NDCA 5LSOA 3P4UB 2FTRA 3MFHA 3CD7A 1F6TA 5HK4A 3SCLE 1F1BB 1TFYA 2MXYA 3QAUA 4RWXA 2YNHA 2DNNA 2DGOA 1IJEB 2VUGA 5KG7A 5G4DA 4F67A 4RW8A 2OEKA 3QSIA 3G71S 4V1Ak 4M5DA 3K5PA 1ED9A 3PACA 1LW0B 1RCOB 5IT4A 1FWLA 1HQAA 2WZ1A 3DGPB 2XY6A 2QN6B 3NNHA 2UXCF 1QAJA 2KZZA 2IDLA 1X4HA 3ZTPA 5IOLA 2HWIA 3W64A 5J1NA 2AQ4A 2XHCA 5HMXA 4NWBA 2YWKA 4OJ1A 5M2RA 2QA2A 1TV6B 1RHJB 4DR1J 4MH8A 3T1HF 4QIGA 2IJFA 1LWXA 2AX1A 4GTWA 3MEDA 4NRUA 3LP0A 3KJQB 1WC6A 5KT4A 2KYXA 4IFVA 3OTOJ 4DF8A 4LR7A 3OR2A 5JJBA 4PQAA 1K47A 4K4ZA 4EWTA 3JQMA 4A47A 3RAMA 3H8YA 5DDPC 5HSPA 3KLIA 4DL4A 1M5VC 4G6VB 3R7SB 2RU3A 1WTFA 1QUVA 5D0GA 5D0RA 4J9QA 4PG8A 1N2KA 4UOGA 2OPPA 4ED6A 2W4DA 2HHPA 1R6VA 2ZH5A 1UETA 3KKFA 1Y5IB 2M4MA 2IVFB 1S6OA 1WF2A 1T05B 2QLFB 4WKRA 2ZKTA 3CNQP 4OJGA 1ZZFA 4NLTA 3BBFA 3CJTA 4JV2A 4DZ6A 2KXNB 3SSRA 5G0RB 2G13A 4CO3A 4LFAF 2VG6A 3E2DA 3GIMA 3QIPB 3W2WA 2GMJA 1Y4ZB 2RHSB 4C3MA 3MR2A 2IM0A 3DRSB 2DIVA 1KHJA 3JSYA 2HEKA 2AX0A 5K8PA 1X4FA 4AUKA 3CMAS 2I6WA 4O0NA 1FXDA 3K2YA 2Y9HA 4K50A 3RW7A 1C4AA 5HJYA 5K5MA 4TLRA 1E33P 1LKZA 3UCGA 1MMNA 2LXFA 3KUHA 2Z56B 4ZIWA 3HHKA 3SI8A 2RKIB 3J7AN 2XHWA 4I6AA 2H9ZA 1X60A 4WP8A 3DI6A 1OY6A 4B9LA 1KVIA 3SV3A 3OTDA 4UPHA 4X62F 4PG5A 3LGMA 3AJDA 1XNQJ 1TL1A 2RRAA 3LP2B 1W7WA 5K9FA 1JNZB 3NMAA 3CDWA 4DCJB 1D9AA 4IG3A 2W5XA 2PI4A 4NLQA 1QSSA 2R2UA 2X98A 2OAUA 5D0EA 2OO4A 2E9ZA 1QY7A 4WF9Q 2VG5A 4NYZA 4HKQA 1NJWA 1FE0A 5K14B 2W7OA 2KB2A 4R0EA 1RADB 2CQIA 2WOMA 2WSFC 2B5JA 4EZ6A 3L7UA 4UY8T 4QIWD 3TOQA 4OI2A 1UAWA 2MB0B 2DGQA 1DBDA 3BDEA 3H4DA 2CNOB 1QVGR 3S1TA 5HBMB 3MR3A 4ZVFA 3BGFA 3BQ0A 3MTKA 1QAXA 4GMKA 5DG9A 1IN0A 4I64A 2V2VA 3SDEA 1LW2A 2FZGB 1T94A 3D67A 1I5OB 2WVEA 2C3OA 1TKXA 3E01A 4DPTA 5AJ3F 3K59A 2GVZA 4JUZA 2VA2A 1FA0A 4PWDB 3BBCA 2A2DA 5DDRC 3HT0A 1N32J 1U1PA 2V69A 4C8YA 1WOPA 1RBAA 4CYUA 4L76A 1VLYA 3K5MA 4UOFA 4ZG6A 1S7IA 1H3DA 4AFFA 2XMWA 2YNGB 5KFUA 3H59A 5IT9U 3H5XA 3WAXA 5J1EB 1UFLA 1HW9A 2GA3A 4ED4A 4ID5A 2UP1A 4W92B 3DM2A 1X5OA 1VHFA 2LQ8A 1HNWF 2XS5A 3T1YF 2I2YA 4P2SA 2VQFJ 4UQGA 2HVZA 2HVHA 2WVFA 2K3KA 3O5TB 4B3RF 3QRQA 4ES3A 3J80Y 2MKIA 3DLLQ 1BXNA 2IY5B 4EFAC 1Y6VA 5E3PA 4QU6A 1H6KX 1BWEA 4B9UA 3C2PA 2HS0A 1KH4A 4EZ9A 2VH7A 2L08A 4X84A 3CCSS 3W2VA 3QZ8A 2HHUA 2HFOA 3KK1B 2BKNA 4M95A 4LSZB 7FD1A 2EXUA 4Y2IA 1JWWA 1TK5A 4OX8A 4P73A 2J7KA 4DV6F 1FI4A 3AB2B 3U27A 1RACB 5EWEA 2GW8A 3K7RA 1Y5NB 4LMZA 4MHXA 3UQSA 2CG4A 3B4MA 5A6PA 2G0JA 5KFKA 1MWQA 2JNJA 1HNVA 3HXMA 4RNHA 4X4QA 4FKYA 1N36F 2OSQA 3AXKA 2A0FB 2V8GA 4Q5VA 3KJFB 1NB2A 4ZG9A 1FDBA 1W2BR 2NR0A 3C66A 5H1SV 4GKKJ 2ALYB 3GIIA 4X4UA 3OLBA 4ZCKA 5J2QA 1TVRA 1HLWA 5INHA 2J7WA 2B8PA 3BDGB 2R9LA 1F5BA 1FHTA 3TR5A 4KGMA 3CIMA 3CXCR 4ZKAA 4ZVEA 4X4OA 4B17A 1WHXA 4ECQA 1JIHA 5IM0B 4O3PA 2CZVC 1D1UA 5KFOA 2YX1A 2OELA 1R0AB 2CXEA 5KFRA 4CLFA 3AT1B 1KHNA 1U6FA 3TWZA 3R6GB 4JI0F 4C6AA 1LWCB 2J8AA 5E3QA 5MAOA 1J5OA 4ICLB 1FX2A 5HMWA 2QT7A 2GQCA 4Y6IA 2DRBA 3GTYX 4OYOA 3R2CJ 3NS7B 3QGPA 1NCLA 2GJFA 3BEGB 2R2RA 1RE1B 3I5AA 4AXIA 2LU2A 3AQOA 2OPSB 5JUMA 4G65A 4ZCIA 3N0VA 3VQSA 3NKQA 2B7CB 2NQPA 3KLHB 4DU8A 1IQZA 1SJ4P 3A3PB 5D4OA 1DQAA 1IVZA 2HMIB 2G4BA 1ALHA 1TK8A 1S1VA 2V34A 2O3DA 3TARA 1CJKA 3ZTOA 4ANCA 4IOBA 4GRSA 4L72B 5T7LA 3QJLA 4PR6A 4NX9A 2P9CA 2MZQA 3PXGa 2IDEA 1F5CA 3DRRA 4YB5A 2OLWA 4B02A 4KHPJ 1U49A 1WC4A 1KVKA 4C8NA 3K5LA 2GQ2A 2UV8G 3PYEA 1MWYA 3T9ZA 2HNYA 1OQ6A 4EK2A 1RAGB 4LRCA 1VISA 4CO5A 4N77A 4ZVGA 4CZCA 4RW6A 3OLAA 2R2TA 2IRUA 4ZPTR 4A8YA 4JI2F 3I4HX 1IBMF 1NK5A 5EDWA 3TUZC 2VPXB 4I56A 5RUBA 2YQ0A 4DCOB 5ITHA 2G2ZA 3DLBA 2DK2A 1FJGF 2XRGA 1ZEBA 3W9JA 2DPIA 5KG6A 2VBZA 2KKHA 3PJXA 1L3SA 5L9XA 5U47A 4N56A 2QO3A 4P2XA 3S01A 4BC7A 3MM7B 3W65A 1ZBTA 1RISA 4OZ5A 3RG6A 3UO0A 3BSCA 2OPQB 2V4QA 2W24A 4IH5A 4ELVA 1P27B 1CULA 2X3GA 3GR0A 3Q8SB 4ATNA 4QAXA 1KD1T 3Q0AA 3B82A 3IMQJ 2HBQB 2HFVA 1N4LA 1TL7B 4RNFA 3TZXA 3PIPQ 4CNZA 1LWEB 1R43A 2DB1A 4CNYA 2ZDPA 4W98A 3V81A 4DF4A 2IA6A 3J81U 1HBUB 1H2TZ 3KK2B 4YUDA 2YH1A 2MKHA 2R7WA 4YB1P 1HW8A 4DSJA 1CBKA 3RB3A 3OT9A 3SIPB 1F9FA 1AZSA 2DNGA 1VYAA 1VQSA 1ZEDA 3CO9A 2DXEA 2OD4A 4R25A 2HW3A 1IKYA 2F1FA 2LEPA 3CJ5A 1NH8A 3ZZTA 3RB0A 3L7PA 1T7PA 3HSGA 2C22A 3C19A 2B56A 2VBWA 4B9SA 3HKZD 3RU0A 2OFGX 3NEKA 5KG4A 3PG9A 3V6HA 1H2UX 2VDHA 4H54A 2YNIB 1G1XA 1U2FA 3GCWP 1S0MA 1R8HA 1SV5A 2LXIA 6FD1A 2Y1RI 1SUQA 3OD2A 3I6PA 2ZD1A 4KO0A 4R5PA 6AT1B 2QZUA 5D4LA 2ZOFA 4RW9A 3RZAA 1CQMA 1SQGA 2ZBCA 1NUEA 3MCOA 4PXCA 3I87A 4Q8EA 1RT6B 2ZNYA 4NASA 3G82A 4IRCA 3C6TB 1KH9A 3FCHA 4EYIB 1G2EA 8RUCA 2FC9A 5DQGA 2OEMA 2PEBA 1FFGB 4B9VA 1U1RA 5D3GA 2M8HA 4KH1B 2DH9A 3M6UA 1B0PA 5IV4A 2EBGA 4GTYA 3UNYA 1FF2A 1BQXA 4LBPA 2BE2A 4AE5A 3A8EA 2KXHA 3PKMA 1UVJA 1ZM3A 1RTIA 1VIXA 3D0GE 1K0TA 2F40A 1OIAA 1RT3B 5J2PB 1FT8A 4HVZA 2GIRA 1LWFA 4AD6A 4Y0FA 2WSCC 3MF5A 3EYZA 1S0NA 3NKNA 4DPWA 2E7XA 4LF7F 3OVAA 1NK9A 4RBUA 4NLXA 3AHPA 3TZWA 3CCZA 2YY3A 2CJQA 5AJ9A 2EWHA 4DPUA 2F9JA 2FLPA 1T9YA 2XMMA 2GZOA 4J9UE 2RMLA 1Q8KA 4IH7A 4PAAA 2BRKA 4OYXA 4XPEA 4JOUA 2J9DA 3QO9A 2B9WA 4OX7A 2W7AA 3IWNC 1LFWA 3KG0A 2PE8A 1TKZA 4DR3J 5CAAA 4M5MA 2XG8A 2CQ2A 4PCQA 1SCJB 2ZHOA 3D7SB 3PX6A 2FVQA 2X7IA 1T03B 3DC2A 2PA8D 2VFSA 2DO0A 3HHEA 3VAKA 4WKYA 4NA1A 4FYVB 1IBCB 1NKCA 2R7TA 1N6QB 4C7QA 3EMTA 3QLHB 2CAJA 2AZ1A 1RU2A 3JYTB 4OYZA 4DR1F 3IWXA 2IVYA 1XERA 2F65A 1EP4A 4C0OC 3EGNA 2BANA 4RLEA 2OD6A 3GV5B 1M90T 5DO2A 3THVA 3ULHA 1UFWA 2DNOA 1Q86T 2KN4A 3IA0A 4HEA9 3OTOF 1JXEA 1TKDA 4RNMA 4M5GA 2VKRA 3HHLB 4GTXA 2KJWA 3FNNA 3W62A 5D77A 3V2UC 3RR8A 4FXVA 2HS4A 2XSJA 1RT2A 5F8GA 1F9HA 1ANIA 1NDLA 1S79A 1RLDA 2NSCA 5F0WA 3US5A 3PEJA 4YQWA 2R8IA 3MDFA 5KFPA 1HBOA 5KOXA 3GV7B 4YHHJ 1GNKA 1HNZF 3KJVA 3ZZRA 2W01A 1MU2A 5L38A 1VQ8S 3M8YA 1YHQS 4XAKA 4M5KA 1IKXA 3WIVA 3UWTA 3VAIA 2ZITA 4N41A 3ET6B 1I1GA 1VDHA 2Y1IA 5I3UA 1VR6A 1F60B 4NEZA 5A0YB 2HLUA 2ZH7A 2MZTA 2GJ2A 2W9BB 4MKAA 1KWMA 1Q5YA 4I2QB 2I9SA 4LSLB 2MY7A 1WTBA 2CJAA 4XK8C 2VB6A 4CO0A 1OS5A 1RT4A 4DZDA 4OIXA 1AA1B 2BKOA 4F36A 1Q95G 5M2UA 4F4KA 2RDIA 4MKVA 5B0EA 5KFQA 2V8DA 3TX8A 1UVIA 2ZM6J 4B3TJ 3LPEA 1KLMA 3GFHA 3TAMA 4DQIA 1RABB 1HQEB 1XNQF 4MJKA 1BLUA 2YKNB 5K8MA 3PDNA 4GVBA 3CCLS 4LR9A 3M2RB 1OSCA 3CPWR 1CSJA 1D09B 1QD1A 1APSA 5LRNA 4F02A 5IQ6A 2Z2MA 4NLUA 4UOPA 5CQGA 4P52A 1KOOA 3HF5A 3MFIA 3BN7A 1EI6A 2HBZB 3MMJA 2ZH8A 3UD5A 1WG4A 2GVDB 3VAGA 4YS2A 4KTQA 1FKPB 3NWRA 6FDRA 4UF4A 5KT3A 1N54B 4OI4A 3CC7S 2B9XA 2CPJA 3SZ2A 5GMEA 2DD8S 2YKPA 4EO6A 5GVQA 1S57A 3NOCA 3QT5A 1SJ1A 4HACA 4NEYA 3GSIA 1NBEB 5FDLA 2MQOA 2LEAA 3RRKA 3A52A 3THPA 1DQ9A 2U2FA 4ED0A 3C15A 4EBDA 1HNIB 4IKAA 3C46A 2E66A 4IFYB 2E5LJ 4ED7A 4DR2J 4E2FB 2JH3A 1E6YA 1N32F 2KM8B 1XMBA 3BGRB 3C3LA 2FY1A 1HMVA 2ASYA 4WIQA 3MAAA 4WYWA 3R7NB 1B70B 4IRDA 5HQLA 3CWJA 5CH7B 3AODA 4ZP8A 5KFVA 3R5GA 1UFKA 8AT1B 5IJQA 3PVXA 2CPDA 2YVSA 4H4OA 3IG1B 1YWXA 3UDLA 2XY5A 3M8QB 4X64J 1PILA 2NUHA 2FY8A 1T8EA 2Q43A 5EHHA 1CEZA 2EG2A 3BSOA 2HIYA 3KOAA 3CE8A 3BGLA 9ATCB 2VQFF 3O3LA 3W3SA 2OI2A 4ZCLA 1WACA 3T3FA 3D1QA 5KG3A 2LXUA 2CPYA 4UOOA 5E0OA 2HRYA 1ZPVA 3G87A 3WX4A 4QZVB 1S9GB 2FVPA 1JLCA 3ILIA 4HLBA 1EQJA 4EMDA 4DHVA 3Q2TC 3HSDA 4KSEB 1SKRA 3HHLC 1U6ZA 4G1PA 2ASDA 4PWUA 1FFWB 2R7UA 2MKYA 3HO1A 4NLPA 1VC0A 2JZ5A 1VQYA 4C0HA 2AJ0A 4OJ3A 2AEMA 3G8QA 3NCPA 1FJEB 1KEKA 2K7KA 3GV8B 3MAQA 3SFUA 1HHSA 2YNFB 4Q0BB 3R7BB 2AGQA 1DRZA 2J8SA 3I9ZA 3UVJB 4JI6J 3RTVA 4GTZA 2KO1A 2XCAA 4O3QA 4A46A 3DOMB 4ZPDA 3W5XA 1M5HA 1ITPA 1WOOA 3CJKB 2CDQA 2X1FA 3FDSA 4D3HA 4RJVA 2M0GB 4KV8A 5IT0A 2HK2A 1SH3A 4TNOA 3WAVA 3W63A 3GYGA 3FCWA 2HQIA 4NLOA 1LK7A 4K4VA 1WEXA 3UI3A 2Z2ZA 3G6VA 2VFUA 4ED1A 2ACMA 1JLQB 4GKKF 2ADBA 1NK6A 4CLKA 4X4NA 2RJZA 2VKZG 5KFHA 2W2PP 3JSRA 3UD4P 2CPFA 1RT7A 2HAIA 2A10A 1TQLA 3OL8A 4RW7B 5KTQA 3FQKA 2AV5A 3JS9A 2OHDA 5FJ4A 2B4OA 3S8SA 2CQ4A 2MLYA 4UQTA 3BYPA 4O3OA 3ZFVA 4ZVHA 4KBIA 4NCGA 1H98A 3I96A 3CEDA 3P8BB 2CYYA 2QC3A 4AL7A 4IH6A 2MZ1A 2QMUB 3V6JA 4U67Q 1IQTA 3UN2A 5D8HB 3GJRB 4DV7J 2PEHA 1JX4A 2OMOA 3H2UB 4Q45A 3DOLA 2O67A 1IWAA 3M30B 3OBIA 1Q8LA 1KQKA 4Y2AA 1CS4A 4YB6A 3UR3C 1SXLA 1NK0A 1X5TA 1JKHB 1T3OA 1Z2LA 4WK3A 2HNZA 5DLTA 1RT1A 2XMVA 4FYXB 2CNNB 4TQRA 1PAEX 3OQ2A 2EEYA 4Z7YA 1DARA 1WC0A 3D5MA 2YWFA 5CD4H 4ILLA 5D78A 2C2OB 4MIBA 4OHYA 5AXLA 1M5KC 2W8DA 2EW9A 4YB7A 3J81j 4WE1A 1RU1A 5ADZA 2P6SA 1EJ7L 2L9NA 2E5GA 1Z2ZA 3H4BA 1MN9A 4WYLA 3LALA 2IUCB 4HHHA 4L6V3 2LKZA 3BH7B 4O23A 1RAOA 3AY0A 1JQGA 4BS2A 3NNAA 4LF2A 2V67A 2Y0SD 2YQ3A 1S0VA 4I69A 1WUUA 4CLYA 5KFNA 2JC1A 1AXQA 2AWZA 3MEEA 1XIQA 2DXDA 4RW4B 2FGCA 4KHPF 4NA2A 2BQUA 1VQLS 4MKYA 1HHQA 2KM8C 2H48B 2IMOA 1RKIA 4K4SA 2NZ4A 4J5OA 4DXLA 3ISND 1DQ8A 1YTYA 2NXUA 2C3UA 2YWGA 3MR7A 4LBHA 1GX5A 2YBVA 4TU9A 4YP3A 2OKQA 2G2YA 5M2PA 1RUSA 5LXYA 4J37A 1RHKB 3Q22A 5EX3A 5THWA 2ZFHA 1S9EB 2M8DB 4JP8A 4LFCJ 1HI0P 3N28A 3SV4A 1HD1A 4AYBD 4DV1F 1WF1A 2W7PA 3RR7A 3OHAA 3G8SA 1T3NA 4P10A 2RQCA 3EVOA 2CZ4A 2L41A 1SJFA 4ER8A 1SC3B 2A1BA 3W5ZA 1UVMA 2RRBA 5CYQA 3Q86A 1HWLA 2YKMB 5C42A 5JMNA 1OY9A 4WFXA 5LOQA 4CLTA 1C2PA 3R5DA 4FS1A 2XR9A 1URNA 4EUVA 2W8SA 3PHTA 4RUAA 3DLGA 3HKWA 1SHNA 2EFOA 1FRMA 2NS1B 2F9DA 4QWDA 3DYAA 2D9OA 3IWLA 2YNHB 5LIAA 3H20A 2GA7A 3DGVA 3IGVA 2HNDB 4UTGA 3T19A 5E5NA 4X2BA 1NSPA 3BM7A 2J9CA 1RAIB 2LA6A 4J91A 1FRHA 3KTQA 4F8RA 3IP0A 3ITHA 4YR1A 2MQMA 4DLGA 1P8GA 2W2QP 1YJNS 3OJUA 1Q0NA 2AT1B 5CHCB 2Z4PA 4KY3A 4ZVSB 3UDVA 3RBDA 3NXZA 4UUWA 4LSNA 2XNRA 1JLAA 1NHUA 4F26A 4I2PB 3JAMY 4J9MA 3PX0A 1NPPA 1JNRB 2BXJA 2DT9A 2DR5A 3PW7A 4U96A 4RUCA 1ELYA 1HBNA 2BR0A 1AW0A 2DCUB 3NGRA 3KNAA 1HIYA 5CD4A 4I7FA 2YKAA 5IFMA 3AD9C 5KT6A 3LGNA 2ZZMA 4DQPA 1XBWA 1QJHA 3FFIA 2PA3A 2FLNA 3H0PA 2IC3A 3TA1A 3KLIB 5DG7A 2AEJA 2MYFA 1JLGA 4MKBA 2HG4A 3JB9k 2FQQB 2Q79A 3MR5A 1UP1A 4WU2A 3SSQA 5B0GA 1JJ4A 3IR6B 3OUYA 2QZ8A 3M6VA 2MGZB 4C98A 3C8YA 2OPPB 1RAEB 4J9LA 2Q6CA 3FQLA 3SXLA 4X66J 2MQLA 4GO5X 4PXEA 4UZBA 1XJWB 1ZM2A 4C3LA 2CJ9A 1VC6A 4N7TA 4L74A 4B3OA 1NM2A 2MY8A 5ETLA 2VQEJ 3R5JB 4MFBA 3UCUP 2V94A 2B9EA 2DH7A 3A8JA 3KDNA 4JI7J 2VF3A 3H42A 3Q3QA 3TG0A 2VG6B 2QA4G 3E8OA 5LM7E 4I68A 3W2WB 2NZCA 1SKSA 1I6JA 1ICEB 4USWA 2ZHAA 3IM8A 3HMJG 5T41A 2QIFA 2F4VJ 2DNYA 1N5QA 1U45A 5LJ5Y 2JEJA 4NWXA 2FYXA 3CCVS 2CZ9A 1VLOA 4C8OA 2W2OP 3KNGA 2UUTA 2L3MA 1ZEFA 1XMQJ 1IJFB 1AYEA 3W7BA 4G3IA 2XS7A 3LPYA 1ULRA 3CDEA 5F9LA 3FRYA 5D15A 3DI6B 4ZOSA 2K2PA 4DR3F 4CWBA 1BQMB 1YLXA 1KC8T 4G1IA 2J6SA 3RRGA 1VQ9S 1NRKA 3GILA 4DSEA 2JVRA 1TL1B 3BO4A 2F5GA 3CCTA 3K8WA 2FIUA 3L95X 5HANA 4CP5A 3KLGA 4X4TA 4P6QA 1TV6A 2B51A 4BHQA 2AF6A 1KTQA 1F5AA 3CJRA 3F41A 4X65J 1IKWB 1NJIT 2DNZA 2HBYB 2JLGA 4E8UA 1D3WA 1SKWA 2NLWA 4DQRA 1C1BA 2IIHA 3POTB 1Y10A 1NSAA 2WOMB 2D7SA 2B5JB 1DTQB 2VFRA 1TFWA 1HI1A 3RB4A 1VQ5S 1FEHA 4OFZA 1O99A 2GGPB 2QYGA 3SDEB 3UDEA 9RUBA 1PO6A 1EZZB 2AP6A 3IS9B 1SI9A 1TKXB 1XQIA 2M5YA 3E01B 3VAFA 2FVRA 2GVZB 3OV7A 3B54A 1WOSA 4XDDA 4QWEA 4YHHF 4WK1A 2BYCA 2DGVA 2FHOB 2J0SD 5ETMA 1RGVA 1Q7YT 4J9PA 2DRAA 4ZP7A 2CIMA 3VGUA 4JB8B 1VRTA 1PYTA 2O01C 2G1DA 1I3OB 1N52B 3KG1A 1NEEA 2CG8A 2NXEA 1R6YA 3MWBA 3TQ1A 4MT1A 3DMJA 4ID5B 2KFZA 3VAMA 3FZBA 2BJ9A 2EC2A 3DM2B 1S1XB 4L3NA 2ZOGA 5H9EK 1RTHA 2XSFA 2KDOA 1D9FA 2HQDA 2GSUA 4O44B 4YR3A 4UW2A 1FRXA 2E1MC 2BM1A 1FK9B 3BO3A 2DTJA 2RKIA 4V19X 4BC9A 2Z57B 4CO4A 4NXNJ 2YX7A 2J0QD 4EI2A 4K4WA 1LNQA 3ETMA 5FIIA 2ZM6F 3DLJA 4B3TF 3MPUB 4OJHA 3IRXA 4K5SA 1VHIA 2WSEC 2DHHA 3PRDA 1K73T 5J2MA 2D41A 5J2NA 1RYSA 3SBMA 2XMAA 4CLWA 3W2VB 3N6LA 2BOPA 5LXRA 4WFAQ 3K57A 1X5SA 2DHXA 3NBPA 1TZ0A 2HWHA 4HTIA 3DOKA 2IAJB 3VTIA 3MPYA 4X4VA 4YDDB 4EO8A 1RWXB 5AE2A 2LP4A 5GAEU 1AJDA 2N7YA 5EWGA 4C8KA 3CJ2A 3ZTSA 4ZJOA 4AL6A 4LR8A 4U7CA 5L1JA 1WORA 2BBEA 3MD1A 3TUJC 3EDRB 2J7UA 1Q8IA 3UN5A 4K4XA 2IHR1 2YPYA 2YWHA 4IDKA 5IV3A 1Y00A 1O6XA 1Y5LB 4HH0A 1YJ7A 2KRBA 3S6EA 2BQ3A 2QTWA 5DZ6A 4MY4A 3I5CA 2E5LF 3NVLA 5J2QB 1HL6A 4DR2F 1TVRB 2VC0A 2HIQA 3MECA 2EPIA 3A1YG 3IR7B 2N4DA 3TVKA 4MK7A 3AA9A 3DKDA 3KLFA 5J1EA 1FKOA 1YSJA 4NZ0A 1PCAA 3TAQA 1FVSA 1SC6A 4Y00A 1HR0J 3F0NA 5EN1A 5C2CA 4WTOB 3R3TA 4CIOA 1RAFB 5HP1B 2XLKA 4Q8FA 2KHDA 4X64F 2U1AA 4NA3A 2LA4A 1UZHA 1OWXA 1J5OB 5IC4B 2DNRA 4ANEA 2VBYA 2ZHBA 3CCUS 3TUPA 2HRTA 5AXNA 1V6HA 3PYFA 1B3TA 4M5NA 2FJEB 3NKOA 5HAOA 4I4BA 1WWHA 3TNVA 3FRZA 4ELTA 4PXDA 1T9TA 2B4VA 4FF4A 4OZLA 1BE4A 2A2CA 1O98A 3Q8PB 4NMXA 4P71A 2YKQA 2BJDA 3LAMA 2HURA 1NK8A 2W5WA 2DGUA 2BQRA 3HHNB 2D1CA 2VJVA 2IA0A 3W8GA 1P9QC 1CJKB 3KK1A 5KFAA 3GQCA 3AQPA 3CCMS 3D66A 1XR6A 2DR6A 4DMZA 1RWPB 4OX6A 5T7LB 2QLXA 3OJSA 1FRLA 3DRPB 4DV0J 4IR9A 2JSXA 3EM1A 3DRRB 1NHKL 4WZMA 3D6TB 3IAS9 1S59A 3UD3P 2HNYB 4JI6F 3GYNA 4EU0A 1OPZA 5F3TA 3KMQA 2Q66A 2JEIA 2CQCA 3U1MA 3LANA 5HMYA 3WAWA 4FF1A 1J5EJ 3DLHA 2ATLA 2V5HG 2WK4A 3AOCA 4H4KA 4ZG7A 3VCDA 1WC5A 8ATCB 2J6TA 4M5JA 4HR2A 4QPXA 1YJTA 3IR5B 4NZ6A 5DLWA 2VIHA 4C48A 2ASJA 4B9NA 3CCWA 3VVTA 1SKUB 3HFVA 3DXBA 3MMAA 2B0GA 1R31A 1KH5A 5GADU 4DV4J 4WP3A 3G6YA 3DN9A 2RILA 3MUMP 3D6HB 2QJ3A 3QIDA 1R0AA 2QMWA 3J7Z5 2PIIA 3ZTRA 3TZZA 2CVEA 1VIOA 1O8BA 4CYRA 4ZPVR 3ICLA 3CCJS 2R7OA 2L9WA 1NPRA 2EG1A 4DEZA 1KNZA 2EFVA 1Q82T 4LF6J 4F2RA 2LQJA 3A13A 4DV7F 2H4YB 2ZJPQ 3CB4A 1MMDA 1DY3A 1JXVA 4DQQA 4G1QA 3OR1A 5BYSA 3LUYA 4JV1A 2E9RX 1V9OA 2QLBB 3A8IA 4DSLA 4ZVUB 5D4NA 2AGPA 5CYMB 1WG1A 4QYRA 3KUGA 3BKTA 3NWGA 1AZSB 1SHQA 2DGTA 1N5YA 2WW4A 4EBEA 4F4ZA 4P2FA 2FJAB 1IKYB 2HMIA 2UUBJ 1P1LA 3QBCA 4DN0A 5DDOC 1KFDA 3FEZA 4CTAA 2B4PA 1EKRA 2W25A 3B4DA 1D9DA 2M9KA 1U1NA 3T02A 3M9OB 4F2SA 1RXOB 1UWBB 3R2DJ 3Q8RB 2V2KA 4Y34A 4JI3J 2HFUA 1EW9A 2W8KA 2V8PA 1NB7A 1RWNB 5ETVA 4FYWB 1FFSB 1VQ6S 1SV5B 4TXSA 3BBBA 4IO9Q 1SUQB 1YG0A 1PYOB 5ETRA 4IOAQ 1UCNA 3J7A1 4R5PB 4KO0B 1XC9A 2PMWA 3RJMB 3G8TA 1S4EA 1N33J 1RKJA 3ILOA 3VWSA 1R8BA 1YRXA 3NKYA 2HZAA 2HHWA 1N48A 4LVOP 2CQGA 1RTZA 3L7OA 4FVMA 1WI6A 1DLOA 3NKMA 4Q44A 5AT1B 2ZDOA 1F2GA 2CADA 2CQ0A 4LFCF 3AAWB 3EUNA 2RE1A 1FDAA 1HYSB 3M2UA 3HT3A 2ZKUA 4YFUA 2B3TB 5MLCV 3IM9A 4URQU 1GAOA 5H9FK 4A8OA 1TAQA 2HGMA 5B0BA 3HSJA 3IAM9 1RTIB 1W26A 4F4YA 2WHOA 2FUG9 2R7SA 4DL3A 1L3VA 3PO5A 4ECTA 2F8MA 1NXIA 1TL7A 2PI5A 3AH6A 1YBTA 1LWEA 1BGXT 3LAKA 2CRLA 1RHUB 3L4BC 4WXWA 1RZMA 2XYPB 2IMWP 3OL6A 1JLEA 4KYZA 4IQMA 5KFXA 1KBRA 5GMKa 3TO8A 5GADI 2IBOA 5A8RA 3SQOP 1ALJA 4U7UD 2V68A 2MMYA 1EIYB 1IXKA 2RHQB 2XWYA 1NSKL 3OSNA 5ETNA 2NUUG 2DVIA 5KFTA 1U47A 3FSIA 3MM5B 4UT4A 4KQZA 4K4UA 1X9SA 4QCLA 1HKAA 3VGSA 2Y1LB 3J81Y 4ZVQB 1MROA 2IVMA 1KKHA 2V6AA 2LU1A 2E9TA 1GMVA 2BE7D 3UW1A 1C0TB 1AB8A 3Q8UA 4FF3A 3MPVA 4DL2A 3KUEA 1EP4B 4F3QA 2BANB 3FBFA 3VAHA 3G9CA 2MLZA 4FN5A 3UDCA 5DLGA 3IC1A 2I0XA 2HVIA 1RCXB 1KR4A 2MKCA 1TMMA 1B0VA 3H90A 3SQGA 1KQFB 2VPWB 3BB5A 1FVQA 4OX9J 2XSJB 1RT2B 2QRRA 3C16A 1G3OA 3GE9A 3CVKA 3RAQA 1X8DA 1S7HA 2DR8A 5I4MA 3IBWA 2VONA 4DUYJ 4DSFA 1RTDA 1JJHA 2FPHX 4FXWA 4PPZA 3MXHP 2R8JA 4WCEQ 2KFNA 1HBOB 2XB2D 2QG9B 4KC5A 1RB0A 1VK3A 1MU2B 3RGIA 4O3NA 4PRFA 3NCRA 2E1PA 4X66F 2ACYA 3GJTB 3NS5A 5GOVA 2E1AA 1IKVA 1DHMA 1U7LA 5KG5A 1IKXB 1X4BA 4RL1A 2NPIA 1NJZA 2VQEF 3PX4A 2BJEA 1TAUA 2ZVIA 2W4PA 3UN3A 4JI7F 5I3UB 2QLWA 4M5IA 4RX6A 2E7VA 2JRSA 1WDTA 5C7PA 3IN5A 2FB0A 1T9VA 4ZITA 3O8WA 1X0PA 3SYZA 2CDRB 2F4VF 5KFZA 1DJ0A 2VU5A 1XMQF 2VG7A 1GXTA 3LA0A 4ITSA 2R4FA 3BGOP 4Z2XA 4TKTA 3IFEA 3MUVP 3AD7C 5BXIA 1AFIA 2B6AA 2F7VA 3TAMB 3ENAA 4NWJA 2ASLA 1H72C 4KJGA 2V2ZA 5KFGA 3X3UA 4IG0A 5A8KA 3J7YU 2ZE2A 3KD8A 4C11A 2I1RA 1ELXA 3GFYA 2DNMA 3NKRA 2MDAA 2HLTA 4GVBB 4ZVOB 3I55S 4F3OA 4TU8A 3TP2A 3JYTA 3HX9A 4CCHA 1EETA 1P6TA 4FPRA 5DS7A 5LSLA 1QAIA 4LREA 1KOHA 4X65F 1BUXA 3OTBA 4DG1A 1SH2A 4F4AA 5L1IA 4LFBJ 3HZEA 1N0VC 3TVYA 1HNXJ 3Q83A 2DH8A 1DTTB 3HVTB 4MYTA 3HDSA 2PMZD 4M1KA 2PGCA 4AQYJ 2C2DA 3D6MB 5C2GA 3GIKA 4ILRA 4MTPA 3MK2A 3H7HB 3NGTA 1X4GA 4P74A 2JJ4D 3BH6B 1U1QA 4A8XA 2J6UA 3O44A 5L46A 2JDJA 1HQUA 3C15B 2PO4A 2PFFB 1HWIA 3HULA 4X4SA 1TUGB 1E6YB 1HBMB 3W8PA 4OHVA 3P6YC 3C6UA 1HMVB 2IYIA 1NO8A 3CMES 3ET6A 3H2VE 3DDIA 1HPZA 1FJ7A 2AYBA 1A6LA 1U0HA 1H73A 1F3VA 1DZ5A 3FZ2A 2F63A 2YXLA 4H4OB 5A0YA 5F9NA 1ZPWX 3GP9A 1U1LA 3BJYA 1QDUB 5E3RA 2W9BA 3PW4A 4LF8J 1OSDA 4OV1A 2AZ3A 3DLKB 1B0TA 1PC5A 3DHXA 2AW0A 3CD0A 4JV5J 3OTEA 4BCAA 2OPRB 3LP1A 1ZA2B 3M8WA 2AJ4A 3VF0B 2GIFA 1KN6A 2HFZA 1IBKF 4ZS6A 4TVAB 1S4FA 3JQJA 1X4EA 1ANJA 1PYSB 3QWUA 4NXNF 1RA7A 3KLEA 2GJIA 1RSCA 1GTEA 1URAA 1JLCB 3CC2S 3FEYB 1FRIA 1R3NA 4C4WA 1CJTB 5GAGI 2VA3A 2PN6A 2YKNA 1S6UA 2G2OA 2UUCF 3M2RA 4NI2A 1SPBP 3WBZA 4OI3A 1B7FA 3VQTA 3NOGA 5KFBA 2UXDJ 5KFSA 1ZH5A 3MM6A 2DIUA 2BVZA 1I94J 5CA5A 3T6BA 5KG1A 5F8LA 2ZWOA 2QL9B 1FKAF 4YY3J 4FDIA 1Q5VA 2OSRA 2DO4A 2J0XA 2VBXA 4NLGA 5IWAJ 3TQEA 3PFEA 2R42A 3J7YI 4QIVA 2DCLA 3CIZA 3NS6A 4RKUC 3BDFA 3P96A 5KFLA 3MTJA 1SQEA 5C25A 4B3SJ 4KV8B 4USUA 2FVCA 5B0DA 1BQNA 2CWXA 4KRWA 2IRYA 4NCAA 2LVWA 4GC7A 4OYIA 3A4TA 3Q8VA 3DRXA 3R5CA 5K20B 2LECA 3ETOA 3LH2S 3M2VA 4ZVPB 3CTRA 2HFNA 1EARA 5H9EJ 4EEYA 1YRTA 5ETSA 4CI0B 1URRA 4NYOA 2KT2A 1RI7A 3I0SB 5EX0A 2ILZA 3T6JA 3HPOA 1X31C 3CCES 1KQGB 3E2EA 4DL6A 1WI8A 2CJBA 4DUTA 3MR6A 1HR0F 4PG4A 1SJQA 4HDGA 1MW7A 3CCQS 2EK1A 1MWZA 2JEFA 1TMJA 3EZUA 3G6XA 3BGUA 3VALA 3P49B 1K7HA 1ZTWA 1AJAA 2OTLS 3DOLB 1YJUA 1O5JA 4KFBB 2VHGA 1SIZA 2BJ7A 3P5TL 4F0KA 3TRGA 2LDYA 2HYIB 2W5TA 1CS4B 1Y0HA 1OMSA 3N6NA 5LMNJ 4XPCA 5DRKA 2C28A 1S9GA 2E5IA 5KG2A 1V3SA 2GS8A 5E3AA 3ZZUA 2FVSA 1UKUA 3IDDA 2WVCA 3CSKA 2HNZB 1HJKA 4NMLA 4ED5A 1RT1B 1YJVA 2V9WA 2NYHA 3WDOA 2DR7A 4MYUA 1RTJB 2ZH6A 3NGUA 4WE1B 3T5HA 4KM4A 5F41A 3V4IA 1FD2A 2RNEA 3HHLD 2ABYA 2DNLA 2NREA 2YNFA 3ISNC 4Q0BA 3T5JA 4OLPA 2HHQA 4NE9C 1L3TA 3UVJA 4DV0F 1UJ5A 3G86A 4P72A 3MEEB 3MOJB 3KHRA 3DYCA 2RB7A 1VMBA 2PC6A 3CJKA 2AMCB 3K58A 5A2QU 5K4PA 4IYQA 1S72S 4DFKA 3ED4A 3SMZA 2D1GA 1A9NB 2HVEA 2IJNA 3WZ0A 4PUOB 3W66A 1J5EF 4DL7A 3J7ZT 3BS9A 3SFGA 5IZHA 5E7OB 5KFIA 2N7CA 1S10A 1GQEA 2P2CB 5KT2A 3L9ZA 3HCXA 1LEOA 2RF2B 1NKBA 2KRRA 2UXBJ 3HM9A 1VI7A 2LFVA 2XO6A 2Z58B 4DV4F 2WCXA 3HD1A 3PRVA 1T95A 4YMEA 3VGTA 1OO0B 4RBTA 4C8LA 1XTZA 1C1CA 2EFGA 3BF4A 3CDBA 2JLEA 1TU0B 3BQ2A 2Q6BA 4ECRA 3DLGB 2WONA 4DV5J 2BRLA 4PPDA 2V63A 3GIRA 2NYIA 3DYAB 1S1UA 4LF6F 2VOPA 1U8SA 1S1WA 5GRRA 1WHWA 4QPTA 3MCNA 1NNDA 2A6OA 1FCAA 3GZ7A 2UVUA 2H54B 3IGYB 3NAIA 3MMBA 4YEAA 3MZIA 3ITHB 2F8EX 1VQ7S 4TY8A 3KFWX 3BKUA 4FNIA 3MM9A 4WJBA 4JI4J 1C0UA 3KK3A 1FEEA 2JOQA 2UVVA 1FXLA 1I51B 2JEGA 2UUBF 1OYEA 2GFFA 2GHVC 5AE3A 3NNCA 3QFWA 1Y7PA 2YWEA 3R1HA 4LSNB 1CJVB 1K44A 1X4CA 3UR0A 2X1GA 2XLJA 2H5JB 3U1NA 4TYAA 2W9AA 2XI2A 4FDJA 5KAKA 4JI8J 3WIUA 1W2IA 4JI3F 2W2MP 1Z4UA 2XTJP 3NGSA 4ZGAA 3I5BA 4I7FB 1REVB 2J5AA 3ENVA 5BJRA 2XMJA 4KGXB 4OI1A 3RRHA 1TL4A 1NH7A 4CO1A 4IR1A 3PKYA 1TK0A 1S1TA 1X4AA 3FFIB 4J9OA 2IBKA 2KZMA 2IC3B 3PW2A 4HT7A 2H65B 2AJ2A 1N33F 3K5NA 3L3CA 5AXMA 2W1BA 1MSWD 1JLGB 2P9EA 4QU7A 1ELOA 3VVUA 5I3PA 3QYYA 2COLA 5F0UA 1SVDA 3G96A 1JLBB 2HZVA 3HJVA 4OV6A 2M70A 1YGYA 4KKOA 5KFWA 3B6BA 3DRYA 1X5PA 4FYYB 3W9IA 3MMCA 3GR1A 1UA0A 1G4CA 2KTQA 4B3OB 4FNHA 1U48A 4MFBB 1MG7A 4TQSA 2H5IB 4OI0A 5B08A 1QE1A 2HGNA 4FDFA 2W9CA 1B8JA 3VZIA 2A3JA 5SUHA 4U7UK 3KHGA 2P6TA 4CT9A 5L8RC 3P5BP 3CJQA 5LJ3Y 2RD5C 3MD3A 4CM0A 4USTA 4E0DA 2VJUA 4O4GA 2HNDA 5EGHA 3N9UC 4LF9J 2Q1LA 3LO3A 1RT5B 4GKJJ 1WKJA 2G0CA 4U8YA 4L73A 3FMWA 5E41A 1XNRJ 2ZBRA 4KGVB 4QWBA 2L9DA 4DSIA 1TL3A 3F73A 1H2VZ 4WFYA 4USMA 2YPZA 2AYEA 4RO0A 2XEXA 3NMRA 3EPIA 3EVMA 1RWUA 4YOEA 1JLFA 3KLGB 4I2PA 3RYLA 2DPJA 4ECWA 3AOBA 4A4JA 1T11A 2E5JA 4MIVA 4FBTA 3TJ8A 2KXFA 1GH8A 4FBUA 1V5VA 3D54A 5CZXA 4KB7A 1VJWA 2GIQA 2RU9A 1YJ9S 1C1BB 4MAKA 3LW5C 3H25A 3CUNA 2OMLA 4HYKA 1ZTTA 2B9YA 5FLXU 4KR0B 1ZZNA 1NZ8A 4M94A 3AFGA 3ZNJ1 1VQOS 4QOTA 3FCVA 1TL5A 4URSA 2VD3A 4OX9F 1ACMB 2CNLB 5DLFA 2WVBA 1O0PA 3N5FA 4FF2A 5H9FJ 2KVQE 3A3NB 4NXMJ 4DUYF 1HA1A 3SSSA 2MGZA 1HNZJ 5K8OA 4QBUA 4K7QA 4A48A 2CFXA 1E2SP 2VODA 2OH2A 1N56A 2QFJA 3LWMA 2QA1A 1RK8A 1AUKA 4HI1A 1HARA 1IR0A 4USJC 3PYDA 2N3OA 2E1CA 1VRTB 1WG5A 3SCKE 2PD1A 1U09A 3V5RA 3GSDA 3GWCA 3AJ1A 2MQPA 1G7CB 4OHZA 5KG0A 1K1SA 3DMJB 4RR5A 2W5VA 1FNMA 1ZAXA 2NCKL 4J90A 3IBCB 4RPFA 1CVJA 1RTHB 4CRJA 4K5RA 3ZZPA 3BDPA 2NXNA 5GMDA 4J9KA 4NYPA 3V6DA 1FSUA 2DITA 1PGZA 4QQBA 1BQMA 3ZXWA 3IRXB 3M8PB 1EW8A 1E6VB 2M3DA 1JMTA 5J2MB 1CG2A 3R5BA 5J2NB 4X4PA 3QT6A 4PQUA 2AD9A 3L09A 3M32A 4RU2A 4FP9A 1IKWA 2IM3A 4C8MA 4Y28C 3M8SA 3NBPB 4PABA 3OXGA 3DOKB 3JTPA 1UEVA 2BW7A 2F4FA 3POTA 4MMOA 1VBZA 4ECXA 4LFBF 2ZBQA 2IM1A 1DTQA 1HNXF 3I31A 3N79A 2DISA 1KTVA 2ZVSA 3Q24A 3GFXA 5A6WA 1ZAWA 5HLFA 1FERA 5KFCA 4ZHRB 4USVA 2GGPA 3EWGA 4AQYF 2FDNA 4IDKB 3BR8A 4F0MA 3H5UA 3IS9A 3WBHA 5FD1A 4ZP6A 4NOHA 1NK7A 1Y11A 1VOMA 4RZRA 5JVGQ 3PR4A 2ZWPA 3SEOA 3D28A 4P7TA 5IQQA 3PJWA 4CXUA 3OTCA 1X9MA 3T5LA 3TZYA 3D3CJ 4USIA 1FNOA 4ZCMA 3MECB 4DX7A 5AXKA 2ZH3A 4I67A 3EGVA 3HVWA 1AUDA 3AD8C 3LOUA 3R1LA 2DR9A 4KJDA 4W90B 5I42A 3I9V9 2EFQA 3KLFB 1FKOB 4DR4J 3T41A 1LQ9A 4P2MA 4DFJA 1HWKA 1R0CB 1RWMB 2BJ8A 5BR8J 1S1XA 1YIJS 2W4CA 2DHAA 4OZ2A 5HROA 1CLFA 2XMTA 1RAAB 4LF8F 1OYDA 1TR0A 4JV5F 3JTNA 4LIRA 2CA9A 3O1LA 3OXLA 4LRAA 3T9NA 4ETXA 4O44A 3DLEB 1YVFA 4XIUA 4ECSA 1E1ZP 3R27A 3QNWB 2RUSA 1FK9A 1XK8A 5F8MA 1TKTB 4LJMA 3G2XA 5ETQA 3BPSP 4O3RA 2C3PA 4JI1J 3BN4A 2JC0A 2Z8QA 2GX8A 1PJ7A 2ZBPA 4DV2J 3VAJA 4XTTA 1PG5B 1Y3JA 3MK0A 2XZWA 3QZ7A 4DX6A 3C14A 4IUFA 1VBXA 2R3VA 2E44A 4I1TA 1KRPA 2PT0A 5D6GA 2CUYA 2UXDF 1B64A 3TJ9A 2IAJA 1I94F 4ZIVA 2K1RA 4DLEA 2BV3A 2CPHA 3EICA 3RBZA 4TN2A 3QRRA 4LRDA 3JSMA 1N5SA 4YY3F 2VDIA 2G9OA 5IWAF 2C2ZB 1VRUB 4UZCA 1PSDA 3BSNA 4ZJLA 4H4MB 3PRBA 2Y1JA 4OZNA 3WHIA 3T01A 5BYRA 4B3SF 2O5DA 4OYPA 4K4TA 5LRMA 2RT3A 4LF5J 4ZP9A 1S6QA 2XYGB 1YITS 3ZNUA 1LV5A 1DFDA 5A8WA 2L48A 2XZDB 3CC4S 4LRBA 1Y9OA 4HDHA 1KLNA 1WEYA 2ZZTA 3MM8A 1CJUB 4KGKA 3GYXB 3WX8A 1IWGA 3CGIA 1SH0A 3OXFA 5KFDA 1S49A 3RAXA 3MMAB 3HK2A 3T1AA 3S7RA 2ZH9A 2ATCB 4DS5A 3GIJA 3DDKA 4CXKA 3FKBA 3RBEA 3ZO7A 4ZPBA 4WWSA 2M7SA 1UPPA 2RDDA 2V4JA 2QL5B 2GV1A 5HP1A 4YR2A 4K8RA 2N3LA 4D3GA 2JX2A 1XR7A 2DHSA 1IR2A 2W5QA 5ETPA 2MZJA 4PEOA 1Y3KA 4G1QB 3OR1B 4YDXA 3WC2A 4QR0A 2LLZA 2IM2A 1S48A 3K89A 1ZM9A 3Q89A 4LF4J 3U7JA 5LMNF 5L1KA 4JBCA 2QYCA 1FTCA 1YKWA 1N5YB 3NY0A 2HWTA 1IUJA 1VRQC 2PSZA 4DJBA 2QSWA 3PFOA 1T9UA 4QIFA 1NPKA 2DKOB 4CTAB 3QPIA 4PKDB 4QWCA 2DHGA 4OI6A 1P9YA 4YR0A 3ELHA 3DRPA 3Q8QB 4WFZA 4S0MA 3NKPA 4IO1A 2RS2A 1VJQA 2HQ3A 4DWIA 4AT1B 1K8AT 1SL1A 4BDPA 2K8GA 1WKLA 4LRFA 3I56S 4LQ3A 5C24A 4N8OA 4JI5J 3CJSA 2Z2LA 2RDJA 2HBRB 3NCQA 3D0HE 2KT5A 4ECUA 4N47A 4R8UA 3UPFA 1M1HA 4NZ7A 1FJCA 4RUBA 1Q79A 1T02A 1YBUA 4MIAA 5L0KA 4F4WA 5DZ7A 4ILMA 4RNNA 2UU9J 4Q43A 4ALZA 4C2MA 1DLOB 4RW8B 1D0EA 4KHMA 4DV1J 4DQSA 3M8RA 1HQ2A 4M5DB 2QMXA 4ELUA 1VQKS 4K59A 4ES2A 4ZLPA 3R97A 5DGBA 1D8ZA 3M2UB 4N8NA 2PFDA 2UUAJ 2UXBF 1NAQA 4B08A 3GJQB 1GMWA 2MQ8A 1SC1B 4DX8H 1WNEA 1U2CA 4KAVA 2EK6A 1TUVA 4RNOA 4LVNP 1PIEA 2AYGA 4LT6A 4QJVA 3BREA 5KFJA 4PXBA 2W5RA 4DV5F 2W2NP 1VGYA 1JLEB 1XEZA 2K06A 3MEDB 4P75A 1FDNA 3LP0B 1S6PA 4B9MA 2I5JA 2VV5A 5A8RB 3QATA 4IFVB 5CYMA 1MN7A 4CQ1A 1UEUA 3MEGA 3OR2B 3M1VA 1OPIA 2JLFA 3KMSA 1FD8A 1NKEA 1V3RA 3PZPA 1N34J 2XNQA 2M52A 1EHWA 4JI4F 2H3EB 3I0RA 4NLRA 1MROB 3FSYA 3IGNA 4DR7J 2A6MA 4QW9A 4ZN1A 1N88A 4CLZA 4UPKA 1UWBA 4U95A 1IM6A 5B09A 7FDRA 3M6XA 3T00A 4H4KC 4ES1A 1R8PA 3PM9A 2VICA 1SC4B 2BDPA 3MHYA 3M7VA 3TVZA 4JI8F 4F50A 5HRTA 2VC1A 2FC8A 1IM4A 2DGSA 4Z7CA 3OFGA 3EJMA 3R6LB 1SIWB 1T0TV 3RW6A 1LFPA 5A76A 2R7RA 3K17A 1ROFA 3SQGB 2BA9A 2MKKA 1SL0A 3ILLA 4DN9A 1FX4A 1U6BA 2P8IA 3C16B 3KLVA 4LF1A 4QWAA 4USKA 2CVIA 4DR6J 1M5PC 2CPEA 2DY9A 2A18A 5DQIA 1RTDB 1L3UA 2UVWA 5JXSA 1U1MA 3T5KA 2HHHJ 5HQ8A 4DS4A 1LW0A 1HYSA 2FLOA 3VZHA 3H2LA 2OUGA 1RAHB 3DGPA 4USHA 5ETOA 1QTMA 1IKVB 3UE2A 3F56A 3HVRA 3KJNB 4ED3A 4ETZA 1D8YA 3D3BJ 5HVFA 1AJCA 4TN0A 4IG3B 4WP9A 2BJ3A 2W5SA 3MPWA 1UWAA 5ETKA 4A8QA 2MSSA 2HK3A 3IO1A 1GT8A 4LR2A 2MTLA 2VG5B 1PC4A 3FUYA 5LMUJ 5HJXA 2ERRA 3MUTP 4WTYA 3EDQB 4QW8A 3ZZOA 3RUBL 3ZC4A 4RU9A 5HN0A 1RJJA 3PYGA 4ERDA 4LF9F 4QR2A 5CZVA 5KOWA 3JTOA 2MZRA 4GKJF 3B8HA 2VG7B 3P3DA 4CLSA 3QGHA 2K7JA 2WB1D 2F8HA 3MM5A 1XNRF 2DEIA 4A8WA 4HHJA 2B6AB 5DGAA 5I3QA 3BDHA 2C2KB 3PHEA 1GMUA 5IS2A 1F2HA 2QEXS 5L0BA 1NU4A 1JJCB 4IG0B 1LW2B 5A8KB 2R8KA 2ZE2B 3EGZA 4C11B 1JJ2R 2VOOA 1YQHA 2OFHX 4DUZJ 1BWVA 2FD2A 2BKPA 1K1QA 1O51A 2CQDA 1U4BA 1C0TA 3Q23A 4WFNQ 1EETB 4U9RA 2E29A 2ZOMA 3G6ES 2MKJA 4CYUB 3FBCA 1T05A 4DG1B 5LL6d 2MJUA 1UTAA 1Y7AA 3M4XA 5G0RA 4QYZJ 3SCJE 4FXDA 3QIPA 2EBEA 4U6PA 4GC6A 3DRSA 2FGOA 4DSKA 1NJXA 4PWWA 2DY1A 4JYAJ 1WD6A 3J80U 2KYZA 4I6WA 4NRTA 2DBBA 4W4MA 3ISZA 4UUXA 4OYAA 4NXMF 4GVLA 1HQUB 1GMWD 2C2EA 4ZK7M 1RWVB 4J9VA 5HVHA 3ZZZA 3EX7B 3C6UB 3TX0A 3EZOA 3O2IA 1FWKA 5L0EA 1KQSR 1HPZB 3LP2A 2AJQA 1U0HB 5DJBA 5T14A 2RRNA 1AUSL 2RH6A 4OYWA 5E2QA 5CABA 2X3DA 4OYMA 1NSQA 5K14A 1U24A 3LP1B 1NK4A 1AT1B 4CH7A 4PYAA 3IXQA 1H0HB 4E98A 3QSYB 3CULA 3JSBA 1HFEL 4DL5A 2CJKA 4KT0C 4OLOA 5HBMA 1C4CA 4Y2CA 1HNVB 3LF0A 2XI3A 4B9TA 3KLEB 5ETTA 3QT8A 1VQMS 1GXUA 3Q2SC 1H7XA 2WTFA 1EW2A 4CLLA 5TJ3A 4AL5A 1J2VA 2OIHA 2DEJA 3CJ4A 2R2SA 1PJ5A 4HI2A 2GSNA 4LIWA 4NI2B 4PWDA 2E1RA 4CH0S 3PO4A 3RB6A 1KS2A 2FJDB 3MM6B 1RAJA 1JXLA 4C8ZA 4DV3J 4J9RA 1F9EB 2YTCA 2BW2A 3CF5Q 1FRJA 2HZCA 3RBXA 2XYHB 2JFDA 2RVJA 2YNGA 5IXUA 2RH3A 1R8AA 1GX6A 2GC8A 2NSBA 1DTTA 3HVTA 4MK8A 4CT8A 1WSRA 4NLSA 2H5EA 4NPOA 1W25A 7AT1B 2V9KA 1KHVA 2DNHA 3MEKA 2F3JA 5B7WA 2XGQA 2C2MB 3KXDA 4WFBQ 1RHQB 5C25B 4PZVA 4ZPWR 4ZLLA 1BQNB 3GB0A 3LGHA 4Q2MA 4Y65A 2LMIA 3I32A 4ZN3A 4OHWA 1HI8A 1GEHA 3N5BA 2KI2A 4TY9A 4DPOA 2C2RA 4ED8A 2R7QA 2M2BA 3D4JA 3W61A 1HBMA 3M2VB 3MCSA 4LUBA 4KPCA 2NXJA 2GNKA 1NMEB 3UFCX 4P7VA 2D69A 5HMZA 3GPAA 2ALZA 4CM2A 2X1BA 1WELA 1MLAA 4DR4F 1S1VB 2KVIA 2OGUA 1ED8A 5BR8F 4RBVA 3DLKA 1Q53A 2OTJS 1U0SA 2OPRA 4CH1A 1TELA 4BBYA 3HFKA 3HI9A 3PW5A 5DQHA 4DPXA 1U25A 3CD6S 4KAYA 1YBAA 4FVCA 2HPUA 3TI0A 2R8GA 3EXYA 2C1EB 2HHXA 1KHKA 5IC6B 4DCPB 5KFMA 4JI1F 3EE3A 1BMQB 5CCMA 1H7WA 4RW6B 5KFYA 2BE9B 2XZTB 5CYJA 1CJTA 4DV2F 3DDNA 2IYGA 5HVGA 3FJ2A 3QWPA 1VBYA 2ANHA 1VQNS 1YDLA 1VFJA 1RDRA 1TP7A 2EFPA 3H5YA 3HHDA 1XN9A 2ROGA 2IJRA 2ZZNA 3V4IB 1KONA 3BDGA 1EX8A 4N5SA 3M9MB 2MHEA 3X1LB 2VFTA 1XMOJ 4Y3CA 5IM0A 3CDAA 4KE5A 3G4SS 2DNPA 3CT9A 2XBPA 1Q1KA 2CKWA 1CULB 3VGVA 2Z2YB 1P1TA 3K5OA 1UZDA 1LWCA 2YH0A 4ICLA 3QGIA 5B0FA 1RLCL 2MZSA 3U1LA 4F3MA 5LQQA 3NG8A 3NRBA 3NL0A 4DR5J 2Z0GA 3V81B 2ZH1A 4LF5F 2V2QA 2WRMA 3SCIE 3AB4B 4FYDA 4R0JA 2BMBA 1RWKB 1NLKL 3QFHA 2G9YA 3KHHA 3HZGA 2FHMA 3OL7A 4B56A 1X4DA 1IBLJ 2OPSA 2J9EA 2OEJA 2LEBA 4IQXA 1UA1A 4XO0A 4K2XA 2QE5A 1ZA1B 3FSXA 3M6WA 1CQNA 4P9SA 5C66A 3KLHA 3I0SA 4LQ9A 1EQMA 3D2WA 4BWMA 1FDDA 4K4YA 3DU6A 3O6QA 1M5OC 3GMGA 1XR5A 4O4RA 1SBRA 2KJVA 1S9FA 1C1CB 3HLUA 2XULA 3JQKA 4MK9A 4JV0A 3WQPA 2C42A 4HHUA 1M1GA 1NDKA 1UEKA 2WONB 1UJ4A 4KFBA 1S1UB 3M05A 1S1WB 3AA8A 1VS3A 2RQKA 1FTRA 5L9NA 2RSQA 4KPYA 2APOA 4NLVA 2ILYA 4ZPCA 3QGGA 2Q3PA 4B3MJ 4A8KA 1WF0A 4IRKA 3BV8A 5F8HA 2ZD1B 4WU3A 2HAFA 2VFVA 3B5QA 4KGZB 4RW9B 2FJBB 4LF4F 1KFSA 1LOUA 1N0UA 3Q8YA 4L3KA 3MMBB 4Q2LA 4URGA 2QV6A 4CO2A 4TY8B 3FVYA 1U1OA 4F04B 1A7GE 3G82B 3MM9B 1C0UB 3KK3B 3EZ5A 4DFPA 3HFZB 1RTJA 2XO7A 4K0KJ 5IJSA 1AJBA 4N76A 3KDOA 1VC5A 5F8IA 5D3GB 3CD5A 1RHMB 1REGX 4HT5A 5DETA 4KH0B 3E51A 5AE1A 2VQRA 1HD0A 3DNCA 2GHWA 3MM7A 3TEGA 3B78A 1BHNA 3ILJA 1NZAA 2C2NA 3OHBA 1T9WA 4TYBA 3A8KA 1K0VA 2OPQA 2BE2B 3AOAA 2QL7B 2WBMA 4Y2MA 2BOAA 4NCBA 5L39A 1MNEA 3FMBA 3NLCA 3PEHA 1SJRA 3LXQA 3PR5B 1LWFB 4J9SA 1G6BA 3PY8A 4JI5F 4DOZA 1B7YB 1AFJA 2XQCA 1S1TB 3D68A 4WIIA 5HL7Q 2N82B 2ZH4A 3MK1A 4PUOA 1RBLA 1RA6A 4DU7A 3MOZA 1XWLA 3GU0A 1V3ZA 1GFWB 3DU5A 2ZJQQ 1HBUA 4UPIA 3OVSA 1WHVA 2UU9F 3MI7X 5A2QY 3KK2A 4FZVA 4HH1A 2J0WA 5EUHA 4OYBA 2JFKA 1Q4RA 2KH9A 3QO9B 3N01A 1FWPA 1SB6A 2JVOA 2RF2A 4KKOB 2HHTA 3FC9A 1EQ0A 3PTWA 5CCLA 3MMCB 1TKZB 3QJPA 2FZCB 1QVFR 2BACA 2UXCJ 4TLQA 4FKXA 1QLNA 3TJAA 2UUAF 1KVJA 2CJYB 2GLQA 1PJ6A 3QQCD 3AXMA 3BKFA 1QE1B 2K3IA 2W9CB 1PBUA 3IGZB 5KT5A 1GK8A 1OY8A 3HD2A 3T1HJ 3R8YA 4M63A 2ROEA 3EGWB 2YNIA 3CCRS 2IFXA 3LQVA 2Y8WA 5HATA 5CXTA 2HRUA 4O4GB 1YJWS 2VASA 3MCMA 3TAPA 3ADAC 3I4PA 4Q7AA 1EJJA 3GONA 4ZPAA 3MAHA 3CJ0A 4A8SA 3WAYA 4NLDA 2RUGA 2MHNA 4OZ1A 1RT6A 1EB0A 1TL3B 3ENWA 4M5LA 3C6TA 2MJNA 2XMKA 1NDPA 1N34F 1M1KT 1E3CP 2XM3A 2ZH2A 3FGVA 4Y2KA 1R8CA 2AEFA 1M5SA 2YQ1A 4I0WA 2Y3YA 1NJYA 2HHSA 1UVLA 2AIRB 1KSPA 2PMHA 1CJVA 4DR7F 2CQPA 3IRWP 3OVBA 1JLFB 2JWNA 4DBQA 2O66A 4EYHB 3KJVB 1WSVA 2DGWA 2ZEJA 5KT7A 3BQ1A 4O0IA 1S12A 3PNIA 1X0FA 4NL5A 1Q7LB 2LYVA 4K2JA 2CQ1A 2UV8A 1X7VA 4DFMA 1REVA 1RT3A 4LFAJ 5J2PA 2R7XA 3P45B 2YKOA 5J1PA 1VK8A 1U02A 4F7VA 2AJ1A 2MSTA 1ZOTA 3ZTQA 5DG8A 3TA0A 5E3CA 2D9PA 1QM9A 1PAUB 5GAGU 1S99A 4DR6F 1DURA 1RT4B 2KFYA 4NLYA 1FESA 1U26A 1JLBA 1UVNA 4ID8A 2DRDA 1A0OB 2GO8A 1VQPS 5D0HA 3CJ8A 2HHHF 4BLGA 2AYMA 2XGPA 3KG4A 3BPDA 2HHVA 4X62J 3A3OB 5C5JA 5E33A 3N6MA 1T03A 3QJJA 1KLMB 1F3FA 1N2LA 5HO4A 2ZC4A 3HSZA 5F3ZA 1UW4A 2E7WA 3W60A 1N5VA 3TANA 4RUHA 3W5YA 3PW0A 2D74B 1N6QA 1FE4A 3QLHA 2EVZA 4ZMMA 4A8MP 2HVDA 3D6FB 1P49A 4OZ3A 3W1YC 3NP5A 2VPZB 1RP5A 4ED2A 2DGXA 5LMUF 2JL9A 2HQGA 2X1AA 2HKEA 1RT5A 2X51A 1ZAVA 1KHLA 3HHLA 1YZ6A 3V6DB 1RWOB 4WZQA 3OFHA 4UOCA 4WBFA 2KHCA 2C3MA 3D0IE 2WW8A 4ENOA 1X9WA 2OP5A 5F8NA 2HSEB 2XWXA 2PDAA 4UOHA 2BM0A 2HQCA 1UPMB 4IOCQ 2DXFA 5AJ3J 4HACB 1VCTA 5FDLB 4PQUB 2GAGC 1RWWB 4RWWA 4DUZF 1ZETA 4UY85 3K8VA 3M32B 1FO1A 1ZM4A 4QR1A 1ALKA 3QMQA 3GCXP 2J76E 1H74A 5EWFA 4ZVTB 3K0JA 3MAAB 3FBBA 1N8RT 1S5ZA 4MIWA 4OQJA 4ZJQA 4QIEA 3OPKA 2GHPA 5DLVA 3SZZA 2RQ4A 2MPUA 4CLUA 2QLJB 4LQYA 4OL8A 2BX6A 3MPDA 4PYDA 3UCZP 4KIAA 1HNWJ 3DCAA 5HLFB 5JVHQ 4CDIA 1HWJA 4C97A 2DNQA 1H38A 4I2QA 4LSLA 2V4RA 4NLWA 4JYAF 3VR1A 4C9DA 3T1YJ 4FPIA 1BY9A 2Y8YA 2GAHC 1PBAA 2VZ9A 5FLXY 2DYAA 1U1KA 4DL0C 2H4WB 3FBEA 4B3RJ 2KT3A 1YRUA 4EBCA 4AXJA 3IBFB 3R5AA 2GQQA 2H1YA 1FXRA 3OW2R 2FZKB 4OZ0A 2FHKA 4OZJA 1WEZA 2N4CA 1TTHB 2CQBA 1URBA 5I42B 1HQEA 2FLLA 1IR1A 1N5TA 4J9NA 2ADCA 2FHJA 3CDUA 5D4PA 1MMLA 2WBRA 3H5SA 2SXLA 1LK5A 2HS3A 2EKYA 5HROB 3EVWA 1S97A 3EPGA 2IPOB 4F4XA 3CO0P 1UL3A 2G1HA 2QGFB 5DM6Q 2GVDA 2XS2A 4ECZA 1YX2A 3KYLA 4GO7X 1QTNB 4DV6J 1IBKJ 1R0BG 1JK9B 1KH7A 4UPLA 1FKPA 3KWMA 4Z37A 1KDNA 2XC9A 2HGLA 2AKWB 2B4UA 3A12A 1UJ6A 2ZUGA 1KP6A 4ZLJA 4U8VA 2JHEA 1N36J 1HHTP 2MEWA 4WXOA 3M8PA 2V50A 5HQMA 2M88A 1U2RA 1E6VA 1Q8BA 3M8ZA 2IRXA 2UUCJ 2XY7A 2IFYA 1K9MT 1PKUA 2MQQA 2KG1A 2XLIA 3HP6A 5B0AA 1HDHA 3C14B 4ECYA 2GSOA 3BR9A 1HNIA 5GAHU 4IFYA 3H40A 2P9GA 3M9NB 4DI6A 3ZZYA 3CW2C 1RT7B 3BGRA 2RQMA 4DV3F 2CPXA 2K1RB 2AU0A 3GG1A 2V0NA 3QAEA 2D3ZA 2CPIA 3ENQA 1LXNA 3PIOQ 3JSMB 1T9XA 4BWJA 1R7IA 1WKKA 1RYRA 2BZ2A 2BUNA 4NCGB 2FJVA 3IG1A 2AGOA 3PCOB 4HL9A 3ZZ0A 4JI0J 3M8QA 1RBOB 1F0XA 4ZHRA 5B0CA 1WHYA 1UMJA 2V8VA 1ZS6A 2KG0A 3AJ2A 2B7BB 2R8HA 1BD6A 5EGEA 2WB4A 3N4WA 3NGKA 3H98A 2D3OR 4PG7A 1WDDA 2GMLA 3BYRA 4OHXA 1S6QB 1B99A 2KU7A 5DM7Q 5A8WB 3NGDA 2POKA 1ALIA 3NAHA 2ZNZA 2HQFA 3TYTA 4ANDA 2V8HA 2W8LA 3MM8B 5LT5A 2CQHA 1OJ4A 1UVKA 1QSLA 4KJIA 2FJXA 1V5IB 2ZUAA 3JXOA 3F44A 3GLJA 4DPYA 3PV8A 2HFSA 2RIJA 3LTOA 4TU7A 2EKNA 1J27A 3QT7A 2DNKA 2V4JB 4ZA1A 4ZVRB 3VV2B 1CC7A 1YK9A 4KAIA 3BZQA 2LQ9A 1Q16B 2CPZA 3GFZA 3ONQA 2R7VA 2G0IA 2WVDA 5IT9Y 1B4SA 3DLEA 5HI7A 2UVRA 4X4RA 1FNXH 3BO2A 3DXSX 2XCPA 2MQNA 2YWWA 4C0BA 2EI5A 3OSPA 4C3KA 3THTA 2ROPA 3DOMA 1TKTA 1YZ7A 1LXJA 3TEHB 4DDFA 5EGYA 1QUPA 1RHRB 3D9BA 4OMFG 1ELZA 4JI2J 1NHVA 2LQBA 1IBMJ 4KHRA 3I82A 2J9DE 2QA4S 2B8QA 3VHQA 2CNKB 2GMHA 1Q78A 3QRPA 1BC6A 1FJGJ 1L5UA 3R9LA 2BEFA 1HWUA 2GO9A 1JLQA 1VQ4S 3CJ3A 1WC1A 2VPYB 4J7CA 1Q81T 1TUWA 3D1OA 1R27B 2CWKA 4UORA 2UUWA 3EXCX 3V6KA 4RW7A 3TUIC 3UNGC 2ZC3A 2I8EA 4CLPA 3E3XA 5LSRA 1M0SA 1GTHA 2P5VA 5CYQB 1XMOF 3W9HA 1YI2S 3CMQA 4HTJA 5SZTA 1VRUA 2DJWA 3CMRA 2KL8A 4M5HA 5C42B 5C24B 4H4MA 3FK4A 5GAHI 2D3O1 2BABA 4R8UB 4V19J 2XMUA 1QAYA 1ZYQA 3DHWC 2VL1A 1YJRA 3MGJA 4I6YA 1R89A 3M30A 4F0HA 4DR5F 2YX4A 2D3UA 2GCFA 5GAEI 2FJWA 1CJUA 2O1PA 3GG0A 1JKHA 1WJ9A 1IBLF 1WC3A 2FHJD 2UZAA 2RAQA 1CC8A 2I38A 1UW9A 1QSYA 3HVAA 1SJ3P 4FS2A 1Z1ZA 4EGLA 3JAMU 2LCWA 1DAXA 1S76D 2NXCA 3MURP 4ZDNA 3V4MA 4ZLNA 2NPFA 1EKSA 3BSAA 1JB0C 2LQ5A 4CYSA 3FEXB 3PJ9A 3WC0A 5K8NA 1S0OA 2AHOB 2IUCA 1JLAB 2AJFE 2QSFA 3TW0A 5KFEA 3D1HA 2Y0BB 1U8WA 2MLXA 5F8JA 1HBNB 4A8FA 4RW4A 3OL9A 2MKSA 4L75A 2CQ3A 1S6PB 2I5JB 5L1LA 4DX5A 1L3KA 5KXAA 1EAYC 2E5HA 2QFIA 4ECVA 2OJ3A 4B3MF 2H51B 1KHWA 3MEGB 3M1VB 2Z30B 3LWLA 4LBIA 2ZBIA 2B43A 3DPCA 3GJSB 5BYQA 3HJFA 3TA2A 2CJXB 4F25A 2EC0A 3U02A 1S9EA 1SL2A 1SQFA 3I0RB 2EFNA 2RS8A 4K0KF 4YN3B 4QYZK 3OFEA 2LDIA 3OUYB 1OQ3A 1CPZA 1S77D 2QX0A 4PG6A 4O3SA 4CXSA 1AROP 1VBKA 4WPAA 5KFFA 3KHLA 4M8LA 3DFEA 1RQ0A 1GXLA 4XDCA 1FRKA 5DDQC 2ZJRQ 3OFFA 2YKMA 2C3YA
chains in the Genus database with same CATH topology
3NKOA 3WAWA 5LIAA 1HJKA 3UN5A 1ZEFA 3E2DA 4GTWA 3BDGA 1O99A 1URAA 4UPKA 3SZYA 5AJ9A 3CMRA 4GTXA 3IGZB 1P49A 4ZG7A 4NWJA 4KJGA 3T00A 5DLVA 3SZZA 2QZUA 1SHQA 3NKMA 1AUKA 1AJCA 4TN0A 4KJDA 4MHXA 1KHJA 4LRCA 1ED8A 4CXKA 4LQYA 3M7VA 1O98A 3KD8A 2RH6A 4KAVA 3NKPA 3WAVA 1Y7AA 1ELXA 2W5SA 4LR7A 5DLWA 5KXAA 4MIVA 3NKRA 4KM4A 4MY4A 3LXQA 5GOVA 4UOOA 1ANIA 5HRTA 1KH7A 4UPLA 3NVLA 2W5WA 4YR1A 5DLTA 3A52A 1KH9A 5EGEA 4LRDA 1E33P 4FDJA 1KHLA 4LR2A 1B8JA 1EQJA 4LRFA 1KH5A 2W5RA 3MK1A 2W5VA 4KAYA 3OT9A 4ZG9A 1EJJA 1ELZA 4LREA 2XRGA 3T02A 3DPCA 3UN3A 1ZEDA 1ZEBA 3WAYA 1ED9A 4N7TA 2W5QA 5L0EA 4ZGAA 5LQQA 4FDIA 4LRAA 1ALIA 3NKQA 3B5QA 3DYCA 4NWXA 4UPIA 1KHKA 2W8DA 1HQAA 4UPHA 3M8YA 1E1ZP 3M8ZA 1EW9A 4CYRA 3T01A 1K7HA 1N2KA 4LR9A 2IFYA 4GTYA 1Y6VA 1AJAA 5GRRA 5INHA 1E3CP 5EGHA 3Q3QA 3TG0A 5LRMA 2IUCB 3UNYA 2G9YA 5L0KA 1HDHA 1ALHA 3BDFA 5K4PA 1ELYA 2GSOA 5LRNA 3BDGB 1KH4A 4CXSA 1EW2A 1FSUA 4UOPA 4B56A 5TJ3A 1AJDA 3WBHA 3M8WA 2W5XA 3UO0A 3BDHA 4UORA 3ED4A 1AJBA 5IJSA 2D1GA 5IJQA 4ZG6A 1N2LA 2ANHA 1URBA 2XR9A 1EI6A 5L0BA 2W8SA 2X98A 2W5TA 4CYSA 1ALKA 1SHNA 1ALJA 2ZKTA 2GSNA 5C66A 4CXUA 4LRBA 3MK2A 4QAXA 3NKNA 3IGYB 3TX0A 2GLQA 4GTZA 3WAXA 3UN2A 2GSUA 1ANJA 4LR8A 1EW8A 2GA3A 1KHNA 2VQRA 1E2SP 3MK0A 3IDDA 3TWZA 2IUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKO A;  3WAW A;  5LIA A;  1HJK A;  3UN5 A;  1ZEF A;  3E2D A;  4GTW A;  3BDG A;  1O99 A;  1URA A;  4UPK A;  3SZY A;  5AJ9 A;  3CMR A;  4GTX A;  3IGZ B;  1P49 A;  4ZG7 A;  4NWJ A;  4KJG A;  3T00 A;  5DLV A;  3SZZ A;  2QZU A;  1SHQ A;  3NKM A;  1AUK A;  1AJC A;  4TN0 A;  4KJD A;  4MHX A;  1KHJ A;  4LRC A;  1ED8 A;  4CXK A;  4LQY A;  3M7V A;  1O98 A;  3KD8 A;  2RH6 A;  4KAV A;  3NKP A;  3WAV A;  1Y7A A;  1ELX A;  2W5S A;  4LR7 A;  5DLW A;  5KXA A;  4MIV A;  3NKR A;  4KM4 A;  4MY4 A;  3LXQ A;  5GOV A;  4UOO A;  1ANI A;  5HRT A;  1KH7 A;  4UPL A;  3NVL A;  2W5W A;  4YR1 A;  5DLT A;  3A52 A;  1KH9 A;  5EGE A;  4LRD A;  1E33 P;  4FDJ A;  1KHL A;  4LR2 A;  1B8J A;  1EQJ A;  4LRF A;  1KH5 A;  2W5R A;  3MK1 A;  2W5V A;  4KAY A;  3OT9 A;  4ZG9 A;  1EJJ A;  1ELZ A;  4LRE A;  2XRG A;  3T02 A;  3DPC A;  3UN3 A;  1ZED A;  1ZEB A;  3WAY A;  1ED9 A;  4N7T A;  2W5Q A;  5L0E A;  4ZGA A;  5LQQ A;  4FDI A;  4LRA A;  1ALI A;  3NKQ A;  3B5Q A;  3DYC A;  4NWX A;  4UPI A;  1KHK A;  2W8D A;  1HQA A;  4UPH A;  3M8Y A;  1E1Z P;  3M8Z A;  1EW9 A;  4CYR A;  3T01 A;  1K7H A;  1N2K A;  4LR9 A;  2IFY A;  4GTY A;  1Y6V A;  1AJA A;  5GRR A;  5INH A;  1E3C P;  5EGH A;  3Q3Q A;  3TG0 A;  5LRM A;  2IUC B;  3UNY A;  2G9Y A;  5L0K A;  1HDH A;  1ALH A;  3BDF A;  5K4P A;  1ELY A;  2GSO A;  5LRN A;  3BDG B;  1KH4 A;  4CXS A;  1EW2 A;  1FSU A;  4UOP A;  4B56 A;  5TJ3 A;  1AJD A;  3WBH A;  3M8W A;  2W5X A;  3UO0 A;  3BDH A;  4UOR A;  3ED4 A;  1AJB A;  5IJS A;  2D1G A;  5IJQ A;  4ZG6 A;  1N2L A;  2ANH A;  1URB A;  2XR9 A;  1EI6 A;  5L0B A;  2W8S A;  2X98 A;  2W5T A;  4CYS A;  1ALK A;  1SHN A;  1ALJ A;  2ZKT A;  2GSN A;  5C66 A;  4CXU A;  4LRB A;  3MK2 A;  4QAX A;  3NKN A;  3IGY B;  3TX0 A;  2GLQ A;  4GTZ A;  3WAX A;  3UN2 A;  2GSU A;  1ANJ A;  4LR8 A;  1EW8 A;  2GA3 A;  1KHN A;  2VQR A;  1E2S P;  3MK0 A;  3IDD A;  3TWZ A;  2IUC A; 
#chains in the Genus database with same CATH topology
 2WAQ D;  3SZY A;  2BJ1 A;  4LF7 J;  1NDC A;  5LSO A;  3P4U B;  2FTR A;  3MFH A;  3CD7 A;  1F6T A;  5HK4 A;  3SCL E;  1F1B B;  1TFY A;  2MXY A;  3QAU A;  4RWX A;  2YNH A;  2DNN A;  2DGO A;  1IJE B;  2VUG A;  5KG7 A;  5G4D A;  4F67 A;  4RW8 A;  2OEK A;  3QSI A;  3G71 S;  4V1A k;  4M5D A;  3K5P A;  1ED9 A;  3PAC A;  1LW0 B;  1RCO B;  5IT4 A;  1FWL A;  1HQA A;  2WZ1 A;  3DGP B;  2XY6 A;  2QN6 B;  3NNH A;  2UXC F;  1QAJ A;  2KZZ A;  2IDL A;  1X4H A;  3ZTP A;  5IOL A;  2HWI A;  3W64 A;  5J1N A;  2AQ4 A;  2XHC A;  5HMX A;  4NWB A;  2YWK A;  4OJ1 A;  5M2R A;  2QA2 A;  1TV6 B;  1RHJ B;  4DR1 J;  4MH8 A;  3T1H F;  4QIG A;  2IJF A;  1LWX A;  2AX1 A;  4GTW A;  3MED A;  4NRU A;  3LP0 A;  3KJQ B;  1WC6 A;  5KT4 A;  2KYX A;  4IFV A;  3OTO J;  4DF8 A;  4LR7 A;  3OR2 A;  5JJB A;  4PQA A;  1K47 A;  4K4Z A;  4EWT A;  3JQM A;  4A47 A;  3RAM A;  3H8Y A;  5DDP C;  5HSP A;  3KLI A;  4DL4 A;  1M5V C;  4G6V B;  3R7S B;  2RU3 A;  1WTF A;  1QUV A;  5D0G A;  5D0R A;  4J9Q A;  4PG8 A;  1N2K A;  4UOG A;  2OPP A;  4ED6 A;  2W4D A;  2HHP A;  1R6V A;  2ZH5 A;  1UET A;  3KKF A;  1Y5I B;  2M4M A;  2IVF B;  1S6O A;  1WF2 A;  1T05 B;  2QLF B;  4WKR A;  2ZKT A;  3CNQ P;  4OJG A;  1ZZF A;  4NLT A;  3BBF A;  3CJT A;  4JV2 A;  4DZ6 A;  2KXN B;  3SSR A;  5G0R B;  2G13 A;  4CO3 A;  4LFA F;  2VG6 A;  3E2D A;  3GIM A;  3QIP B;  3W2W A;  2GMJ A;  1Y4Z B;  2RHS B;  4C3M A;  3MR2 A;  2IM0 A;  3DRS B;  2DIV A;  1KHJ A;  3JSY A;  2HEK A;  2AX0 A;  5K8P A;  1X4F A;  4AUK A;  3CMA S;  2I6W A;  4O0N A;  1FXD A;  3K2Y A;  2Y9H A;  4K50 A;  3RW7 A;  1C4A A;  5HJY A;  5K5M A;  4TLR A;  1E33 P;  1LKZ A;  3UCG A;  1MMN A;  2LXF A;  3KUH A;  2Z56 B;  4ZIW A;  3HHK A;  3SI8 A;  2RKI B;  3J7A N;  2XHW A;  4I6A A;  2H9Z A;  1X60 A;  4WP8 A;  3DI6 A;  1OY6 A;  4B9L A;  1KVI A;  3SV3 A;  3OTD A;  4UPH A;  4X62 F;  4PG5 A;  3LGM A;  3AJD A;  1XNQ J;  1TL1 A;  2RRA A;  3LP2 B;  1W7W A;  5K9F A;  1JNZ B;  3NMA A;  3CDW A;  4DCJ B;  1D9A A;  4IG3 A;  2W5X A;  2PI4 A;  4NLQ A;  1QSS A;  2R2U A;  2X98 A;  2OAU A;  5D0E A;  2OO4 A;  2E9Z A;  1QY7 A;  4WF9 Q;  2VG5 A;  4NYZ A;  4HKQ A;  1NJW A;  1FE0 A;  5K14 B;  2W7O A;  2KB2 A;  4R0E A;  1RAD B;  2CQI A;  2WOM A;  2WSF C;  2B5J A;  4EZ6 A;  3L7U A;  4UY8 T;  4QIW D;  3TOQ A;  4OI2 A;  1UAW A;  2MB0 B;  2DGQ A;  1DBD A;  3BDE A;  3H4D A;  2CNO B;  1QVG R;  3S1T A;  5HBM B;  3MR3 A;  4ZVF A;  3BGF A;  3BQ0 A;  3MTK A;  1QAX A;  4GMK A;  5DG9 A;  1IN0 A;  4I64 A;  2V2V A;  3SDE A;  1LW2 A;  2FZG B;  1T94 A;  3D67 A;  1I5O B;  2WVE A;  2C3O A;  1TKX A;  3E01 A;  4DPT A;  5AJ3 F;  3K59 A;  2GVZ A;  4JUZ A;  2VA2 A;  1FA0 A;  4PWD B;  3BBC A;  2A2D A;  5DDR C;  3HT0 A;  1N32 J;  1U1P A;  2V69 A;  4C8Y A;  1WOP A;  1RBA A;  4CYU A;  4L76 A;  1VLY A;  3K5M A;  4UOF A;  4ZG6 A;  1S7I A;  1H3D A;  4AFF A;  2XMW A;  2YNG B;  5KFU A;  3H59 A;  5IT9 U;  3H5X A;  3WAX A;  5J1E B;  1UFL A;  1HW9 A;  2GA3 A;  4ED4 A;  4ID5 A;  2UP1 A;  4W92 B;  3DM2 A;  1X5O A;  1VHF A;  2LQ8 A;  1HNW F;  2XS5 A;  3T1Y F;  2I2Y A;  4P2S A;  2VQF J;  4UQG A;  2HVZ A;  2HVH A;  2WVF A;  2K3K A;  3O5T B;  4B3R F;  3QRQ A;  4ES3 A;  3J80 Y;  2MKI A;  3DLL Q;  1BXN A;  2IY5 B;  4EFA C;  1Y6V A;  5E3P A;  4QU6 A;  1H6K X;  1BWE A;  4B9U A;  3C2P A;  2HS0 A;  1KH4 A;  4EZ9 A;  2VH7 A;  2L08 A;  4X84 A;  3CCS S;  3W2V A;  3QZ8 A;  2HHU A;  2HFO A;  3KK1 B;  2BKN A;  4M95 A;  4LSZ B;  7FD1 A;  2EXU A;  4Y2I A;  1JWW A;  1TK5 A;  4OX8 A;  4P73 A;  2J7K A;  4DV6 F;  1FI4 A;  3AB2 B;  3U27 A;  1RAC B;  5EWE A;  2GW8 A;  3K7R A;  1Y5N B;  4LMZ A;  4MHX A;  3UQS A;  2CG4 A;  3B4M A;  5A6P A;  2G0J A;  5KFK A;  1MWQ A;  2JNJ A;  1HNV A;  3HXM A;  4RNH A;  4X4Q A;  4FKY A;  1N36 F;  2OSQ A;  3AXK A;  2A0F B;  2V8G A;  4Q5V A;  3KJF B;  1NB2 A;  4ZG9 A;  1FDB A;  1W2B R;  2NR0 A;  3C66 A;  5H1S V;  4GKK J;  2ALY B;  3GII A;  4X4U A;  3OLB A;  4ZCK A;  5J2Q A;  1TVR A;  1HLW A;  5INH A;  2J7W A;  2B8P A;  3BDG B;  2R9L A;  1F5B A;  1FHT A;  3TR5 A;  4KGM A;  3CIM A;  3CXC R;  4ZKA A;  4ZVE A;  4X4O A;  4B17 A;  1WHX A;  4ECQ A;  1JIH A;  5IM0 B;  4O3P A;  2CZV C;  1D1U A;  5KFO A;  2YX1 A;  2OEL A;  1R0A B;  2CXE A;  5KFR A;  4CLF A;  3AT1 B;  1KHN A;  1U6F A;  3TWZ A;  3R6G B;  4JI0 F;  4C6A A;  1LWC B;  2J8A A;  5E3Q A;  5MAO A;  1J5O A;  4ICL B;  1FX2 A;  5HMW A;  2QT7 A;  2GQC A;  4Y6I A;  2DRB A;  3GTY X;  4OYO A;  3R2C J;  3NS7 B;  3QGP A;  1NCL A;  2GJF A;  3BEG B;  2R2R A;  1RE1 B;  3I5A A;  4AXI A;  2LU2 A;  3AQO A;  2OPS B;  5JUM A;  4G65 A;  4ZCI A;  3N0V A;  3VQS A;  3NKQ A;  2B7C B;  2NQP A;  3KLH B;  4DU8 A;  1IQZ A;  1SJ4 P;  3A3P B;  5D4O A;  1DQA A;  1IVZ A;  2HMI B;  2G4B A;  1ALH A;  1TK8 A;  1S1V A;  2V34 A;  2O3D A;  3TAR A;  1CJK A;  3ZTO A;  4ANC A;  4IOB A;  4GRS A;  4L72 B;  5T7L A;  3QJL A;  4PR6 A;  4NX9 A;  2P9C A;  2MZQ A;  3PXG a;  2IDE A;  1F5C A;  3DRR A;  4YB5 A;  2OLW A;  4B02 A;  4KHP J;  1U49 A;  1WC4 A;  1KVK A;  4C8N A;  3K5L A;  2GQ2 A;  2UV8 G;  3PYE A;  1MWY A;  3T9Z A;  2HNY A;  1OQ6 A;  4EK2 A;  1RAG B;  4LRC A;  1VIS A;  4CO5 A;  4N77 A;  4ZVG A;  4CZC A;  4RW6 A;  3OLA A;  2R2T A;  2IRU A;  4ZPT R;  4A8Y A;  4JI2 F;  3I4H X;  1IBM F;  1NK5 A;  5EDW A;  3TUZ C;  2VPX B;  4I56 A;  5RUB A;  2YQ0 A;  4DCO B;  5ITH A;  2G2Z A;  3DLB A;  2DK2 A;  1FJG F;  2XRG A;  1ZEB A;  3W9J A;  2DPI A;  5KG6 A;  2VBZ A;  2KKH A;  3PJX A;  1L3S A;  5L9X A;  5U47 A;  4N56 A;  2QO3 A;  4P2X A;  3S01 A;  4BC7 A;  3MM7 B;  3W65 A;  1ZBT A;  1RIS A;  4OZ5 A;  3RG6 A;  3UO0 A;  3BSC A;  2OPQ B;  2V4Q A;  2W24 A;  4IH5 A;  4ELV A;  1P27 B;  1CUL A;  2X3G A;  3GR0 A;  3Q8S B;  4ATN A;  4QAX A;  1KD1 T;  3Q0A A;  3B82 A;  3IMQ J;  2HBQ B;  2HFV A;  1N4L A;  1TL7 B;  4RNF A;  3TZX A;  3PIP Q;  4CNZ A;  1LWE B;  1R43 A;  2DB1 A;  4CNY A;  2ZDP A;  4W98 A;  3V81 A;  4DF4 A;  2IA6 A;  3J81 U;  1HBU B;  1H2T Z;  3KK2 B;  4YUD A;  2YH1 A;  2MKH A;  2R7W A;  4YB1 P;  1HW8 A;  4DSJ A;  1CBK A;  3RB3 A;  3OT9 A;  3SIP B;  1F9F A;  1AZS A;  2DNG A;  1VYA A;  1VQS A;  1ZED A;  3CO9 A;  2DXE A;  2OD4 A;  4R25 A;  2HW3 A;  1IKY A;  2F1F A;  2LEP A;  3CJ5 A;  1NH8 A;  3ZZT A;  3RB0 A;  3L7P A;  1T7P A;  3HSG A;  2C22 A;  3C19 A;  2B56 A;  2VBW A;  4B9S A;  3HKZ D;  3RU0 A;  2OFG X;  3NEK A;  5KG4 A;  3PG9 A;  3V6H A;  1H2U X;  2VDH A;  4H54 A;  2YNI B;  1G1X A;  1U2F A;  3GCW P;  1S0M A;  1R8H A;  1SV5 A;  2LXI A;  6FD1 A;  2Y1R I;  1SUQ A;  3OD2 A;  3I6P A;  2ZD1 A;  4KO0 A;  4R5P A;  6AT1 B;  2QZU A;  5D4L A;  2ZOF A;  4RW9 A;  3RZA A;  1CQM A;  1SQG A;  2ZBC A;  1NUE A;  3MCO A;  4PXC A;  3I87 A;  4Q8E A;  1RT6 B;  2ZNY A;  4NAS A;  3G82 A;  4IRC A;  3C6T B;  1KH9 A;  3FCH A;  4EYI B;  1G2E A;  8RUC A;  2FC9 A;  5DQG A;  2OEM A;  2PEB A;  1FFG B;  4B9V A;  1U1R A;  5D3G A;  2M8H A;  4KH1 B;  2DH9 A;  3M6U A;  1B0P A;  5IV4 A;  2EBG A;  4GTY A;  3UNY A;  1FF2 A;  1BQX A;  4LBP A;  2BE2 A;  4AE5 A;  3A8E A;  2KXH A;  3PKM A;  1UVJ A;  1ZM3 A;  1RTI A;  1VIX A;  3D0G E;  1K0T A;  2F40 A;  1OIA A;  1RT3 B;  5J2P B;  1FT8 A;  4HVZ A;  2GIR A;  1LWF A;  4AD6 A;  4Y0F A;  2WSC C;  3MF5 A;  3EYZ A;  1S0N A;  3NKN A;  4DPW A;  2E7X A;  4LF7 F;  3OVA A;  1NK9 A;  4RBU A;  4NLX A;  3AHP A;  3TZW A;  3CCZ A;  2YY3 A;  2CJQ A;  5AJ9 A;  2EWH A;  4DPU A;  2F9J A;  2FLP A;  1T9Y A;  2XMM A;  2GZO A;  4J9U E;  2RML A;  1Q8K A;  4IH7 A;  4PAA A;  2BRK A;  4OYX A;  4XPE A;  4JOU A;  2J9D A;  3QO9 A;  2B9W A;  4OX7 A;  2W7A A;  3IWN C;  1LFW A;  3KG0 A;  2PE8 A;  1TKZ A;  4DR3 J;  5CAA A;  4M5M A;  2XG8 A;  2CQ2 A;  4PCQ A;  1SCJ B;  2ZHO A;  3D7S B;  3PX6 A;  2FVQ A;  2X7I A;  1T03 B;  3DC2 A;  2PA8 D;  2VFS A;  2DO0 A;  3HHE A;  3VAK A;  4WKY A;  4NA1 A;  4FYV B;  1IBC B;  1NKC A;  2R7T A;  1N6Q B;  4C7Q A;  3EMT A;  3QLH B;  2CAJ A;  2AZ1 A;  1RU2 A;  3JYT B;  4OYZ A;  4DR1 F;  3IWX A;  2IVY A;  1XER A;  2F65 A;  1EP4 A;  4C0O C;  3EGN A;  2BAN A;  4RLE A;  2OD6 A;  3GV5 B;  1M90 T;  5DO2 A;  3THV A;  3ULH A;  1UFW A;  2DNO A;  1Q86 T;  2KN4 A;  3IA0 A;  4HEA 9;  3OTO F;  1JXE A;  1TKD A;  4RNM A;  4M5G A;  2VKR A;  3HHL B;  4GTX A;  2KJW A;  3FNN A;  3W62 A;  5D77 A;  3V2U C;  3RR8 A;  4FXV A;  2HS4 A;  2XSJ A;  1RT2 A;  5F8G A;  1F9H A;  1ANI A;  1NDL A;  1S79 A;  1RLD A;  2NSC A;  5F0W A;  3US5 A;  3PEJ A;  4YQW A;  2R8I A;  3MDF A;  5KFP A;  1HBO A;  5KOX A;  3GV7 B;  4YHH J;  1GNK A;  1HNZ F;  3KJV A;  3ZZR A;  2W01 A;  1MU2 A;  5L38 A;  1VQ8 S;  3M8Y A;  1YHQ S;  4XAK A;  4M5K A;  1IKX A;  3WIV A;  3UWT A;  3VAI A;  2ZIT A;  4N41 A;  3ET6 B;  1I1G A;  1VDH A;  2Y1I A;  5I3U A;  1VR6 A;  1F60 B;  4NEZ A;  5A0Y B;  2HLU A;  2ZH7 A;  2MZT A;  2GJ2 A;  2W9B B;  4MKA A;  1KWM A;  1Q5Y A;  4I2Q B;  2I9S A;  4LSL B;  2MY7 A;  1WTB A;  2CJA A;  4XK8 C;  2VB6 A;  4CO0 A;  1OS5 A;  1RT4 A;  4DZD A;  4OIX A;  1AA1 B;  2BKO A;  4F36 A;  1Q95 G;  5M2U A;  4F4K A;  2RDI A;  4MKV A;  5B0E A;  5KFQ A;  2V8D A;  3TX8 A;  1UVI A;  2ZM6 J;  4B3T J;  3LPE A;  1KLM A;  3GFH A;  3TAM A;  4DQI A;  1RAB B;  1HQE B;  1XNQ F;  4MJK A;  1BLU A;  2YKN B;  5K8M A;  3PDN A;  4GVB A;  3CCL S;  4LR9 A;  3M2R B;  1OSC A;  3CPW R;  1CSJ A;  1D09 B;  1QD1 A;  1APS A;  5LRN A;  4F02 A;  5IQ6 A;  2Z2M A;  4NLU A;  4UOP A;  5CQG A;  4P52 A;  1KOO A;  3HF5 A;  3MFI A;  3BN7 A;  1EI6 A;  2HBZ B;  3MMJ A;  2ZH8 A;  3UD5 A;  1WG4 A;  2GVD B;  3VAG A;  4YS2 A;  4KTQ A;  1FKP B;  3NWR A;  6FDR A;  4UF4 A;  5KT3 A;  1N54 B;  4OI4 A;  3CC7 S;  2B9X A;  2CPJ A;  3SZ2 A;  5GME A;  2DD8 S;  2YKP A;  4EO6 A;  5GVQ A;  1S57 A;  3NOC A;  3QT5 A;  1SJ1 A;  4HAC A;  4NEY A;  3GSI A;  1NBE B;  5FDL A;  2MQO A;  2LEA A;  3RRK A;  3A52 A;  3THP A;  1DQ9 A;  2U2F A;  4ED0 A;  3C15 A;  4EBD A;  1HNI B;  4IKA A;  3C46 A;  2E66 A;  4IFY B;  2E5L J;  4ED7 A;  4DR2 J;  4E2F B;  2JH3 A;  1E6Y A;  1N32 F;  2KM8 B;  1XMB A;  3BGR B;  3C3L A;  2FY1 A;  1HMV A;  2ASY A;  4WIQ A;  3MAA A;  4WYW A;  3R7N B;  1B70 B;  4IRD A;  5HQL A;  3CWJ A;  5CH7 B;  3AOD A;  4ZP8 A;  5KFV A;  3R5G A;  1UFK A;  8AT1 B;  5IJQ A;  3PVX A;  2CPD A;  2YVS A;  4H4O A;  3IG1 B;  1YWX A;  3UDL A;  2XY5 A;  3M8Q B;  4X64 J;  1PIL A;  2NUH A;  2FY8 A;  1T8E A;  2Q43 A;  5EHH A;  1CEZ A;  2EG2 A;  3BSO A;  2HIY A;  3KOA A;  3CE8 A;  3BGL A;  9ATC B;  2VQF F;  3O3L A;  3W3S A;  2OI2 A;  4ZCL A;  1WAC A;  3T3F A;  3D1Q A;  5KG3 A;  2LXU A;  2CPY A;  4UOO A;  5E0O A;  2HRY A;  1ZPV A;  3G87 A;  3WX4 A;  4QZV B;  1S9G B;  2FVP A;  1JLC A;  3ILI A;  4HLB A;  1EQJ A;  4EMD A;  4DHV A;  3Q2T C;  3HSD A;  4KSE B;  1SKR A;  3HHL C;  1U6Z A;  4G1P A;  2ASD A;  4PWU A;  1FFW B;  2R7U A;  2MKY A;  3HO1 A;  4NLP A;  1VC0 A;  2JZ5 A;  1VQY A;  4C0H A;  2AJ0 A;  4OJ3 A;  2AEM A;  3G8Q A;  3NCP A;  1FJE B;  1KEK A;  2K7K A;  3GV8 B;  3MAQ A;  3SFU A;  1HHS A;  2YNF B;  4Q0B B;  3R7B B;  2AGQ A;  1DRZ A;  2J8S A;  3I9Z A;  3UVJ B;  4JI6 J;  3RTV A;  4GTZ A;  2KO1 A;  2XCA A;  4O3Q A;  4A46 A;  3DOM B;  4ZPD A;  3W5X A;  1M5H A;  1ITP A;  1WOO A;  3CJK B;  2CDQ A;  2X1F A;  3FDS A;  4D3H A;  4RJV A;  2M0G B;  4KV8 A;  5IT0 A;  2HK2 A;  1SH3 A;  4TNO A;  3WAV A;  3W63 A;  3GYG A;  3FCW A;  2HQI A;  4NLO A;  1LK7 A;  4K4V A;  1WEX A;  3UI3 A;  2Z2Z A;  3G6V A;  2VFU A;  4ED1 A;  2ACM A;  1JLQ B;  4GKK F;  2ADB A;  1NK6 A;  4CLK A;  4X4N A;  2RJZ A;  2VKZ G;  5KFH A;  2W2P P;  3JSR A;  3UD4 P;  2CPF A;  1RT7 A;  2HAI A;  2A10 A;  1TQL A;  3OL8 A;  4RW7 B;  5KTQ A;  3FQK A;  2AV5 A;  3JS9 A;  2OHD A;  5FJ4 A;  2B4O A;  3S8S A;  2CQ4 A;  2MLY A;  4UQT A;  3BYP A;  4O3O A;  3ZFV A;  4ZVH A;  4KBI A;  4NCG A;  1H98 A;  3I96 A;  3CED A;  3P8B B;  2CYY A;  2QC3 A;  4AL7 A;  4IH6 A;  2MZ1 A;  2QMU B;  3V6J A;  4U67 Q;  1IQT A;  3UN2 A;  5D8H B;  3GJR B;  4DV7 J;  2PEH A;  1JX4 A;  2OMO A;  3H2U B;  4Q45 A;  3DOL A;  2O67 A;  1IWA A;  3M30 B;  3OBI A;  1Q8L A;  1KQK A;  4Y2A A;  1CS4 A;  4YB6 A;  3UR3 C;  1SXL A;  1NK0 A;  1X5T A;  1JKH B;  1T3O A;  1Z2L A;  4WK3 A;  2HNZ A;  5DLT A;  1RT1 A;  2XMV A;  4FYX B;  2CNN B;  4TQR A;  1PAE X;  3OQ2 A;  2EEY A;  4Z7Y A;  1DAR A;  1WC0 A;  3D5M A;  2YWF A;  5CD4 H;  4ILL A;  5D78 A;  2C2O B;  4MIB A;  4OHY A;  5AXL A;  1M5K C;  2W8D A;  2EW9 A;  4YB7 A;  3J81 j;  4WE1 A;  1RU1 A;  5ADZ A;  2P6S A;  1EJ7 L;  2L9N A;  2E5G A;  1Z2Z A;  3H4B A;  1MN9 A;  4WYL A;  3LAL A;  2IUC B;  4HHH A;  4L6V 3;  2LKZ A;  3BH7 B;  4O23 A;  1RAO A;  3AY0 A;  1JQG A;  4BS2 A;  3NNA A;  4LF2 A;  2V67 A;  2Y0S D;  2YQ3 A;  1S0V A;  4I69 A;  1WUU A;  4CLY A;  5KFN A;  2JC1 A;  1AXQ A;  2AWZ A;  3MEE A;  1XIQ A;  2DXD A;  4RW4 B;  2FGC A;  4KHP F;  4NA2 A;  2BQU A;  1VQL S;  4MKY A;  1HHQ A;  2KM8 C;  2H48 B;  2IMO A;  1RKI A;  4K4S A;  2NZ4 A;  4J5O A;  4DXL A;  3ISN D;  1DQ8 A;  1YTY A;  2NXU A;  2C3U A;  2YWG A;  3MR7 A;  4LBH A;  1GX5 A;  2YBV A;  4TU9 A;  4YP3 A;  2OKQ A;  2G2Y A;  5M2P A;  1RUS A;  5LXY A;  4J37 A;  1RHK B;  3Q22 A;  5EX3 A;  5THW A;  2ZFH A;  1S9E B;  2M8D B;  4JP8 A;  4LFC J;  1HI0 P;  3N28 A;  3SV4 A;  1HD1 A;  4AYB D;  4DV1 F;  1WF1 A;  2W7P A;  3RR7 A;  3OHA A;  3G8S A;  1T3N A;  4P10 A;  2RQC A;  3EVO A;  2CZ4 A;  2L41 A;  1SJF A;  4ER8 A;  1SC3 B;  2A1B A;  3W5Z A;  1UVM A;  2RRB A;  5CYQ A;  3Q86 A;  1HWL A;  2YKM B;  5C42 A;  5JMN A;  1OY9 A;  4WFX A;  5LOQ A;  4CLT A;  1C2P A;  3R5D A;  4FS1 A;  2XR9 A;  1URN A;  4EUV A;  2W8S A;  3PHT A;  4RUA A;  3DLG A;  3HKW A;  1SHN A;  2EFO A;  1FRM A;  2NS1 B;  2F9D A;  4QWD A;  3DYA A;  2D9O A;  3IWL A;  2YNH B;  5LIA A;  3H20 A;  2GA7 A;  3DGV A;  3IGV A;  2HND B;  4UTG A;  3T19 A;  5E5N A;  4X2B A;  1NSP A;  3BM7 A;  2J9C A;  1RAI B;  2LA6 A;  4J91 A;  1FRH A;  3KTQ A;  4F8R A;  3IP0 A;  3ITH A;  4YR1 A;  2MQM A;  4DLG A;  1P8G A;  2W2Q P;  1YJN S;  3OJU A;  1Q0N A;  2AT1 B;  5CHC B;  2Z4P A;  4KY3 A;  4ZVS B;  3UDV A;  3RBD A;  3NXZ A;  4UUW A;  4LSN A;  2XNR A;  1JLA A;  1NHU A;  4F26 A;  4I2P B;  3JAM Y;  4J9M A;  3PX0 A;  1NPP A;  1JNR B;  2BXJ A;  2DT9 A;  2DR5 A;  3PW7 A;  4U96 A;  4RUC A;  1ELY A;  1HBN A;  2BR0 A;  1AW0 A;  2DCU B;  3NGR A;  3KNA A;  1HIY A;  5CD4 A;  4I7F A;  2YKA A;  5IFM A;  3AD9 C;  5KT6 A;  3LGN A;  2ZZM A;  4DQP A;  1XBW A;  1QJH A;  3FFI A;  2PA3 A;  2FLN A;  3H0P A;  2IC3 A;  3TA1 A;  3KLI B;  5DG7 A;  2AEJ A;  2MYF A;  1JLG A;  4MKB A;  2HG4 A;  3JB9 k;  2FQQ B;  2Q79 A;  3MR5 A;  1UP1 A;  4WU2 A;  3SSQ A;  5B0G A;  1JJ4 A;  3IR6 B;  3OUY A;  2QZ8 A;  3M6V A;  2MGZ B;  4C98 A;  3C8Y A;  2OPP B;  1RAE B;  4J9L A;  2Q6C A;  3FQL A;  3SXL A;  4X66 J;  2MQL A;  4GO5 X;  4PXE A;  4UZB A;  1XJW B;  1ZM2 A;  4C3L A;  2CJ9 A;  1VC6 A;  4N7T A;  4L74 A;  4B3O A;  1NM2 A;  2MY8 A;  5ETL A;  2VQE J;  3R5J B;  4MFB A;  3UCU P;  2V94 A;  2B9E A;  2DH7 A;  3A8J A;  3KDN A;  4JI7 J;  2VF3 A;  3H42 A;  3Q3Q A;  3TG0 A;  2VG6 B;  2QA4 G;  3E8O A;  5LM7 E;  4I68 A;  3W2W B;  2NZC A;  1SKS A;  1I6J A;  1ICE B;  4USW A;  2ZHA A;  3IM8 A;  3HMJ G;  5T41 A;  2QIF A;  2F4V J;  2DNY A;  1N5Q A;  1U45 A;  5LJ5 Y;  2JEJ A;  4NWX A;  2FYX A;  3CCV S;  2CZ9 A;  1VLO A;  4C8O A;  2W2O P;  3KNG A;  2UUT A;  2L3M A;  1ZEF A;  1XMQ J;  1IJF B;  1AYE A;  3W7B A;  4G3I A;  2XS7 A;  3LPY A;  1ULR A;  3CDE A;  5F9L A;  3FRY A;  5D15 A;  3DI6 B;  4ZOS A;  2K2P A;  4DR3 F;  4CWB A;  1BQM B;  1YLX A;  1KC8 T;  4G1I A;  2J6S A;  3RRG A;  1VQ9 S;  1NRK A;  3GIL A;  4DSE A;  2JVR A;  1TL1 B;  3BO4 A;  2F5G A;  3CCT A;  3K8W A;  2FIU A;  3L95 X;  5HAN A;  4CP5 A;  3KLG A;  4X4T A;  4P6Q A;  1TV6 A;  2B51 A;  4BHQ A;  2AF6 A;  1KTQ A;  1F5A A;  3CJR A;  3F41 A;  4X65 J;  1IKW B;  1NJI T;  2DNZ A;  2HBY B;  2JLG A;  4E8U A;  1D3W A;  1SKW A;  2NLW A;  4DQR A;  1C1B A;  2IIH A;  3POT B;  1Y10 A;  1NSA A;  2WOM B;  2D7S A;  2B5J B;  1DTQ B;  2VFR A;  1TFW A;  1HI1 A;  3RB4 A;  1VQ5 S;  1FEH A;  4OFZ A;  1O99 A;  2GGP B;  2QYG A;  3SDE B;  3UDE A;  9RUB A;  1PO6 A;  1EZZ B;  2AP6 A;  3IS9 B;  1SI9 A;  1TKX B;  1XQI A;  2M5Y A;  3E01 B;  3VAF A;  2FVR A;  2GVZ B;  3OV7 A;  3B54 A;  1WOS A;  4XDD A;  4QWE A;  4YHH F;  4WK1 A;  2BYC A;  2DGV A;  2FHO B;  2J0S D;  5ETM A;  1RGV A;  1Q7Y T;  4J9P A;  2DRA A;  4ZP7 A;  2CIM A;  3VGU A;  4JB8 B;  1VRT A;  1PYT A;  2O01 C;  2G1D A;  1I3O B;  1N52 B;  3KG1 A;  1NEE A;  2CG8 A;  2NXE A;  1R6Y A;  3MWB A;  3TQ1 A;  4MT1 A;  3DMJ A;  4ID5 B;  2KFZ A;  3VAM A;  3FZB A;  2BJ9 A;  2EC2 A;  3DM2 B;  1S1X B;  4L3N A;  2ZOG A;  5H9E K;  1RTH A;  2XSF A;  2KDO A;  1D9F A;  2HQD A;  2GSU A;  4O44 B;  4YR3 A;  4UW2 A;  1FRX A;  2E1M C;  2BM1 A;  1FK9 B;  3BO3 A;  2DTJ A;  2RKI A;  4V19 X;  4BC9 A;  2Z57 B;  4CO4 A;  4NXN J;  2YX7 A;  2J0Q D;  4EI2 A;  4K4W A;  1LNQ A;  3ETM A;  5FII A;  2ZM6 F;  3DLJ A;  4B3T F;  3MPU B;  4OJH A;  3IRX A;  4K5S A;  1VHI A;  2WSE C;  2DHH A;  3PRD A;  1K73 T;  5J2M A;  2D41 A;  5J2N A;  1RYS A;  3SBM A;  2XMA A;  4CLW A;  3W2V B;  3N6L A;  2BOP A;  5LXR A;  4WFA Q;  3K57 A;  1X5S A;  2DHX A;  3NBP A;  1TZ0 A;  2HWH A;  4HTI A;  3DOK A;  2IAJ B;  3VTI A;  3MPY A;  4X4V A;  4YDD B;  4EO8 A;  1RWX B;  5AE2 A;  2LP4 A;  5GAE U;  1AJD A;  2N7Y A;  5EWG A;  4C8K A;  3CJ2 A;  3ZTS A;  4ZJO A;  4AL6 A;  4LR8 A;  4U7C A;  5L1J A;  1WOR A;  2BBE A;  3MD1 A;  3TUJ C;  3EDR B;  2J7U A;  1Q8I A;  3UN5 A;  4K4X A;  2IHR 1;  2YPY A;  2YWH A;  4IDK A;  5IV3 A;  1Y00 A;  1O6X A;  1Y5L B;  4HH0 A;  1YJ7 A;  2KRB A;  3S6E A;  2BQ3 A;  2QTW A;  5DZ6 A;  4MY4 A;  3I5C A;  2E5L F;  3NVL A;  5J2Q B;  1HL6 A;  4DR2 F;  1TVR B;  2VC0 A;  2HIQ A;  3MEC A;  2EPI A;  3A1Y G;  3IR7 B;  2N4D A;  3TVK A;  4MK7 A;  3AA9 A;  3DKD A;  3KLF A;  5J1E A;  1FKO A;  1YSJ A;  4NZ0 A;  1PCA A;  3TAQ A;  1FVS A;  1SC6 A;  4Y00 A;  1HR0 J;  3F0N A;  5EN1 A;  5C2C A;  4WTO B;  3R3T A;  4CIO A;  1RAF B;  5HP1 B;  2XLK A;  4Q8F A;  2KHD A;  4X64 F;  2U1A A;  4NA3 A;  2LA4 A;  1UZH A;  1OWX A;  1J5O B;  5IC4 B;  2DNR A;  4ANE A;  2VBY A;  2ZHB A;  3CCU S;  3TUP A;  2HRT A;  5AXN A;  1V6H A;  3PYF A;  1B3T A;  4M5N A;  2FJE B;  3NKO A;  5HAO A;  4I4B A;  1WWH A;  3TNV A;  3FRZ A;  4ELT A;  4PXD A;  1T9T A;  2B4V A;  4FF4 A;  4OZL A;  1BE4 A;  2A2C A;  1O98 A;  3Q8P B;  4NMX A;  4P71 A;  2YKQ A;  2BJD A;  3LAM A;  2HUR A;  1NK8 A;  2W5W A;  2DGU A;  2BQR A;  3HHN B;  2D1C A;  2VJV A;  2IA0 A;  3W8G A;  1P9Q C;  1CJK B;  3KK1 A;  5KFA A;  3GQC A;  3AQP A;  3CCM S;  3D66 A;  1XR6 A;  2DR6 A;  4DMZ A;  1RWP B;  4OX6 A;  5T7L B;  2QLX A;  3OJS A;  1FRL A;  3DRP B;  4DV0 J;  4IR9 A;  2JSX A;  3EM1 A;  3DRR B;  1NHK L;  4WZM A;  3D6T B;  3IAS 9;  1S59 A;  3UD3 P;  2HNY B;  4JI6 F;  3GYN A;  4EU0 A;  1OPZ A;  5F3T A;  3KMQ A;  2Q66 A;  2JEI A;  2CQC A;  3U1M A;  3LAN A;  5HMY A;  3WAW A;  4FF1 A;  1J5E J;  3DLH A;  2ATL A;  2V5H G;  2WK4 A;  3AOC A;  4H4K A;  4ZG7 A;  3VCD A;  1WC5 A;  8ATC B;  2J6T A;  4M5J A;  4HR2 A;  4QPX A;  1YJT A;  3IR5 B;  4NZ6 A;  5DLW A;  2VIH A;  4C48 A;  2ASJ A;  4B9N A;  3CCW A;  3VVT A;  1SKU B;  3HFV A;  3DXB A;  3MMA A;  2B0G A;  1R31 A;  1KH5 A;  5GAD U;  4DV4 J;  4WP3 A;  3G6Y A;  3DN9 A;  2RIL A;  3MUM P;  3D6H B;  2QJ3 A;  3QID A;  1R0A A;  2QMW A;  3J7Z 5;  2PII A;  3ZTR A;  3TZZ A;  2CVE A;  1VIO A;  1O8B A;  4CYR A;  4ZPV R;  3ICL A;  3CCJ S;  2R7O A;  2L9W A;  1NPR A;  2EG1 A;  4DEZ A;  1KNZ A;  2EFV A;  1Q82 T;  4LF6 J;  4F2R A;  2LQJ A;  3A13 A;  4DV7 F;  2H4Y B;  2ZJP Q;  3CB4 A;  1MMD A;  1DY3 A;  1JXV A;  4DQQ A;  4G1Q A;  3OR1 A;  5BYS A;  3LUY A;  4JV1 A;  2E9R X;  1V9O A;  2QLB B;  3A8I A;  4DSL A;  4ZVU B;  5D4N A;  2AGP A;  5CYM B;  1WG1 A;  4QYR A;  3KUG A;  3BKT A;  3NWG A;  1AZS B;  1SHQ A;  2DGT A;  1N5Y A;  2WW4 A;  4EBE A;  4F4Z A;  4P2F A;  2FJA B;  1IKY B;  2HMI A;  2UUB J;  1P1L A;  3QBC A;  4DN0 A;  5DDO C;  1KFD A;  3FEZ A;  4CTA A;  2B4P A;  1EKR A;  2W25 A;  3B4D A;  1D9D A;  2M9K A;  1U1N A;  3T02 A;  3M9O B;  4F2S A;  1RXO B;  1UWB B;  3R2D J;  3Q8R B;  2V2K A;  4Y34 A;  4JI3 J;  2HFU A;  1EW9 A;  2W8K A;  2V8P A;  1NB7 A;  1RWN B;  5ETV A;  4FYW B;  1FFS B;  1VQ6 S;  1SV5 B;  4TXS A;  3BBB A;  4IO9 Q;  1SUQ B;  1YG0 A;  1PYO B;  5ETR A;  4IOA Q;  1UCN A;  3J7A 1;  4R5P B;  4KO0 B;  1XC9 A;  2PMW A;  3RJM B;  3G8T A;  1S4E A;  1N33 J;  1RKJ A;  3ILO A;  3VWS A;  1R8B A;  1YRX A;  3NKY A;  2HZA A;  2HHW A;  1N48 A;  4LVO P;  2CQG A;  1RTZ A;  3L7O A;  4FVM A;  1WI6 A;  1DLO A;  3NKM A;  4Q44 A;  5AT1 B;  2ZDO A;  1F2G A;  2CAD A;  2CQ0 A;  4LFC F;  3AAW B;  3EUN A;  2RE1 A;  1FDA A;  1HYS B;  3M2U A;  3HT3 A;  2ZKU A;  4YFU A;  2B3T B;  5MLC V;  3IM9 A;  4URQ U;  1GAO A;  5H9F K;  4A8O A;  1TAQ A;  2HGM A;  5B0B A;  3HSJ A;  3IAM 9;  1RTI B;  1W26 A;  4F4Y A;  2WHO A;  2FUG 9;  2R7S A;  4DL3 A;  1L3V A;  3PO5 A;  4ECT A;  2F8M A;  1NXI A;  1TL7 A;  2PI5 A;  3AH6 A;  1YBT A;  1LWE A;  1BGX T;  3LAK A;  2CRL A;  1RHU B;  3L4B C;  4WXW A;  1RZM A;  2XYP B;  2IMW P;  3OL6 A;  1JLE A;  4KYZ A;  4IQM A;  5KFX A;  1KBR A;  5GMK a;  3TO8 A;  5GAD I;  2IBO A;  5A8R A;  3SQO P;  1ALJ A;  4U7U D;  2V68 A;  2MMY A;  1EIY B;  1IXK A;  2RHQ B;  2XWY A;  1NSK L;  3OSN A;  5ETN A;  2NUU G;  2DVI A;  5KFT A;  1U47 A;  3FSI A;  3MM5 B;  4UT4 A;  4KQZ A;  4K4U A;  1X9S A;  4QCL A;  1HKA A;  3VGS A;  2Y1L B;  3J81 Y;  4ZVQ B;  1MRO A;  2IVM A;  1KKH A;  2V6A A;  2LU1 A;  2E9T A;  1GMV A;  2BE7 D;  3UW1 A;  1C0T B;  1AB8 A;  3Q8U A;  4FF3 A;  3MPV A;  4DL2 A;  3KUE A;  1EP4 B;  4F3Q A;  2BAN B;  3FBF A;  3VAH A;  3G9C A;  2MLZ A;  4FN5 A;  3UDC A;  5DLG A;  3IC1 A;  2I0X A;  2HVI A;  1RCX B;  1KR4 A;  2MKC A;  1TMM A;  1B0V A;  3H90 A;  3SQG A;  1KQF B;  2VPW B;  3BB5 A;  1FVQ A;  4OX9 J;  2XSJ B;  1RT2 B;  2QRR A;  3C16 A;  1G3O A;  3GE9 A;  3CVK A;  3RAQ A;  1X8D A;  1S7H A;  2DR8 A;  5I4M A;  3IBW A;  2VON A;  4DUY J;  4DSF A;  1RTD A;  1JJH A;  2FPH X;  4FXW A;  4PPZ A;  3MXH P;  2R8J A;  4WCE Q;  2KFN A;  1HBO B;  2XB2 D;  2QG9 B;  4KC5 A;  1RB0 A;  1VK3 A;  1MU2 B;  3RGI A;  4O3N A;  4PRF A;  3NCR A;  2E1P A;  4X66 F;  2ACY A;  3GJT B;  3NS5 A;  5GOV A;  2E1A A;  1IKV A;  1DHM A;  1U7L A;  5KG5 A;  1IKX B;  1X4B A;  4RL1 A;  2NPI A;  1NJZ A;  2VQE F;  3PX4 A;  2BJE A;  1TAU A;  2ZVI A;  2W4P A;  3UN3 A;  4JI7 F;  5I3U B;  2QLW A;  4M5I A;  4RX6 A;  2E7V A;  2JRS A;  1WDT A;  5C7P A;  3IN5 A;  2FB0 A;  1T9V A;  4ZIT A;  3O8W A;  1X0P A;  3SYZ A;  2CDR B;  2F4V F;  5KFZ A;  1DJ0 A;  2VU5 A;  1XMQ F;  2VG7 A;  1GXT A;  3LA0 A;  4ITS A;  2R4F A;  3BGO P;  4Z2X A;  4TKT A;  3IFE A;  3MUV P;  3AD7 C;  5BXI A;  1AFI A;  2B6A A;  2F7V A;  3TAM B;  3ENA A;  4NWJ A;  2ASL A;  1H72 C;  4KJG A;  2V2Z A;  5KFG A;  3X3U A;  4IG0 A;  5A8K A;  3J7Y U;  2ZE2 A;  3KD8 A;  4C11 A;  2I1R A;  1ELX A;  3GFY A;  2DNM A;  3NKR A;  2MDA A;  2HLT A;  4GVB B;  4ZVO B;  3I55 S;  4F3O A;  4TU8 A;  3TP2 A;  3JYT A;  3HX9 A;  4CCH A;  1EET A;  1P6T A;  4FPR A;  5DS7 A;  5LSL A;  1QAI A;  4LRE A;  1KOH A;  4X65 F;  1BUX A;  3OTB A;  4DG1 A;  1SH2 A;  4F4A A;  5L1I A;  4LFB J;  3HZE A;  1N0V C;  3TVY A;  1HNX J;  3Q83 A;  2DH8 A;  1DTT B;  3HVT B;  4MYT A;  3HDS A;  2PMZ D;  4M1K A;  2PGC A;  4AQY J;  2C2D A;  3D6M B;  5C2G A;  3GIK A;  4ILR A;  4MTP A;  3MK2 A;  3H7H B;  3NGT A;  1X4G A;  4P74 A;  2JJ4 D;  3BH6 B;  1U1Q A;  4A8X A;  2J6U A;  3O44 A;  5L46 A;  2JDJ A;  1HQU A;  3C15 B;  2PO4 A;  2PFF B;  1HWI A;  3HUL A;  4X4S A;  1TUG B;  1E6Y B;  1HBM B;  3W8P A;  4OHV A;  3P6Y C;  3C6U A;  1HMV B;  2IYI A;  1NO8 A;  3CME S;  3ET6 A;  3H2V E;  3DDI A;  1HPZ A;  1FJ7 A;  2AYB A;  1A6L A;  1U0H A;  1H73 A;  1F3V A;  1DZ5 A;  3FZ2 A;  2F63 A;  2YXL A;  4H4O B;  5A0Y A;  5F9N A;  1ZPW X;  3GP9 A;  1U1L A;  3BJY A;  1QDU B;  5E3R A;  2W9B A;  3PW4 A;  4LF8 J;  1OSD A;  4OV1 A;  2AZ3 A;  3DLK B;  1B0T A;  1PC5 A;  3DHX A;  2AW0 A;  3CD0 A;  4JV5 J;  3OTE A;  4BCA A;  2OPR B;  3LP1 A;  1ZA2 B;  3M8W A;  2AJ4 A;  3VF0 B;  2GIF A;  1KN6 A;  2HFZ A;  1IBK F;  4ZS6 A;  4TVA B;  1S4F A;  3JQJ A;  1X4E A;  1ANJ A;  1PYS B;  3QWU A;  4NXN F;  1RA7 A;  3KLE A;  2GJI A;  1RSC A;  1GTE A;  1URA A;  1JLC B;  3CC2 S;  3FEY B;  1FRI A;  1R3N A;  4C4W A;  1CJT B;  5GAG I;  2VA3 A;  2PN6 A;  2YKN A;  1S6U A;  2G2O A;  2UUC F;  3M2R A;  4NI2 A;  1SPB P;  3WBZ A;  4OI3 A;  1B7F A;  3VQT A;  3NOG A;  5KFB A;  2UXD J;  5KFS A;  1ZH5 A;  3MM6 A;  2DIU A;  2BVZ A;  1I94 J;  5CA5 A;  3T6B A;  5KG1 A;  5F8L A;  2ZWO A;  2QL9 B;  1FKA F;  4YY3 J;  4FDI A;  1Q5V A;  2OSR A;  2DO4 A;  2J0X A;  2VBX A;  4NLG A;  5IWA J;  3TQE A;  3PFE A;  2R42 A;  3J7Y I;  4QIV A;  2DCL A;  3CIZ A;  3NS6 A;  4RKU C;  3BDF A;  3P96 A;  5KFL A;  3MTJ A;  1SQE A;  5C25 A;  4B3S J;  4KV8 B;  4USU A;  2FVC A;  5B0D A;  1BQN A;  2CWX A;  4KRW A;  2IRY A;  4NCA A;  2LVW A;  4GC7 A;  4OYI A;  3A4T A;  3Q8V A;  3DRX A;  3R5C A;  5K20 B;  2LEC A;  3ETO A;  3LH2 S;  3M2V A;  4ZVP B;  3CTR A;  2HFN A;  1EAR A;  5H9E J;  4EEY A;  1YRT A;  5ETS A;  4CI0 B;  1URR A;  4NYO A;  2KT2 A;  1RI7 A;  3I0S B;  5EX0 A;  2ILZ A;  3T6J A;  3HPO A;  1X31 C;  3CCE S;  1KQG B;  3E2E A;  4DL6 A;  1WI8 A;  2CJB A;  4DUT A;  3MR6 A;  1HR0 F;  4PG4 A;  1SJQ A;  4HDG A;  1MW7 A;  3CCQ S;  2EK1 A;  1MWZ A;  2JEF A;  1TMJ A;  3EZU A;  3G6X A;  3BGU A;  3VAL A;  3P49 B;  1K7H A;  1ZTW A;  1AJA A;  2OTL S;  3DOL B;  1YJU A;  1O5J A;  4KFB B;  2VHG A;  1SIZ A;  2BJ7 A;  3P5T L;  4F0K A;  3TRG A;  2LDY A;  2HYI B;  2W5T A;  1CS4 B;  1Y0H A;  1OMS A;  3N6N A;  5LMN J;  4XPC A;  5DRK A;  2C28 A;  1S9G A;  2E5I A;  5KG2 A;  1V3S A;  2GS8 A;  5E3A A;  3ZZU A;  2FVS A;  1UKU A;  3IDD A;  2WVC A;  3CSK A;  2HNZ B;  1HJK A;  4NML A;  4ED5 A;  1RT1 B;  1YJV A;  2V9W A;  2NYH A;  3WDO A;  2DR7 A;  4MYU A;  1RTJ B;  2ZH6 A;  3NGU A;  4WE1 B;  3T5H A;  4KM4 A;  5F41 A;  3V4I A;  1FD2 A;  2RNE A;  3HHL D;  2ABY A;  2DNL A;  2NRE A;  2YNF A;  3ISN C;  4Q0B A;  3T5J A;  4OLP A;  2HHQ A;  4NE9 C;  1L3T A;  3UVJ A;  4DV0 F;  1UJ5 A;  3G86 A;  4P72 A;  3MEE B;  3MOJ B;  3KHR A;  3DYC A;  2RB7 A;  1VMB A;  2PC6 A;  3CJK A;  2AMC B;  3K58 A;  5A2Q U;  5K4P A;  4IYQ A;  1S72 S;  4DFK A;  3ED4 A;  3SMZ A;  2D1G A;  1A9N B;  2HVE A;  2IJN A;  3WZ0 A;  4PUO B;  3W66 A;  1J5E F;  4DL7 A;  3J7Z T;  3BS9 A;  3SFG A;  5IZH A;  5E7O B;  5KFI A;  2N7C A;  1S10 A;  1GQE A;  2P2C B;  5KT2 A;  3L9Z A;  3HCX A;  1LEO A;  2RF2 B;  1NKB A;  2KRR A;  2UXB J;  3HM9 A;  1VI7 A;  2LFV A;  2XO6 A;  2Z58 B;  4DV4 F;  2WCX A;  3HD1 A;  3PRV A;  1T95 A;  4YME A;  3VGT A;  1OO0 B;  4RBT A;  4C8L A;  1XTZ A;  1C1C A;  2EFG A;  3BF4 A;  3CDB A;  2JLE A;  1TU0 B;  3BQ2 A;  2Q6B A;  4ECR A;  3DLG B;  2WON A;  4DV5 J;  2BRL A;  4PPD A;  2V63 A;  3GIR A;  2NYI A;  3DYA B;  1S1U A;  4LF6 F;  2VOP A;  1U8S A;  1S1W A;  5GRR A;  1WHW A;  4QPT A;  3MCN A;  1NND A;  2A6O A;  1FCA A;  3GZ7 A;  2UVU A;  2H54 B;  3IGY B;  3NAI A;  3MMB A;  4YEA A;  3MZI A;  3ITH B;  2F8E X;  1VQ7 S;  4TY8 A;  3KFW X;  3BKU A;  4FNI A;  3MM9 A;  4WJB A;  4JI4 J;  1C0U A;  3KK3 A;  1FEE A;  2JOQ A;  2UVV A;  1FXL A;  1I51 B;  2JEG A;  2UUB F;  1OYE A;  2GFF A;  2GHV C;  5AE3 A;  3NNC A;  3QFW A;  1Y7P A;  2YWE A;  3R1H A;  4LSN B;  1CJV B;  1K44 A;  1X4C A;  3UR0 A;  2X1G A;  2XLJ A;  2H5J B;  3U1N A;  4TYA A;  2W9A A;  2XI2 A;  4FDJ A;  5KAK A;  4JI8 J;  3WIU A;  1W2I A;  4JI3 F;  2W2M P;  1Z4U A;  2XTJ P;  3NGS A;  4ZGA A;  3I5B A;  4I7F B;  1REV B;  2J5A A;  3ENV A;  5BJR A;  2XMJ A;  4KGX B;  4OI1 A;  3RRH A;  1TL4 A;  1NH7 A;  4CO1 A;  4IR1 A;  3PKY A;  1TK0 A;  1S1T A;  1X4A A;  3FFI B;  4J9O A;  2IBK A;  2KZM A;  2IC3 B;  3PW2 A;  4HT7 A;  2H65 B;  2AJ2 A;  1N33 F;  3K5N A;  3L3C A;  5AXM A;  2W1B A;  1MSW D;  1JLG B;  2P9E A;  4QU7 A;  1ELO A;  3VVU A;  5I3P A;  3QYY A;  2COL A;  5F0U A;  1SVD A;  3G96 A;  1JLB B;  2HZV A;  3HJV A;  4OV6 A;  2M70 A;  1YGY A;  4KKO A;  5KFW A;  3B6B A;  3DRY A;  1X5P A;  4FYY B;  3W9I A;  3MMC A;  3GR1 A;  1UA0 A;  1G4C A;  2KTQ A;  4B3O B;  4FNH A;  1U48 A;  4MFB B;  1MG7 A;  4TQS A;  2H5I B;  4OI0 A;  5B08 A;  1QE1 A;  2HGN A;  4FDF A;  2W9C A;  1B8J A;  3VZI A;  2A3J A;  5SUH A;  4U7U K;  3KHG A;  2P6T A;  4CT9 A;  5L8R C;  3P5B P;  3CJQ A;  5LJ3 Y;  2RD5 C;  3MD3 A;  4CM0 A;  4UST A;  4E0D A;  2VJU A;  4O4G A;  2HND A;  5EGH A;  3N9U C;  4LF9 J;  2Q1L A;  3LO3 A;  1RT5 B;  4GKJ J;  1WKJ A;  2G0C A;  4U8Y A;  4L73 A;  3FMW A;  5E41 A;  1XNR J;  2ZBR A;  4KGV B;  4QWB A;  2L9D A;  4DSI A;  1TL3 A;  3F73 A;  1H2V Z;  4WFY A;  4USM A;  2YPZ A;  2AYE A;  4RO0 A;  2XEX A;  3NMR A;  3EPI A;  3EVM A;  1RWU A;  4YOE A;  1JLF A;  3KLG B;  4I2P A;  3RYL A;  2DPJ A;  4ECW A;  3AOB A;  4A4J A;  1T11 A;  2E5J A;  4MIV A;  4FBT A;  3TJ8 A;  2KXF A;  1GH8 A;  4FBU A;  1V5V A;  3D54 A;  5CZX A;  4KB7 A;  1VJW A;  2GIQ A;  2RU9 A;  1YJ9 S;  1C1B B;  4MAK A;  3LW5 C;  3H25 A;  3CUN A;  2OML A;  4HYK A;  1ZTT A;  2B9Y A;  5FLX U;  4KR0 B;  1ZZN A;  1NZ8 A;  4M94 A;  3AFG A;  3ZNJ 1;  1VQO S;  4QOT A;  3FCV A;  1TL5 A;  4URS A;  2VD3 A;  4OX9 F;  1ACM B;  2CNL B;  5DLF A;  2WVB A;  1O0P A;  3N5F A;  4FF2 A;  5H9F J;  2KVQ E;  3A3N B;  4NXM J;  4DUY F;  1HA1 A;  3SSS A;  2MGZ A;  1HNZ J;  5K8O A;  4QBU A;  4K7Q A;  4A48 A;  2CFX A;  1E2S P;  2VOD A;  2OH2 A;  1N56 A;  2QFJ A;  3LWM A;  2QA1 A;  1RK8 A;  1AUK A;  4HI1 A;  1HAR A;  1IR0 A;  4USJ C;  3PYD A;  2N3O A;  2E1C A;  1VRT B;  1WG5 A;  3SCK E;  2PD1 A;  1U09 A;  3V5R A;  3GSD A;  3GWC A;  3AJ1 A;  2MQP A;  1G7C B;  4OHZ A;  5KG0 A;  1K1S A;  3DMJ B;  4RR5 A;  2W5V A;  1FNM A;  1ZAX A;  2NCK L;  4J90 A;  3IBC B;  4RPF A;  1CVJ A;  1RTH B;  4CRJ A;  4K5R A;  3ZZP A;  3BDP A;  2NXN A;  5GMD A;  4J9K A;  4NYP A;  3V6D A;  1FSU A;  2DIT A;  1PGZ A;  4QQB A;  1BQM A;  3ZXW A;  3IRX B;  3M8P B;  1EW8 A;  1E6V B;  2M3D A;  1JMT A;  5J2M B;  1CG2 A;  3R5B A;  5J2N B;  4X4P A;  3QT6 A;  4PQU A;  2AD9 A;  3L09 A;  3M32 A;  4RU2 A;  4FP9 A;  1IKW A;  2IM3 A;  4C8M A;  4Y28 C;  3M8S A;  3NBP B;  4PAB A;  3OXG A;  3DOK B;  3JTP A;  1UEV A;  2BW7 A;  2F4F A;  3POT A;  4MMO A;  1VBZ A;  4ECX A;  4LFB F;  2ZBQ A;  2IM1 A;  1DTQ A;  1HNX F;  3I31 A;  3N79 A;  2DIS A;  1KTV A;  2ZVS A;  3Q24 A;  3GFX A;  5A6W A;  1ZAW A;  5HLF A;  1FER A;  5KFC A;  4ZHR B;  4USV A;  2GGP A;  3EWG A;  4AQY F;  2FDN A;  4IDK B;  3BR8 A;  4F0M A;  3H5U A;  3IS9 A;  3WBH A;  5FD1 A;  4ZP6 A;  4NOH A;  1NK7 A;  1Y11 A;  1VOM A;  4RZR A;  5JVG Q;  3PR4 A;  2ZWP A;  3SEO A;  3D28 A;  4P7T A;  5IQQ A;  3PJW A;  4CXU A;  3OTC A;  1X9M A;  3T5L A;  3TZY A;  3D3C J;  4USI A;  1FNO A;  4ZCM A;  3MEC B;  4DX7 A;  5AXK A;  2ZH3 A;  4I67 A;  3EGV A;  3HVW A;  1AUD A;  3AD8 C;  3LOU A;  3R1L A;  2DR9 A;  4KJD A;  4W90 B;  5I42 A;  3I9V 9;  2EFQ A;  3KLF B;  1FKO B;  4DR4 J;  3T41 A;  1LQ9 A;  4P2M A;  4DFJ A;  1HWK A;  1R0C B;  1RWM B;  2BJ8 A;  5BR8 J;  1S1X A;  1YIJ S;  2W4C A;  2DHA A;  4OZ2 A;  5HRO A;  1CLF A;  2XMT A;  1RAA B;  4LF8 F;  1OYD A;  1TR0 A;  4JV5 F;  3JTN A;  4LIR A;  2CA9 A;  3O1L A;  3OXL A;  4LRA A;  3T9N A;  4ETX A;  4O44 A;  3DLE B;  1YVF A;  4XIU A;  4ECS A;  1E1Z P;  3R27 A;  3QNW B;  2RUS A;  1FK9 A;  1XK8 A;  5F8M A;  1TKT B;  4LJM A;  3G2X A;  5ETQ A;  3BPS P;  4O3R A;  2C3P A;  4JI1 J;  3BN4 A;  2JC0 A;  2Z8Q A;  2GX8 A;  1PJ7 A;  2ZBP A;  4DV2 J;  3VAJ A;  4XTT A;  1PG5 B;  1Y3J A;  3MK0 A;  2XZW A;  3QZ7 A;  4DX6 A;  3C14 A;  4IUF A;  1VBX A;  2R3V A;  2E44 A;  4I1T A;  1KRP A;  2PT0 A;  5D6G A;  2CUY A;  2UXD F;  1B64 A;  3TJ9 A;  2IAJ A;  1I94 F;  4ZIV A;  2K1R A;  4DLE A;  2BV3 A;  2CPH A;  3EIC A;  3RBZ A;  4TN2 A;  3QRR A;  4LRD A;  3JSM A;  1N5S A;  4YY3 F;  2VDI A;  2G9O A;  5IWA F;  2C2Z B;  1VRU B;  4UZC A;  1PSD A;  3BSN A;  4ZJL A;  4H4M B;  3PRB A;  2Y1J A;  4OZN A;  3WHI A;  3T01 A;  5BYR A;  4B3S F;  2O5D A;  4OYP A;  4K4T A;  5LRM A;  2RT3 A;  4LF5 J;  4ZP9 A;  1S6Q A;  2XYG B;  1YIT S;  3ZNU A;  1LV5 A;  1DFD A;  5A8W A;  2L48 A;  2XZD B;  3CC4 S;  4LRB A;  1Y9O A;  4HDH A;  1KLN A;  1WEY A;  2ZZT A;  3MM8 A;  1CJU B;  4KGK A;  3GYX B;  3WX8 A;  1IWG A;  3CGI A;  1SH0 A;  3OXF A;  5KFD A;  1S49 A;  3RAX A;  3MMA B;  3HK2 A;  3T1A A;  3S7R A;  2ZH9 A;  2ATC B;  4DS5 A;  3GIJ A;  3DDK A;  4CXK A;  3FKB A;  3RBE A;  3ZO7 A;  4ZPB A;  4WWS A;  2M7S A;  1UPP A;  2RDD A;  2V4J A;  2QL5 B;  2GV1 A;  5HP1 A;  4YR2 A;  4K8R A;  2N3L A;  4D3G A;  2JX2 A;  1XR7 A;  2DHS A;  1IR2 A;  2W5Q A;  5ETP A;  2MZJ A;  4PEO A;  1Y3K A;  4G1Q B;  3OR1 B;  4YDX A;  3WC2 A;  4QR0 A;  2LLZ A;  2IM2 A;  1S48 A;  3K89 A;  1ZM9 A;  3Q89 A;  4LF4 J;  3U7J A;  5LMN F;  5L1K A;  4JBC A;  2QYC A;  1FTC A;  1YKW A;  1N5Y B;  3NY0 A;  2HWT A;  1IUJ A;  1VRQ C;  2PSZ A;  4DJB A;  2QSW A;  3PFO A;  1T9U A;  4QIF A;  1NPK A;  2DKO B;  4CTA B;  3QPI A;  4PKD B;  4QWC A;  2DHG A;  4OI6 A;  1P9Y A;  4YR0 A;  3ELH A;  3DRP A;  3Q8Q B;  4WFZ A;  4S0M A;  3NKP A;  4IO1 A;  2RS2 A;  1VJQ A;  2HQ3 A;  4DWI A;  4AT1 B;  1K8A T;  1SL1 A;  4BDP A;  2K8G A;  1WKL A;  4LRF A;  3I56 S;  4LQ3 A;  5C24 A;  4N8O A;  4JI5 J;  3CJS A;  2Z2L A;  2RDJ A;  2HBR B;  3NCQ A;  3D0H E;  2KT5 A;  4ECU A;  4N47 A;  4R8U A;  3UPF A;  1M1H A;  4NZ7 A;  1FJC A;  4RUB A;  1Q79 A;  1T02 A;  1YBU A;  4MIA A;  5L0K A;  4F4W A;  5DZ7 A;  4ILM A;  4RNN A;  2UU9 J;  4Q43 A;  4ALZ A;  4C2M A;  1DLO B;  4RW8 B;  1D0E A;  4KHM A;  4DV1 J;  4DQS A;  3M8R A;  1HQ2 A;  4M5D B;  2QMX A;  4ELU A;  1VQK S;  4K59 A;  4ES2 A;  4ZLP A;  3R97 A;  5DGB A;  1D8Z A;  3M2U B;  4N8N A;  2PFD A;  2UUA J;  2UXB F;  1NAQ A;  4B08 A;  3GJQ B;  1GMW A;  2MQ8 A;  1SC1 B;  4DX8 H;  1WNE A;  1U2C A;  4KAV A;  2EK6 A;  1TUV A;  4RNO A;  4LVN P;  1PIE A;  2AYG A;  4LT6 A;  4QJV A;  3BRE A;  5KFJ A;  4PXB A;  2W5R A;  4DV5 F;  2W2N P;  1VGY A;  1JLE B;  1XEZ A;  2K06 A;  3MED B;  4P75 A;  1FDN A;  3LP0 B;  1S6P A;  4B9M A;  2I5J A;  2VV5 A;  5A8R B;  3QAT A;  4IFV B;  5CYM A;  1MN7 A;  4CQ1 A;  1UEU A;  3MEG A;  3OR2 B;  3M1V A;  1OPI A;  2JLF A;  3KMS A;  1FD8 A;  1NKE A;  1V3R A;  3PZP A;  1N34 J;  2XNQ A;  2M52 A;  1EHW A;  4JI4 F;  2H3E B;  3I0R A;  4NLR A;  1MRO B;  3FSY A;  3IGN A;  4DR7 J;  2A6M A;  4QW9 A;  4ZN1 A;  1N88 A;  4CLZ A;  4UPK A;  1UWB A;  4U95 A;  1IM6 A;  5B09 A;  7FDR A;  3M6X A;  3T00 A;  4H4K C;  4ES1 A;  1R8P A;  3PM9 A;  2VIC A;  1SC4 B;  2BDP A;  3MHY A;  3M7V A;  3TVZ A;  4JI8 F;  4F50 A;  5HRT A;  2VC1 A;  2FC8 A;  1IM4 A;  2DGS A;  4Z7C A;  3OFG A;  3EJM A;  3R6L B;  1SIW B;  1T0T V;  3RW6 A;  1LFP A;  5A76 A;  2R7R A;  3K17 A;  1ROF A;  3SQG B;  2BA9 A;  2MKK A;  1SL0 A;  3ILL A;  4DN9 A;  1FX4 A;  1U6B A;  2P8I A;  3C16 B;  3KLV A;  4LF1 A;  4QWA A;  4USK A;  2CVI A;  4DR6 J;  1M5P C;  2CPE A;  2DY9 A;  2A18 A;  5DQI A;  1RTD B;  1L3U A;  2UVW A;  5JXS A;  1U1M A;  3T5K A;  2HHH J;  5HQ8 A;  4DS4 A;  1LW0 A;  1HYS A;  2FLO A;  3VZH A;  3H2L A;  2OUG A;  1RAH B;  3DGP A;  4USH A;  5ETO A;  1QTM A;  1IKV B;  3UE2 A;  3F56 A;  3HVR A;  3KJN B;  4ED3 A;  4ETZ A;  1D8Y A;  3D3B J;  5HVF A;  1AJC A;  4TN0 A;  4IG3 B;  4WP9 A;  2BJ3 A;  2W5S A;  3MPW A;  1UWA A;  5ETK A;  4A8Q A;  2MSS A;  2HK3 A;  3IO1 A;  1GT8 A;  4LR2 A;  2MTL A;  2VG5 B;  1PC4 A;  3FUY A;  5LMU J;  5HJX A;  2ERR A;  3MUT P;  4WTY A;  3EDQ B;  4QW8 A;  3ZZO A;  3RUB L;  3ZC4 A;  4RU9 A;  5HN0 A;  1RJJ A;  3PYG A;  4ERD A;  4LF9 F;  4QR2 A;  5CZV A;  5KOW A;  3JTO A;  2MZR A;  4GKJ F;  3B8H A;  2VG7 B;  3P3D A;  4CLS A;  3QGH A;  2K7J A;  2WB1 D;  2F8H A;  3MM5 A;  1XNR F;  2DEI A;  4A8W A;  4HHJ A;  2B6A B;  5DGA A;  5I3Q A;  3BDH A;  2C2K B;  3PHE A;  1GMU A;  5IS2 A;  1F2H A;  2QEX S;  5L0B A;  1NU4 A;  1JJC B;  4IG0 B;  1LW2 B;  5A8K B;  2R8K A;  2ZE2 B;  3EGZ A;  4C11 B;  1JJ2 R;  2VOO A;  1YQH A;  2OFH X;  4DUZ J;  1BWV A;  2FD2 A;  2BKP A;  1K1Q A;  1O51 A;  2CQD A;  1U4B A;  1C0T A;  3Q23 A;  4WFN Q;  1EET B;  4U9R A;  2E29 A;  2ZOM A;  3G6E S;  2MKJ A;  4CYU B;  3FBC A;  1T05 A;  4DG1 B;  5LL6 d;  2MJU A;  1UTA A;  1Y7A A;  3M4X A;  5G0R A;  4QYZ J;  3SCJ E;  4FXD A;  3QIP A;  2EBE A;  4U6P A;  4GC6 A;  3DRS A;  2FGO A;  4DSK A;  1NJX A;  4PWW A;  2DY1 A;  4JYA J;  1WD6 A;  3J80 U;  2KYZ A;  4I6W A;  4NRT A;  2DBB A;  4W4M A;  3ISZ A;  4UUX A;  4OYA A;  4NXM F;  4GVL A;  1HQU B;  1GMW D;  2C2E A;  4ZK7 M;  1RWV B;  4J9V A;  5HVH A;  3ZZZ A;  3EX7 B;  3C6U B;  3TX0 A;  3EZO A;  3O2I A;  1FWK A;  5L0E A;  1KQS R;  1HPZ B;  3LP2 A;  2AJQ A;  1U0H B;  5DJB A;  5T14 A;  2RRN A;  1AUS L;  2RH6 A;  4OYW A;  5E2Q A;  5CAB A;  2X3D A;  4OYM A;  1NSQ A;  5K14 A;  1U24 A;  3LP1 B;  1NK4 A;  1AT1 B;  4CH7 A;  4PYA A;  3IXQ A;  1H0H B;  4E98 A;  3QSY B;  3CUL A;  3JSB A;  1HFE L;  4DL5 A;  2CJK A;  4KT0 C;  4OLO A;  5HBM A;  1C4C A;  4Y2C A;  1HNV B;  3LF0 A;  2XI3 A;  4B9T A;  3KLE B;  5ETT A;  3QT8 A;  1VQM S;  1GXU A;  3Q2S C;  1H7X A;  2WTF A;  1EW2 A;  4CLL A;  5TJ3 A;  4AL5 A;  1J2V A;  2OIH A;  2DEJ A;  3CJ4 A;  2R2S A;  1PJ5 A;  4HI2 A;  2GSN A;  4LIW A;  4NI2 B;  4PWD A;  2E1R A;  4CH0 S;  3PO4 A;  3RB6 A;  1KS2 A;  2FJD B;  3MM6 B;  1RAJ A;  1JXL A;  4C8Z A;  4DV3 J;  4J9R A;  1F9E B;  2YTC A;  2BW2 A;  3CF5 Q;  1FRJ A;  2HZC A;  3RBX A;  2XYH B;  2JFD A;  2RVJ A;  2YNG A;  5IXU A;  2RH3 A;  1R8A A;  1GX6 A;  2GC8 A;  2NSB A;  1DTT A;  3HVT A;  4MK8 A;  4CT8 A;  1WSR A;  4NLS A;  2H5E A;  4NPO A;  1W25 A;  7AT1 B;  2V9K A;  1KHV A;  2DNH A;  3MEK A;  2F3J A;  5B7W A;  2XGQ A;  2C2M B;  3KXD A;  4WFB Q;  1RHQ B;  5C25 B;  4PZV A;  4ZPW R;  4ZLL A;  1BQN B;  3GB0 A;  3LGH A;  4Q2M A;  4Y65 A;  2LMI A;  3I32 A;  4ZN3 A;  4OHW A;  1HI8 A;  1GEH A;  3N5B A;  2KI2 A;  4TY9 A;  4DPO A;  2C2R A;  4ED8 A;  2R7Q A;  2M2B A;  3D4J A;  3W61 A;  1HBM A;  3M2V B;  3MCS A;  4LUB A;  4KPC A;  2NXJ A;  2GNK A;  1NME B;  3UFC X;  4P7V A;  2D69 A;  5HMZ A;  3GPA A;  2ALZ A;  4CM2 A;  2X1B A;  1WEL A;  1MLA A;  4DR4 F;  1S1V B;  2KVI A;  2OGU A;  1ED8 A;  5BR8 F;  4RBV A;  3DLK A;  1Q53 A;  2OTJ S;  1U0S A;  2OPR A;  4CH1 A;  1TEL A;  4BBY A;  3HFK A;  3HI9 A;  3PW5 A;  5DQH A;  4DPX A;  1U25 A;  3CD6 S;  4KAY A;  1YBA A;  4FVC A;  2HPU A;  3TI0 A;  2R8G A;  3EXY A;  2C1E B;  2HHX A;  1KHK A;  5IC6 B;  4DCP B;  5KFM A;  4JI1 F;  3EE3 A;  1BMQ B;  5CCM A;  1H7W A;  4RW6 B;  5KFY A;  2BE9 B;  2XZT B;  5CYJ A;  1CJT A;  4DV2 F;  3DDN A;  2IYG A;  5HVG A;  3FJ2 A;  3QWP A;  1VBY A;  2ANH A;  1VQN S;  1YDL A;  1VFJ A;  1RDR A;  1TP7 A;  2EFP A;  3H5Y A;  3HHD A;  1XN9 A;  2ROG A;  2IJR A;  2ZZN A;  3V4I B;  1KON A;  3BDG A;  1EX8 A;  4N5S A;  3M9M B;  2MHE A;  3X1L B;  2VFT A;  1XMO J;  4Y3C A;  5IM0 A;  3CDA A;  4KE5 A;  3G4S S;  2DNP A;  3CT9 A;  2XBP A;  1Q1K A;  2CKW A;  1CUL B;  3VGV A;  2Z2Y B;  1P1T A;  3K5O A;  1UZD A;  1LWC A;  2YH0 A;  4ICL A;  3QGI A;  5B0F A;  1RLC L;  2MZS A;  3U1L A;  4F3M A;  5LQQ A;  3NG8 A;  3NRB A;  3NL0 A;  4DR5 J;  2Z0G A;  3V81 B;  2ZH1 A;  4LF5 F;  2V2Q A;  2WRM A;  3SCI E;  3AB4 B;  4FYD A;  4R0J A;  2BMB A;  1RWK B;  1NLK L;  3QFH A;  2G9Y A;  3KHH A;  3HZG A;  2FHM A;  3OL7 A;  4B56 A;  1X4D A;  1IBL J;  2OPS A;  2J9E A;  2OEJ A;  2LEB A;  4IQX A;  1UA1 A;  4XO0 A;  4K2X A;  2QE5 A;  1ZA1 B;  3FSX A;  3M6W A;  1CQN A;  4P9S A;  5C66 A;  3KLH A;  3I0S A;  4LQ9 A;  1EQM A;  3D2W A;  4BWM A;  1FDD A;  4K4Y A;  3DU6 A;  3O6Q A;  1M5O C;  3GMG A;  1XR5 A;  4O4R A;  1SBR A;  2KJV A;  1S9F A;  1C1C B;  3HLU A;  2XUL A;  3JQK A;  4MK9 A;  4JV0 A;  3WQP A;  2C42 A;  4HHU A;  1M1G A;  1NDK A;  1UEK A;  2WON B;  1UJ4 A;  4KFB A;  1S1U B;  3M05 A;  1S1W B;  3AA8 A;  1VS3 A;  2RQK A;  1FTR A;  5L9N A;  2RSQ A;  4KPY A;  2APO A;  4NLV A;  2ILY A;  4ZPC A;  3QGG A;  2Q3P A;  4B3M J;  4A8K A;  1WF0 A;  4IRK A;  3BV8 A;  5F8H A;  2ZD1 B;  4WU3 A;  2HAF A;  2VFV A;  3B5Q A;  4KGZ B;  4RW9 B;  2FJB B;  4LF4 F;  1KFS A;  1LOU A;  1N0U A;  3Q8Y A;  4L3K A;  3MMB B;  4Q2L A;  4URG A;  2QV6 A;  4CO2 A;  4TY8 B;  3FVY A;  1U1O A;  4F04 B;  1A7G E;  3G82 B;  3MM9 B;  1C0U B;  3KK3 B;  3EZ5 A;  4DFP A;  3HFZ B;  1RTJ A;  2XO7 A;  4K0K J;  5IJS A;  1AJB A;  4N76 A;  3KDO A;  1VC5 A;  5F8I A;  5D3G B;  3CD5 A;  1RHM B;  1REG X;  4HT5 A;  5DET A;  4KH0 B;  3E51 A;  5AE1 A;  2VQR A;  1HD0 A;  3DNC A;  2GHW A;  3MM7 A;  3TEG A;  3B78 A;  1BHN A;  3ILJ A;  1NZA A;  2C2N A;  3OHB A;  1T9W A;  4TYB A;  3A8K A;  1K0V A;  2OPQ A;  2BE2 B;  3AOA A;  2QL7 B;  2WBM A;  4Y2M A;  2BOA A;  4NCB A;  5L39 A;  1MNE A;  3FMB A;  3NLC A;  3PEH A;  1SJR A;  3LXQ A;  3PR5 B;  1LWF B;  4J9S A;  1G6B A;  3PY8 A;  4JI5 F;  4DOZ A;  1B7Y B;  1AFJ A;  2XQC A;  1S1T B;  3D68 A;  4WII A;  5HL7 Q;  2N82 B;  2ZH4 A;  3MK1 A;  4PUO A;  1RBL A;  1RA6 A;  4DU7 A;  3MOZ A;  1XWL A;  3GU0 A;  1V3Z A;  1GFW B;  3DU5 A;  2ZJQ Q;  1HBU A;  4UPI A;  3OVS A;  1WHV A;  2UU9 F;  3MI7 X;  5A2Q Y;  3KK2 A;  4FZV A;  4HH1 A;  2J0W A;  5EUH A;  4OYB A;  2JFK A;  1Q4R A;  2KH9 A;  3QO9 B;  3N01 A;  1FWP A;  1SB6 A;  2JVO A;  2RF2 A;  4KKO B;  2HHT A;  3FC9 A;  1EQ0 A;  3PTW A;  5CCL A;  3MMC B;  1TKZ B;  3QJP A;  2FZC B;  1QVF R;  2BAC A;  2UXC J;  4TLQ A;  4FKX A;  1QLN A;  3TJA A;  2UUA F;  1KVJ A;  2CJY B;  2GLQ A;  1PJ6 A;  3QQC D;  3AXM A;  3BKF A;  1QE1 B;  2K3I A;  2W9C B;  1PBU A;  3IGZ B;  5KT5 A;  1GK8 A;  1OY8 A;  3HD2 A;  3T1H J;  3R8Y A;  4M63 A;  2ROE A;  3EGW B;  2YNI A;  3CCR S;  2IFX A;  3LQV A;  2Y8W A;  5HAT A;  5CXT A;  2HRU A;  4O4G B;  1YJW S;  2VAS A;  3MCM A;  3TAP A;  3ADA C;  3I4P A;  4Q7A A;  1EJJ A;  3GON A;  4ZPA A;  3MAH A;  3CJ0 A;  4A8S A;  3WAY A;  4NLD A;  2RUG A;  2MHN A;  4OZ1 A;  1RT6 A;  1EB0 A;  1TL3 B;  3ENW A;  4M5L A;  3C6T A;  2MJN A;  2XMK A;  1NDP A;  1N34 F;  1M1K T;  1E3C P;  2XM3 A;  2ZH2 A;  3FGV A;  4Y2K A;  1R8C A;  2AEF A;  1M5S A;  2YQ1 A;  4I0W A;  2Y3Y A;  1NJY A;  2HHS A;  1UVL A;  2AIR B;  1KSP A;  2PMH A;  1CJV A;  4DR7 F;  2CQP A;  3IRW P;  3OVB A;  1JLF B;  2JWN A;  4DBQ A;  2O66 A;  4EYH B;  3KJV B;  1WSV A;  2DGW A;  2ZEJ A;  5KT7 A;  3BQ1 A;  4O0I A;  1S12 A;  3PNI A;  1X0F A;  4NL5 A;  1Q7L B;  2LYV A;  4K2J A;  2CQ1 A;  2UV8 A;  1X7V A;  4DFM A;  1REV A;  1RT3 A;  4LFA J;  5J2P A;  2R7X A;  3P45 B;  2YKO A;  5J1P A;  1VK8 A;  1U02 A;  4F7V A;  2AJ1 A;  2MST A;  1ZOT A;  3ZTQ A;  5DG8 A;  3TA0 A;  5E3C A;  2D9P A;  1QM9 A;  1PAU B;  5GAG U;  1S99 A;  4DR6 F;  1DUR A;  1RT4 B;  2KFY A;  4NLY A;  1FES A;  1U26 A;  1JLB A;  1UVN A;  4ID8 A;  2DRD A;  1A0O B;  2GO8 A;  1VQP S;  5D0H A;  3CJ8 A;  2HHH F;  4BLG A;  2AYM A;  2XGP A;  3KG4 A;  3BPD A;  2HHV A;  4X62 J;  3A3O B;  5C5J A;  5E33 A;  3N6M A;  1T03 A;  3QJJ A;  1KLM B;  1F3F A;  1N2L A;  5HO4 A;  2ZC4 A;  3HSZ A;  5F3Z A;  1UW4 A;  2E7W A;  3W60 A;  1N5V A;  3TAN A;  4RUH A;  3W5Y A;  3PW0 A;  2D74 B;  1N6Q A;  1FE4 A;  3QLH A;  2EVZ A;  4ZMM A;  4A8M P;  2HVD A;  3D6F B;  1P49 A;  4OZ3 A;  3W1Y C;  3NP5 A;  2VPZ B;  1RP5 A;  4ED2 A;  2DGX A;  5LMU F;  2JL9 A;  2HQG A;  2X1A A;  2HKE A;  1RT5 A;  2X51 A;  1ZAV A;  1KHL A;  3HHL A;  1YZ6 A;  3V6D B;  1RWO B;  4WZQ A;  3OFH A;  4UOC A;  4WBF A;  2KHC A;  2C3M A;  3D0I E;  2WW8 A;  4ENO A;  1X9W A;  2OP5 A;  5F8N A;  2HSE B;  2XWX A;  2PDA A;  4UOH A;  2BM0 A;  2HQC A;  1UPM B;  4IOC Q;  2DXF A;  5AJ3 J;  4HAC B;  1VCT A;  5FDL B;  4PQU B;  2GAG C;  1RWW B;  4RWW A;  4DUZ F;  1ZET A;  4UY8 5;  3K8V A;  3M32 B;  1FO1 A;  1ZM4 A;  4QR1 A;  1ALK A;  3QMQ A;  3GCX P;  2J76 E;  1H74 A;  5EWF A;  4ZVT B;  3K0J A;  3MAA B;  3FBB A;  1N8R T;  1S5Z A;  4MIW A;  4OQJ A;  4ZJQ A;  4QIE A;  3OPK A;  2GHP A;  5DLV A;  3SZZ A;  2RQ4 A;  2MPU A;  4CLU A;  2QLJ B;  4LQY A;  4OL8 A;  2BX6 A;  3MPD A;  4PYD A;  3UCZ P;  4KIA A;  1HNW J;  3DCA A;  5HLF B;  5JVH Q;  4CDI A;  1HWJ A;  4C97 A;  2DNQ A;  1H38 A;  4I2Q A;  4LSL A;  2V4R A;  4NLW A;  4JYA F;  3VR1 A;  4C9D A;  3T1Y J;  4FPI A;  1BY9 A;  2Y8Y A;  2GAH C;  1PBA A;  2VZ9 A;  5FLX Y;  2DYA A;  1U1K A;  4DL0 C;  2H4W B;  3FBE A;  4B3R J;  2KT3 A;  1YRU A;  4EBC A;  4AXJ A;  3IBF B;  3R5A A;  2GQQ A;  2H1Y A;  1FXR A;  3OW2 R;  2FZK B;  4OZ0 A;  2FHK A;  4OZJ A;  1WEZ A;  2N4C A;  1TTH B;  2CQB A;  1URB A;  5I42 B;  1HQE A;  2FLL A;  1IR1 A;  1N5T A;  4J9N A;  2ADC A;  2FHJ A;  3CDU A;  5D4P A;  1MML A;  2WBR A;  3H5S A;  2SXL A;  1LK5 A;  2HS3 A;  2EKY A;  5HRO B;  3EVW A;  1S97 A;  3EPG A;  2IPO B;  4F4X A;  3CO0 P;  1UL3 A;  2G1H A;  2QGF B;  5DM6 Q;  2GVD A;  2XS2 A;  4ECZ A;  1YX2 A;  3KYL A;  4GO7 X;  1QTN B;  4DV6 J;  1IBK J;  1R0B G;  1JK9 B;  1KH7 A;  4UPL A;  1FKP A;  3KWM A;  4Z37 A;  1KDN A;  2XC9 A;  2HGL A;  2AKW B;  2B4U A;  3A12 A;  1UJ6 A;  2ZUG A;  1KP6 A;  4ZLJ A;  4U8V A;  2JHE A;  1N36 J;  1HHT P;  2MEW A;  4WXO A;  3M8P A;  2V50 A;  5HQM A;  2M88 A;  1U2R A;  1E6V A;  1Q8B A;  3M8Z A;  2IRX A;  2UUC J;  2XY7 A;  2IFY A;  1K9M T;  1PKU A;  2MQQ A;  2KG1 A;  2XLI A;  3HP6 A;  5B0A A;  1HDH A;  3C14 B;  4ECY A;  2GSO A;  3BR9 A;  1HNI A;  5GAH U;  4IFY A;  3H40 A;  2P9G A;  3M9N B;  4DI6 A;  3ZZY A;  3CW2 C;  1RT7 B;  3BGR A;  2RQM A;  4DV3 F;  2CPX A;  2K1R B;  2AU0 A;  3GG1 A;  2V0N A;  3QAE A;  2D3Z A;  2CPI A;  3ENQ A;  1LXN A;  3PIO Q;  3JSM B;  1T9X A;  4BWJ A;  1R7I A;  1WKK A;  1RYR A;  2BZ2 A;  2BUN A;  4NCG B;  2FJV A;  3IG1 A;  2AGO A;  3PCO B;  4HL9 A;  3ZZ0 A;  4JI0 J;  3M8Q A;  1RBO B;  1F0X A;  4ZHR A;  5B0C A;  1WHY A;  1UMJ A;  2V8V A;  1ZS6 A;  2KG0 A;  3AJ2 A;  2B7B B;  2R8H A;  1BD6 A;  5EGE A;  2WB4 A;  3N4W A;  3NGK A;  3H98 A;  2D3O R;  4PG7 A;  1WDD A;  2GML A;  3BYR A;  4OHX A;  1S6Q B;  1B99 A;  2KU7 A;  5DM7 Q;  5A8W B;  3NGD A;  2POK A;  1ALI A;  3NAH A;  2ZNZ A;  2HQF A;  3TYT A;  4AND A;  2V8H A;  2W8L A;  3MM8 B;  5LT5 A;  2CQH A;  1OJ4 A;  1UVK A;  1QSL A;  4KJI A;  2FJX A;  1V5I B;  2ZUA A;  3JXO A;  3F44 A;  3GLJ A;  4DPY A;  3PV8 A;  2HFS A;  2RIJ A;  3LTO A;  4TU7 A;  2EKN A;  1J27 A;  3QT7 A;  2DNK A;  2V4J B;  4ZA1 A;  4ZVR B;  3VV2 B;  1CC7 A;  1YK9 A;  4KAI A;  3BZQ A;  2LQ9 A;  1Q16 B;  2CPZ A;  3GFZ A;  3ONQ A;  2R7V A;  2G0I A;  2WVD A;  5IT9 Y;  1B4S A;  3DLE A;  5HI7 A;  2UVR A;  4X4R A;  1FNX H;  3BO2 A;  3DXS X;  2XCP A;  2MQN A;  2YWW A;  4C0B A;  2EI5 A;  3OSP A;  4C3K A;  3THT A;  2ROP A;  3DOM A;  1TKT A;  1YZ7 A;  1LXJ A;  3TEH B;  4DDF A;  5EGY A;  1QUP A;  1RHR B;  3D9B A;  4OMF G;  1ELZ A;  4JI2 J;  1NHV A;  2LQB A;  1IBM J;  4KHR A;  3I82 A;  2J9D E;  2QA4 S;  2B8Q A;  3VHQ A;  2CNK B;  2GMH A;  1Q78 A;  3QRP A;  1BC6 A;  1FJG J;  1L5U A;  3R9L A;  2BEF A;  1HWU A;  2GO9 A;  1JLQ A;  1VQ4 S;  3CJ3 A;  1WC1 A;  2VPY B;  4J7C A;  1Q81 T;  1TUW A;  3D1O A;  1R27 B;  2CWK A;  4UOR A;  2UUW A;  3EXC X;  3V6K A;  4RW7 A;  3TUI C;  3UNG C;  2ZC3 A;  2I8E A;  4CLP A;  3E3X A;  5LSR A;  1M0S A;  1GTH A;  2P5V A;  5CYQ B;  1XMO F;  3W9H A;  1YI2 S;  3CMQ A;  4HTJ A;  5SZT A;  1VRU A;  2DJW A;  3CMR A;  2KL8 A;  4M5H A;  5C42 B;  5C24 B;  4H4M A;  3FK4 A;  5GAH I;  2D3O 1;  2BAB A;  4R8U B;  4V19 J;  2XMU A;  1QAY A;  1ZYQ A;  3DHW C;  2VL1 A;  1YJR A;  3MGJ A;  4I6Y A;  1R89 A;  3M30 A;  4F0H A;  4DR5 F;  2YX4 A;  2D3U A;  2GCF A;  5GAE I;  2FJW A;  1CJU A;  2O1P A;  3GG0 A;  1JKH A;  1WJ9 A;  1IBL F;  1WC3 A;  2FHJ D;  2UZA A;  2RAQ A;  1CC8 A;  2I38 A;  1UW9 A;  1QSY A;  3HVA A;  1SJ3 P;  4FS2 A;  1Z1Z A;  4EGL A;  3JAM U;  2LCW A;  1DAX A;  1S76 D;  2NXC A;  3MUR P;  4ZDN A;  3V4M A;  4ZLN A;  2NPF A;  1EKS A;  3BSA A;  1JB0 C;  2LQ5 A;  4CYS A;  3FEX B;  3PJ9 A;  3WC0 A;  5K8N A;  1S0O A;  2AHO B;  2IUC A;  1JLA B;  2AJF E;  2QSF A;  3TW0 A;  5KFE A;  3D1H A;  2Y0B B;  1U8W A;  2MLX A;  5F8J A;  1HBN B;  4A8F A;  4RW4 A;  3OL9 A;  2MKS A;  4L75 A;  2CQ3 A;  1S6P B;  2I5J B;  5L1L A;  4DX5 A;  1L3K A;  5KXA A;  1EAY C;  2E5H A;  2QFI A;  4ECV A;  2OJ3 A;  4B3M F;  2H51 B;  1KHW A;  3MEG B;  3M1V B;  2Z30 B;  3LWL A;  4LBI A;  2ZBI A;  2B43 A;  3DPC A;  3GJS B;  5BYQ A;  3HJF A;  3TA2 A;  2CJX B;  4F25 A;  2EC0 A;  3U02 A;  1S9E A;  1SL2 A;  1SQF A;  3I0R B;  2EFN A;  2RS8 A;  4K0K F;  4YN3 B;  4QYZ K;  3OFE A;  2LDI A;  3OUY B;  1OQ3 A;  1CPZ A;  1S77 D;  2QX0 A;  4PG6 A;  4O3S A;  4CXS A;  1ARO P;  1VBK A;  4WPA A;  5KFF A;  3KHL A;  4M8L A;  3DFE A;  1RQ0 A;  1GXL A;  4XDC A;  1FRK A;  5DDQ C;  2ZJR Q;  3OFF A;  2YKM A;  2C3Y A; 
#chains in the Genus database with same CATH homology
 3NKO A;  3WAW A;  5LIA A;  1HJK A;  3UN5 A;  1ZEF A;  3E2D A;  4GTW A;  3BDG A;  1O99 A;  1URA A;  4UPK A;  3SZY A;  5AJ9 A;  3CMR A;  4GTX A;  3IGZ B;  1P49 A;  4ZG7 A;  4NWJ A;  4KJG A;  3T00 A;  5DLV A;  3SZZ A;  2QZU A;  1SHQ A;  3NKM A;  1AUK A;  1AJC A;  4TN0 A;  4KJD A;  4MHX A;  1KHJ A;  4LRC A;  1ED8 A;  4CXK A;  4LQY A;  3M7V A;  1O98 A;  3KD8 A;  2RH6 A;  4KAV A;  3NKP A;  3WAV A;  1Y7A A;  1ELX A;  2W5S A;  4LR7 A;  5DLW A;  5KXA A;  4MIV A;  3NKR A;  4KM4 A;  4MY4 A;  3LXQ A;  5GOV A;  4UOO A;  1ANI A;  5HRT A;  1KH7 A;  4UPL A;  3NVL A;  2W5W A;  4YR1 A;  5DLT A;  3A52 A;  1KH9 A;  5EGE A;  4LRD A;  1E33 P;  4FDJ A;  1KHL A;  4LR2 A;  1B8J A;  1EQJ A;  4LRF A;  1KH5 A;  2W5R A;  3MK1 A;  2W5V A;  4KAY A;  3OT9 A;  4ZG9 A;  1EJJ A;  1ELZ A;  4LRE A;  2XRG A;  3T02 A;  3DPC A;  3UN3 A;  1ZED A;  1ZEB A;  3WAY A;  1ED9 A;  4N7T A;  2W5Q A;  5L0E A;  4ZGA A;  5LQQ A;  4FDI A;  4LRA A;  1ALI A;  3NKQ A;  3B5Q A;  3DYC A;  4NWX A;  4UPI A;  1KHK A;  2W8D A;  1HQA A;  4UPH A;  3M8Y A;  1E1Z P;  3M8Z A;  1EW9 A;  4CYR A;  3T01 A;  1K7H A;  1N2K A;  4LR9 A;  2IFY A;  4GTY A;  1Y6V A;  1AJA A;  5GRR A;  5INH A;  1E3C P;  5EGH A;  3Q3Q A;  3TG0 A;  5LRM A;  2IUC B;  3UNY A;  2G9Y A;  5L0K A;  1HDH A;  1ALH A;  3BDF A;  5K4P A;  1ELY A;  2GSO A;  5LRN A;  3BDG B;  1KH4 A;  4CXS A;  1EW2 A;  1FSU A;  4UOP A;  4B56 A;  5TJ3 A;  1AJD A;  3WBH A;  3M8W A;  2W5X A;  3UO0 A;  3BDH A;  4UOR A;  3ED4 A;  1AJB A;  5IJS A;  2D1G A;  5IJQ A;  4ZG6 A;  1N2L A;  2ANH A;  1URB A;  2XR9 A;  1EI6 A;  5L0B A;  2W8S A;  2X98 A;  2W5T A;  4CYS A;  1ALK A;  1SHN A;  1ALJ A;  2ZKT A;  2GSN A;  5C66 A;  4CXU A;  4LRB A;  3MK2 A;  4QAX A;  3NKN A;  3IGY B;  3TX0 A;  2GLQ A;  4GTZ A;  3WAX A;  3UN2 A;  2GSU A;  1ANJ A;  4LR8 A;  1EW8 A;  2GA3 A;  1KHN A;  2VQR A;  1E2S P;  3MK0 A;  3IDD A;  3TWZ A;  2IUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...