3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
1EW8A 1K7HA 3UNYA 2W5QA 5AJ9A 4UOOA 1AJCA 1O99A 5LQQA 4GTXA 3T02A 4UPLA 4CXKA 2XRGA 4KJDA 3IGZB 4LRAA 4YR1A 1KHKA 1P49A 1HJKA 2RH6A 3NKQA 3OT9A 3BDGA 2W8SA 1ALHA 5EGEA 4MHXA 4CYRA 5IJSA 4LRCA 5DLVA 2D1GA 1EQJA 3B5QA 1N2KA 3SZYA 5L0BA 4LRDA 4LREA 4KJGA 1AJBA 4CXUA 1ED8A 2GSUA 3UN5A 3IGYB 3NKPA 1KHNA 3UO0A 1KH4A 5INHA 3MK1A 2IUCB 1URBA 4B56A 4UPIA 1AUKA 2W5TA 2GSOA 2GLQA 4GTZA 3DYCA 3NKNA 1Y6VA 1AJDA 3ED4A 5HRTA 4MY4A 2VQRA 4N7TA 4LRBA 4LR2A 1ALIA 3KD8A 4UPKA 4CXSA 1SHNA 1EW9A 3TG0A 2X98A 1KH9A 2GA3A 5TJ3A 3WAYA 3M7VA 3BDGB 1SHQA 1O98A 4ZGAA 4LRFA 5L0EA 4UOPA 1E33P 2W5SA 3Q3QA 1ED9A 3T01A 5GRRA 2W5RA 4GTYA 1HQAA 3IDDA 5DLWA 5GOVA 1EW2A 4LR8A 1E3CP 3TX0A 4KAVA 2ANHA 4UPHA 1ANIA 3MK2A 3CMRA 1ZEDA 1ZEFA 4LR9A 2XR9A 2IFYA 5LIAA 1KHJA 2W5VA 3LXQA 4ZG6A 4GTWA 4LR7A 3NKOA 5KXAA 1ALKA 1EI6A 3TWZA 2QZUA 3E2DA 4FDJA 5L0KA 2W5WA 5DLTA 1ANJA 1ALJA 3WAWA 3NVLA 3MK0A 1KH7A 5LRNA 4QAXA 3M8YA 2W5XA 2G9YA 4CYSA 3M8ZA 3M8WA 1URAA 4NWXA 3WAXA 4ZG7A 4UORA 3T00A 3UN3A 3UN2A 1Y7AA 1ZEBA 4NWJA 1HDHA 4KAYA 3NKMA 5EGHA 4FDIA 1ELXA 1E1ZP 4LQYA 5C66A 5LRMA 1E2SP 2IUCA 3A52A 1EJJA 2ZKTA 3BDHA 3DPCA 1KHLA 3NKRA 3WAVA 3SZZA 1FSUA 1ELYA 2W8DA 4ZG9A 1AJAA 3BDFA 4KM4A 4TN0A 1N2LA 1KH5A 1ELZA 3WBHA 4MIVA 5K4PA 5IJQA 2GSNA 1B8JA
chains in the Genus database with same CATH superfamily
2QL7B 2RNEA 1NKEA 3PR5B 2R2SA 3H5UA 3I96A 3ZZ0A 2AU0A 2MKYA 5HK4A 2ACYA 2BOAA 7FD1A 4IH6A 5LJ3Y 2V34A 3QLHB 2F3JA 2RF2A 1KONA 1N5YA 2G13A 3DKDA 5LOQA 3QRRA 3FKBA 4B3RF 2DCUB 4DF4A 3J7Z5 5D4NA 3FSIA 1VQLS 2W5SA 4OJGA 4IQMA 3NBPB 3I9V9 1DRZA 1RWOB 4CLWA 1FTRA 4L3NA 1CULB 3PW2A 2V0NA 3H5SA 3M32B 1X9SA 2GVDB 2OPSB 1N88A 5KFGA 1U8WA 1UAWA 3OFEA 3D67A 1U6FA 1A6LA 1RA6A 2C2ZB 1UETA 4RKUC 1LNQA 1Y7AA 4ZS6A 5DGBA 4A8SA 3LP1B 2Z2MA 5B0GA 3IBFB 2C2EA 1WF1A 4DR6J 3P4UB 2N4DA 3MM5B 2EEYA 3OL9A 4B3SF 2MQPA 3MD3A 1FJ7A 1MMDA 2UVVA 1KQFB 3BSOA 4IR1A 3ZZUA 4ED0A 2V68A 2W4CA 3JSMA 3DDKA 4OX9J 1FDBA 2C22A 2CVIA 3ENVA 5EDWA 3S1TA 5D4PA 2VODA 1H7XA 5H9EJ 3LF0A 4KRWA 3M6XA 1FJCA 1FRJA 4F0MA 2HLUA 4DL0C 2BA9A 3V6KA 1VISA 3EPGA 1RHMB 3ZO7A 4HT5A 4MYUA 3IGNA 4QPXA 2QSFA 4JYAF 4GKJF 1L3SA 1NDPA 2YX4A 2B43A 3GIRA 1RWMB 5CQGA 3J7AN 2QT7A 1N34J 2C3MA 1VIOA 3CC2S 1LW2B 1TKZB 1SKSA 4J9PA 2V5HG 2YNHB 1H98A 4E8UA 2QA4G 3CCUS 2KYZA 3W7BA 3DDNA 1ZS6A 3DPCA 1KHLA 4FF1A 2PIIA 1F1BB 3CD6S 3WIUA 2N7CA 1TL1A 4CXKA 4DWIA 2RRNA 2DRAA 1C0UB 5DDOC 2XRGA 2BQRA 3MM9A 3HFKA 1AXQA 1BLUA 3IR5B 5DDRC 5D4OA 4OZ5A 5IM0B 2XULA 3PYFA 4LREA 3T3FA 3UO0A 3K2YA 3MM6A 2WSCC 2UUBF 2YX1A 3VAHA 3R6LB 1HNWF 2FJWA 1XMQF 2NZ4A 2RU9A 1TKTA 5ETMA 2VJUA 1UCNA 1KOHA 3DLEB 3VALA 2K1RA 4A8OA 3MURP 1S9GB 3RBEA 2ERRA 2HS4A 3L09A 3W5ZA 5KG1A 2XMJA 1EKRA 4PG8A 3EGNA 3MAAA 1HBOA 3SCIE 4PYDA 4X4TA 1U4BA 1Q95G 3O6QA 4C9DA 2MY7A 4O3SA 2HHQA 2QLFB 2F7VA 5HANA 4DSKA 5L1IA 4EU0A 1YX2A 3GMGA 5GAGI 5LRNA 1AUDA 3DOMA 1SC4B 2RKIB 3TUIC 2MKKA 3HKWA 2C2MB 3OBIA 2R2RA 3F73A 2FZCB 2J8AA 2F40A 4CH0S 1IXKA 3ZZOA 1B8JA 4C8OA 3CD7A 1VLOA 5KT4A 3J7YI 3CDEA 4ZP7A 1U1LA 4WTYA 3DYAB 4ZPBA 4TQSA 4JV0A 1T9WA 1HWKA 3LH2S 5TJ3A 3GONA 3H7HB 1FNMA 4UOGA 4USIA 1QVGR 2KM8B 3QBCA 4RNNA 3QQCD 2BKNA 2BJ8A 2XC9A 3NY0A 5KFIA 3IM9A 2F8MA 1PAEX 2FLOA 3IS9A 3ISND 4U95A 2IUCA 2E7XA 4H4OA 3NKRA 3KLEA 4HL9A 2XO6A 5F8JA 2FIUA 4DR4J 2C2KB 1WF2A 2OO4A 3DXBA 4Q2MA 4M63A 2B9EA 2CDRB 5KT2A 3IG1A 2VIHA 4K4VA 1U49A 3PHTA 2B4UA 3NG8A 2VJVA 3HHLC 1PYSB 4DPXA 5J1PA 1WC3A 5AXMA 3I5BA 3CDAA 2QMWA 2KFYA 4H4KC 1Y6VA 4J9VA 4RL1A 3R97A 4M5GA 1QTNB 1FKAF 1NPKA 2DR6A 1K73T 1WACA 2VHGA 3BSCA 5LMNF 2D3O1 3DU6A 1H6KX 2AGPA 4LF4J 3KK1A 3QRQA 3N9UC 4IFVB 4PG5A 1ZM9A 2PT0A 3MMCB 2FLPA 1ZM4A 4X4QA 2R7SA 4GTWA 5T14A 4ZIVA 3ZZRA 3I55S 5DLGA 4ZCKA 1RT6B 4A8FA 2QO3A 4M5KA 3AAWB 3CCTA 4U8YA 8AT1B 4ZPAA 2OJ3A 4RX6A 1PJ7A 3M05A 1DJ0A 3LUYA 4NLGA 5B7WA 2CWKA 4IKAA 2APOA 2FDNA 2YH1A 2GSNA 5IJSA 2DGOA 2V2KA 3MEKA 2B0GA 1J5OA 3VZHA 1AROP 4C0HA 4JI7F 3IAM9 2MEWA 1WC1A 3JQJA 2DY9A 2MY8A 2VF3A 2C2DA 3J81Y 2VG6A 3EXYA 2G4BA 3ZXWA 2YKMA 2YNIA 5SUHA 1JJHA 3N4WA 4RLEA 4I67A 3JXOA 2PFFB 1OMSA 2ILZA 3W63A 3CUNA 5G0RB 5F0WA 1XQIA 3LGMA 1JKHB 3FBEA 3EVWA 2ZH9A 2CPDA 2UXDF 2XQCA 1WF0A 3MECA 2CJQA 1C1CB 2RUGA 2V50A 1E33P 1NDCA 5HVGA 1H74A 4TVAB 1TK8A 1RXOB 4O4GB 5J2QA 2XGPA 4QWBA 2A1BA 1RHKB 3R7NB 1IUJA 3FBCA 4M5DB 2QZUA 1S0MA 4FP9A 1JLCB 1PC5A 4ZHRB 3NVLA 2DTJA 3TR5A 4KHPF 4BDPA 4NWXA 2AGOA 3UI3A 4RBTA 1HPZA 3NNHA 4ZPWR 2VB6A 1ELXA 2IM1A 4OLOA 3X3UA 1N56A 4NLOA 1SJRA 1XK8A 2E1AA 2H5IB 2KL8A 4JI0F 4LSLA 2EK1A 3DOLB 3PZPA 1SV5B 2J0SD 1F2GA 4RW4B 2WVEA 1SUQA 3MZIA 1I94J 2C3YA 5IFMA 1P6TA 3T19A 4PR6A 2WOMA 4RW9B 4B3SJ 1TUGB 2CNOB 2HS3A 3MEEA 2DITA 2AV5A 2J5AA 1OY6A 1ALIA 2LKZA 1WOPA 5U47A 4KIAA 1L3KA 4YMEA 3DRXA 1BMQB 2ZH1A 4ZVPB 2W5VA 4PG6A 5E41A 1VRUB 1JLQA 1GXTA 3H0PA 1AW0A 2O1PA 2ZBIA 3MWBA 4I2QB 2GHWA 1CJVB 2H5EA 1NU4A 4Y00A 4GKJJ 1OYEA 1O0PA 2R8HA 4W90B 2BJ3A 3SCKE 2N82B 2W8DA 4C4WA 1SCJB 2DNLA 1YJNS 3O3LA 4C0BA 5J2MB 1IN0A 2I0XA 2FGCA 4UOHA 1Q86T 4V1Ak 4LSNA 1JXEA 4KO0A 1SC1B 2J6SA 2PGCA 1PC4A 1OY9A 3C16A 3J7A1 3MMBA 2MGZB 3DGPB 2HBZB 5C25A 2WK4A 2Z8QA 1P8GA 1KVIA 5AT1B 2HFNA 2NLWA 1JQGA 1XERA 3R5DA 2DRDA 4NI2B 2DEIA 1XJWB 2D74B 1HNWJ 1Y11A 1S6PB 3D68A 4A4JA 3GIIA 4DFPA 1RYSA 1FDDA 3CCVS 3OTOJ 3QLHA 2GMLA 1P27B 1HI0P 2MTLA 4IG0B 2XMVA 1UVIA 1CJKA 3DGVA 3PX4A 1R3NA 2CQIA 4FXVA 3QIDA 5AXNA 3NBPA 3SSQA 4DV4F 1VBXA 1RYRA 3TUPA 4WBFA 1I6JA 3D2WA 1CULA 3ADAC 2UV8A 5CD4A 4C8MA 1U02A 3H2VE 3SSRA 3M32A 3FMBA 1X0PA 2OPSA 3AD9C 1P49A 1LXNA 2W8LA 3BDGA 5EGEA 5KFKA 4HR2A 5L38A 1YDLA 5A8KB 3Q8VA 3UWTA 2XYPB 1HD1A 2M8DB 2WAQD 2VU5A 2RJZA 1TL7A 4RNFA 3LP1A 3BSAA 4LFAJ 4NZ7A 5C2GA 6AT1B 3MM5A 4WFYA 1LWXA 1AA1B 2R42A 1A9NB 4UOPA 2EK6A 2VFSA 2VBWA 3QMQA 5KG3A 2HNYA 3K5LA 4QR2A 3EVOA 3EYZA 1S6UA 4Y34A 1B0VA 2CPYA 2UUCJ 1QM9A 4OZ0A 2UV8G 4X62J 4K4XA 3LWLA 5DLFA 3VVUA 1U48A 2BW7A 5KFXA 4E0DA 5E3RA 4DR7J 3THPA 4Q2LA 1IKXA 4P9SA 1H38A 2J7KA 3OSNA 1NK9A 3BPSP 3PIPQ 3OLAA 5IT4A 1NK7A 2Z56B 2RHQB 1U25A 3I82A 1WWHA 2GGPA 4Q44A 1LW2A 4XIUA 4NLXA 2JH3A 2EPIA 2BKPA 1FVSA 3QJJA 3CJ0A 1M1KT 3KHRA 4WP9A 2ZOFA 5CH7B 2BEFA 2BYCA 4MK7A 1S9FA 1IBLF 1T9TA 4L3KA 1FJGF 1RJJA 2F4VF 4NE9C 5J1EB 1C0TB 2JEFA 3H5YA 4QR1A 1IQTA 3FDSA 2KU7A 1S59A 3Q3QA 1IQZA 5IM0A 4RW7B 4C3LA 3GLJA 4C8ZA 4D3GA 4RWWA 1F3VA 1HNXF 4LR9A 2R2UA 2L3MA 3J7ZT 1VFJA 5IQQA 3EGWB 1WHXA 3OTEA 1ZAWA 2GO8A 2JX2A 3CJ3A 4ILMA 3HHLA 1URAA 3DLEA 5HQLA 4LFBF 2HWIA 2A3JA 2UU9F 1UWBB 4JV5F 1NHVA 1S9GA 1XBWA 3PW5A 1H3DA 1M0SA 1I5OB 2JHEA 2KVIA 1SI9A 3LP2B 1VC0A 3L95X 4ICLA 4XDDA 3CB4A 2QX0A 3IC1A 4CO2A 1NKCA 4KJDA 3IGZB 3GIKA 4DSLA 2XY6A 1JNZB 5ETNA 4NXMJ 4ILLA 2KFNA 1SH2A 2A10A 4B9SA 1D0EA 4URGA 1V9OA 1LV5A 3FCWA 4M5HA 3HD1A 3WZ0A 5D8HB 1FWLA 4JI7J 1YTYA 2ZNYA 2WBRA 1LKZA 3K8VA 2R7WA 4RPFA 1HLWA 1NBEB 1RT1B 3BJYA 9ATCB 4I7FB 2AGQA 1RBAA 2M2BA 2JC1A 1S7IA 5AXKA 3D0IE 3OL8A 3IWXA 2LFVA 4KH1B 3EXCX 3LXQA 2ZHAA 3UW1A 3RRGA 1IR1A 3CE8A 1EETA 3MXHP 3MPUB 2GCFA 3FFIB 4F36A 4Q5VA 4LFCJ 3CD5A 4ID5B 3SQGB 4BLGA 5L39A 4TXSA 3D66A 4U9RA 3OD2A 2FGOA 1BHNA 3W3SA 3OXFA 1UTAA 1JX4A 4KFBA 2ABYA 3RZAA 2QL5B 3SDEB 3FMWA 4LF6F 2VASA 2ZWOA 4CWBA 2HYIB 1Y4ZB 2B56A 4MYTA 1U1NA 4IRKA 4UPIA 2HRYA 1XNRJ 3TVKA 1NCLA 4RNHA 4ZPVR 2XMWA 2CQ3A 1YIJS 1GMVA 3NGRA 2WW4A 2J8SA 3PKMA 3NKYA 2KTQA 1WSVA 5DG9A 1RADB 4KHRA 1KD1T 4IDKB 1TL5A 2X7IA 2XY7A 1U2RA 4HACB 4EUVA 1MWYA 3AA9A 1IBCB 3NMAA 2XR9A 3CGIA 4HDHA 4CQ1A 1PBUA 5HP1A 1RWVB 1VQNS 3HXMA 1TP7A 4OV1A 1UVKA 2K3IA 4DR5F 4C8LA 2DB1A 4U67Q 3A52A 3CCJS 5HLFB 4IFVA 1WEXA 1NNDA 1F60B 1HBUB 3HPOA 2AX1A 4BS2A 2OUGA 1FKPB 1KHKA 4DUZJ 3NKQA 4ERDA 3NCRA 2RD5C 3PRDA 2MZRA 3T41A 3MPVA 1RT6A 2V6AA 1VBYA 2M3DA 2QGFB 2BBEA 2EFPA 2KG0A 3LTOA 2KKHA 4J9OA 4KY3A 1GNKA 1F5CA 2Y9HA 2VQEJ 1XNQF 3BO3A 4PQUB 3BH6B 4UPKA 2KYXA 1U1MA 3GTYX 5HO4A 4WFXA 4WK3A 3NAHA 4NCAA 1RP5A 2L9WA 1WDTA 4DQQA 5GAGU 3M9NB 2KXHA 1SJFA 4ANEA 4KV8B 1FE0A 5HAOA 2KT2A 1X4BA 2HPUA 4YR0A 5G0RA 1G2EA 1ALJA 2UVWA 1JKHA 2ZJRQ 1HQEA 4Q8FA 2FJEB 4CO0A 5F9NA 4LVOP 3LOUA 3J7YU 2V67A 5H9FJ 2HFUA 4ZCIA 3W2VB 3TZZA 4DV6J 3DLBA 4URQU 4RU2A 2NXJA 4ZHRA 2B4OA 1C1BB 1VR6A 1GX6A 2MLYA 3ZNUA 1JMTA 2AEJA 2AJ4A 5HMWA 2IA6A 4DQIA 5EGYA 2ZOGA 4CTAB 3L3CA 4H4MB 1VQOS 1QSSA 3LA0A 1TV6A 4L75A 1SIZA 1RTDA 1QDUB 3NL0A 5LSOA 1TZ0A 4DV3F 2XMKA 4AQYF 1SV5A 4NMLA 4RW4A 4JI8F 5EUHA 2FZGB 1O8BA 4I68A 1BD6A 1VBZA 4UQGA 2H4WB 1PAUB 5C24B 3AH6A 2GV1A 1RTIA 3C6TB 1KNZA 3ZTRA 3G82A 4WFAQ 4RW9A 4HHHA 3KG0A 2GAGC 4PCQA 1WC0A 3POTB 2KXNB 3IFEA 2CKWA 2ASYA 3D1HA 1KFSA 1RISA 4JI3F 4I64A 1CLFA 2GIQA 1Y5IB 4RW6B 3FZBA 2K8GA 3MUMP 3V6JA 1AUSL 1U6ZA 1OJ4A 5DDPC 5DJBA 4DJBA 1IJFB 4XO0A 3AJ2A 3V6HA 3IXQA 4K4SA 3IMQJ 1CJVA 1H2TZ 3HF5A 1TFYA 2QA4S 3G6YA 2L9DA 5HVHA 3RG6A 1HD0A 2QSWA 4NA3A 3R3TA 1SJ4P 5HMYA 4DL2A 5J2MA 2VFVA 3CJTA 3PYDA 4OI0A 3I0SB 1WC6A 2ZHBA 2BZ2A 1W7WA 1FXRA 5KFBA 3BPDA 3MCNA 3OJSA 1XR6A 4OJHA 2QIFA 2MGZA 5FIIA 3QGHA 1IBLJ 4JP8A 1FJGJ 3MMAB 2VC1A 4USHA 2F4VJ 2FJVA 4AL6A 5IV4A 4LQ3A 2VC0A 3DOKB 2P6SA 3ZFVA 4OZ3A 2VONA 1QAIA 1URRA 3OW2R 3HHEA 1Y7PA 3N5BA 1HNXJ 4KAYA 4NI2A 3LGHA 2IJFA 2D41A 1RT2A 4DPWA 4FYWB 3TI0A 3D9BA 2DGTA 3RB0A 5K4PA 2MZ1A 2IBKA 4ECRA 3W5XA 3CIMA 2WZ1A 4DPUA 4Y65A 4IG0A 1HIYA 3B4MA 2KG1A 4OX7A 1MLAA 3LWMA 2QE5A 2GIRA 4MTPA 2CPXA 4NZ0A 1YJWS 2X1FA 1VCTA 3MUTP 2OSQA 2GS8A 4OL8A 3U1LA 4DX6A 1JLAA 2CPZA 5ETTA 2ZM6F 2W5RA 3TAQA 2HS0A 5GOVA 2XM3A 2VG5A 3OFGA 3TAPA 3PJ9A 2ZD1B 5K20B 3MOJB 3U7JA 2DGWA 3LQVA 1Q78A 4ZOSA 1W26A 2IRYA 4NLPA 2XMTA 3D3CJ 3AOBA 4DUYJ 2O66A 4USVA 2VOOA 3QWUA 4MK9A 1X4GA 3MMJA 2EFQA 2ZJQQ 1WSRA 2HQGA 1BQNB 1FSUA 3L7OA 4Q0BA 1OQ6A 1N0VC 2Z4PA 3HCXA 3AJ1A 1SC6A 1RSCA 1HW9A 1DHMA 3MOZA 3DRSB 1DTQA 1Y9OA 1N2KA 2RMLA 2YWWA 1C4AA 2OPQA 1UVNA 4ECUA 3BGFA 3EPIA 1LW0A 3FEYB 1S4FA 1IR2A 3DLJA 3MD1A 2MKIA 3HJVA 1ZA1B 2UP1A 2WONA 4ITSA 4X66F 2W2QP 3I9ZA 3BQ2A 4FXDA 3MK2A 1FDNA 2EFGA 2F8HA 2LQ8A 4IRDA 1ROFA 5DZ7A 2VV5A 4P7VA 4KR0B 2OEJA 1E6VB 4NCGA 4RW7A 1RHUB 2EC0A 4HLBA 2XYHB 3G6VA 3FSYA 3ISZA 2JSXA 2W7AA 3H8YA 2JOQA 4TNOA 1WTBA 3JSRA 3PG9A 3C6UB 1UWBA 3D6HB 2D3UA 2DD8S 2PMZD 3NP5A 4P2MA 1U24A 2B9YA 4DLEA 4OI4A 3LP2A 3R5JB 3NKNA 2YPYA 2H48B 2A18A 3DI6B 3V4MA 4DSJA 1X60A 3G6ES 4USKA 2XLIA 1JIHA 5DS7A 3MUVP 5L1KA 4B02A 2J0QD 1QE1B 2Y8YA 1SKRA 1SL2A 1GXUA 3ET6B 4J9LA 1XNQJ 1C4CA 4DQRA 1YKWA 3MCOA 3ELHA 4C98A 3Q8SB 2VICA 3PY8A 4EBEA 2ZUGA 1VQKS 2A0FB 4CO4A 4P7TA 3PNIA 3M8SA 3TA0A 2EFOA 4OHWA 4BC7A 2BKOA 4WZQA 3HSDA 2RAQA 4OV6A 2VA2A 5EWGA 2RB7A 4HH1A 4DR2J 2E5LF 4TN0A 2IVYA 4KQZA 3GSDA 3KK3B 4A8QA 3GV5B 2ZNZA 3VV2B 4NLYA 5IT0A 1F5AA 4ZCMA 4HTJA 1U1OA 4PQAA 2QLWA 5LJ5Y 4A48A 3DLLQ 1ZBTA 4ID5A 2F8EX 2DHAA 3HVTB 3SQGA 3PCOB 4ELUA 4JI4F 4CLTA 3HHLD 2MZQA 2HAIA 4DFKA 1TL4A 4ZVUB 2MQQA 2OEKA 2BE7D 3PJWA 4B3MJ 2Y0BB 2ZITA 5DG8A 4ZN3A 2C2RA 3M2UB 4IG3B 5AJ3J 3WIVA 1NB7A 2P8IA 3BGRB 2UUAF 1ZEFA 3M9MB 2MQ8A 3RAMA 2KHDA 4KGXB 3BV8A 1DFDA 1NO8A 1OYDA 3CJSA 5GADU 4EYIB 2HHUA 2GW8A 4JI8J 2BJ1A 5AXLA 4C8YA 4BCAA 4QAXA 3VAKA 3AT1B 3HD2A 2Q79A 3E51A 1TVRA 2FY8A 2HZCA 3W65A 4M5MA 2ROPA 4IDKA 1IM6A 1VQ5S 1J5EJ 3IP0A 3UNGC 4NYPA 1NH8A 2RS8A 1VC6A 2GFFA 5GVQA 1LWFB 1D8ZA 4JI3J 3UE2A 2V4JA 2LYVA 4DN0A 5GAHI 4QYZJ 2AMCB 2BJ7A 3EUNA 1JLFB 3TQ1A 1RTJB 2D1GA 3QT6A 1N36J 3FCHA 2K2PA 2B6AB 4LF5F 4CLLA 2AYMA 3VVTA 5CYQB 3KLFB 1HBUA 2Y1LB 1FKPA 4GVBB 2F65A 3V6DA 2IJNA 2NSBA 4C11B 2XHWA 2CJKA 4C2MA 5KAKA 3CMES 4LR8A 1VMBA 3NS5A 1WG1A 3RR7A 1VRTA 4NRTA 4ZG6A 4G1PA 2UUTA 2HBYB 4X64F 2K3KA 1N33J 3OL6A 2RF2B 4PQUA 3OFHA 1N5YB 3DHWC 3QSIA 3CF5Q 2A2CA 3WX8A 2NQPA 2ASLA 4TLQA 4Y2CA 3Q89A 2EI5A 2DJWA 3O8WA 3CCSS 4KV8A 1KFDA 3CEDA 4CYUA 4LF7J 4NPOA 3OUYA 2DIVA 3ETOA 4WXOA 3SQOP 3BDPA 1K7HA 3TOQA 3BBCA 1T05A 3KWMA 4MHXA 3AB4B 1NB2A 1VIXA 3TZXA 3HZEA 1R0CB 2PO4A 1HQUA 1KWMA 1UA1A 4JI2F 4X84A 1TK5A 2QEXS 4DU8A 3W2VA 1RDRA 2P5VA 2VQRA 2FJXA 4AT1B 9RUBA 1WHYA 3U1NA 1QTMA 4CDIA 5HVFA 1C1BA 4J5OA 4F8RA 4KH0B 1EJ7L 4YB6A 3HP6A 3IDDA 3JSMB 4L74A 3L4BC 2BQ3A 3W9HA 4CTAA 3TZWA 5L9NA 5KFDA 4H4MA 4O3QA 3D6TB 3S7RA 4XK8C 3Q24A 1S6OA 3TJAA 2FC8A 2HK2A 2M52A 1RUSA 2ZM6J 5B0BA 3LGNA 2R7OA 2JVOA 5A2QY 3MGJA 3CSKA 2V63A 1UW4A 2DXFA 4CZCA 3K5PA 1UVLA 3Q8QB 4ELVA 3ILLA 4M1KA 3OL7A 2OPPA 5GAEU 3POTA 1JJ2R 3W8PA 3MM8A 5K8OA 2RH6A 1S79A 1CVJA 2W01A 2PEBA 3J80U 4LRDA 3EICA 3PFEA 3IO1A 1FRIA 4ECQA 3OPKA 1TFWA 5DQGA 4ECWA 2Z2ZA 1D3WA 2CNKB 4CO1A 2C3UA 2GA3A 2RQMA 5K8MA 3P6YC 5D78A 1FFGB 2CQDA 5C42A 3EWGA 3WDOA 2XNRA 4HH0A 1WI8A 4FF2A 1IJEB 4EZ9A 3CD0A 3D1QA 1QLNA 3MM6B 4GC7A 2W4DA 1G7CB 5ETQA 2LQ9A 5D15A 1SJQA 5KFJA 2DR9A 1SQFA 2AIRB 5GMDA 3H4DA 3VZIA 4QWAA 1Y3KA 3SCJE 2DKOB 1HBOB 1GTHA 4WU3A 3MMAA 4UPLA 5EWEA 4L72B 4OX6A 3DOKA 5F3TA 2KZZA 3C8YA 3LO3A 3DOMB 1AZSA 5GMKa 2LA6A 3EGVA 3I0RB 3K58A 4RJVA 2ATLA 4RO0A 3Q8PB 2I1RA 1T7PA 2PI4A 3I32A 1HL6A 2G2OA 2ZBPA 1K9MT 2RSQA 3B82A 5FJ4A 1QJHA 3OQ2A 4DR6F 2LP4A 1HQAA 3OHAA 1WKKA 1R0BG 1P9QC 3EZOA 4EGLA 4ZK7M 3UCUP 2CDQA 3TANA 4OX9F 4ZVTB 5DM6Q 3R5CA 3N79A 1KH7A 3R9LA 1X5TA 4P2FA 4PZVA 3HHKA 4ZVSB 1UEVA 3PDNA 4A8XA 2LQBA 3THVA 3V2UC 1UVMA 2ALZA 4DUTA 5IV3A 1UFLA 2KFZA 3QWPA 1T9UA 4YB5A 3PX6A 5FLXU 4DPYA 3NWGA 2ZD1A 1Q5VA 1B4SA 3JQKA 5D0GA 2EVZA 4YUDA 1RABB 4NA1A 4J9KA 5IZHA 1U2CA 1N34F 3KDNA 3W60A 3IS9B 4B08A 1EQJA 1QAJA 2CNLB 3BREA 5THWA 2IUCB 2BE9B 2MQLA 3DRYA 3KLEB 4LRBA 2LLZA 1R8AA 3J80Y 2M8HA 1A0OB 4RBUA 1APSA 1WHVA 4ZCLA 1WUUA 2X1GA 3W5YA 4W92B 2ZH7A 2JC0A 3W66A 2LU1A 3E01A 1MNEA 5BYRA 4WYWA 5KG7A 1K8AT 2XG8A 1E6YA 2ZBQA 4F25A 2QMXA 2UVUA 3M8ZA 3I5CA 2E1CA 2YKNA 1WG5A 1T94A 2G2YA 3KUEA 3KLVA 2MHNA 4FF4A 3KK1B 4TYAA 3ITHA 3VGUA 2M9KA 4PPZA 2M5YA 4WU2A 3NWRA 2DO0A 3ZTPA 2HRUA 2JJ4D 4WFNQ 2U2FA 1GEHA 1FKOB 1KOOA 2DR8A 4UUXA 3DFEA 5C5JA 2VL1A 1IBMF 4OYBA 1U1RA 1B70B 2HVIA 2O67A 4UF4A 4UZBA 2VFTA 1U0SA 4M5JA 4ES3A 2MHEA 5LT5A 3KJFB 1HKAA 4GTZA 3SI8A 3HFVA 4CI0B 3KKFA 1BWEA 3PW7A 1RI7A 2C1EB 2H65B 2QC3A 2K7JA 2MKCA 4TU9A 2AYEA 3I6PA 2VG6B 2V69A 5HL7Q 2YNIB 1K0TA 4WZMA 3IA0A 1HW8A 4C7QA 1PCAA 4F3MA 5J2PB 3DI6A 3B4DA 3O5TB 4I1TA 3H25A 4ETZA 2PA3A 3GV7B 4X4PA 1FCAA 1LXJA 1VI7A 1SKUB 2W24A 3NOCA 1QE1A 1KVJA 2XZTB 3ET6A 4QOTA 3ZZTA 4NXNF 3IWNC 2DGSA 1SQEA 2MLZA 4WCEQ 4I0WA 1OSCA 2CWXA 2DNZA 1OY8A 3CCWA 3LAMA 2AW0A 4Z7YA 3MFIA 1DURA 3BR8A 3D5MA 2H1YA 1T3OA 3M6WA 5EWFA 5HJYA 3CW2C 3D1OA 2Y8WA 2KZMA 1UJ5A 3RBDA 3KFWX 1R6VA 1NK0A 3IR6B 1HPZB 4EO8A 3R27A 2BVZA 5GMEA 2GSOA 3G71S 4USWA 3Q0AA 4AL5A 3BEGB 3E2EA 1YJUA 1Y10A 3TAMA 1S57A 4QYZK 2OD6A 4WE1B 4USJC 4DLGA 4KB7A 2ASDA 2CQPA 2QV6A 4Y0FA 2QLXA 2XZWA 5D6GA 5ETLA 3BO2A 2LEAA 4GKKF 4MKAA 3DLGB 2WOMB 5KFMA 4RUHA 1JNRB 3PO4A 2XNQA 2W5XA 5KFSA 2YPZA 1M5VC 3OSPA 2ADCA 4IG3A 1BXNA 4KPYA 3H5XA 2ZVSA 4UOFA 1RAFB 3BDFA 2G0JA 4LF4F 4V19X 5DG7A 1QD1A 3GP9A 1KEKA 2IDEA 3V81B 5CZXA 4F3OA 3SV4A 1NM2A 1WEZA 4DN9A 3QZ7A 3QO9B 1T11A 3KG1A 4ES1A 1S1WB 1RAJA 4O0IA 2QLBB 4O23A 2VBZA 2NPFA 1RCXB 5KFRA 3TUJC 2JLFA 1N54B 3DLKB 3PRVA 4DR3J 1LWFA 3JS9A 3D0HE 4K2JA 4LSNB 4KO0B 1S9EA 1RTJA 4DX5A 1RWWB 1Z1ZA 1BUXA 2QYCA 5LSLA 1XTZA 2BMBA 3CMRA 1FRLA 2HGNA 2WVDA 2B6AA 5C25B 1T9VA 1S1TA 5HATA 1W25A 3GFHA 1LOUA 5CYQA 3KLFA 2BQUA 3M8PA 4FDFA 2IRXA 3N01A 4GVBA 4TY8B 4OFZA 1YLXA 1YG0A 4C11A 1MMNA 3NS6A 3PACA 1AFJA 4FS2A 1VQ4S 2RIJA 1IWGA 3QNWB 3WQPA 1H0HB 1AYEA 3V4IB 2AJ2A 3MM7B 3D3BJ 2JEJA 4HKQA 3ZZPA 1CJKB 4KYZA 2OH2A 3K0JA 1X4HA 3G8SA 1ZTTA 1IKYB 2YQ1A 2W2OP 4FBTA 2F4FA 3VGSA 3Q23A 1M5HA 1JJCB 1WKJA 3KG4A 3VAGA 1GMWA 3BDGB 3AXKA 1F9HA 1RE1B 2GVZB 4CH1A 4CNYA 3K8WA 1TL7B 3W61A 2XMMA 2FYXA 2FTRA 5HBMA 2C2OB 1I94F 5IC4B 1EI6A 5E2QA 4DV0J 5M2RA 1WD6A 1TU0B 4IR9A 1HYSA 2POKA 4OLPA 2G9YA 2FC9A 4DHVA 1S1UA 1RAEB 4J7CA 4ENOA 1HMVB 2HNYB 3GG0A 3GV8B 8ATCB 3G4SS 2ZZNA 4J9UE 2L08A 4O4RA 4OJ3A 4DI6A 2XWXA 4F04B 2QL9B 4N56A 4DZDA 3AJDA 3MR5A 1HJKA 1ALHA 2CQ1A 2X3DA 4WP3A 2XMUA 1MROB 1IKXB 4M5IA 2XO7A 2COLA 2D3OR 5C7PA 3UCGA 3PEHA 5LL6d 4P75A 1VJWA 2IM2A 1KS2A 2CJ9A 1HNVA 3D54A 4P6QA 2E5HA 3TEHB 4CP5A 2GGPB 4KPCA 4BC9A 1U47A 4DV2J 1R8HA 4PWDA 5KG0A 1NK5A 1FRKA 4YQWA 2R8IA 3UDLA 4N8NA 2HWTA 4RR5A 3M4XA 2C3OA 4I4BA 1ALKA 3T5HA 4C6AA 2I9SA 1HQ2A 2XSFA 3F56A 1T3NA 4CLKA 1QSLA 1PILA 2ZZMA 4FYYB 4B9TA 1DQAA 4P2XA 3B8HA 2AF6A 3MFHA 2YWHA 3TVZA 1M5PC 4YOEA 1WDDA 2RDDA 3T1AA 1KP6A 5J2NA 1NK6A 2MZTA 4CRJA 2OAUA 3CCZA 1X5OA 5KOWA 2XCAA 5JVGQ 3MHYA 3HHLB 3OTOF 5ETRA 3BN7A 2AYBA 1CBKA 4OZ1A 1X5SA 4DQPA 3H40A 2JFDA 2YKAA 1RHRB 4OZ2A 4ICLB 2Y1IA 4Z7CA 1M5KC 1IBMJ 3CJ2A 5KFEA 4FYVB 4DL5A 3R7BB 1FT8A 2E1MC 4P52A 3TZYA 3WHIA 2CG4A 4F02A 1F3FA 5A8WA 3I0RA 4LJMA 1VK3A 3CJ5A 2DNYA 2BJEA 5LIAA 3C14B 3J81U 2BR0A 4G65A 1FJEB 5DLTA 5F8NA 4LFAF 3BS9A 2ZBCA 4XDCA 3AB2B 5LM7E 4YDDB 1VYAA 5HI7A 1KRPA 3LAKA 1Q8BA 2YQ0A 4DS5A 5A6WA 2E66A 4E98A 2CZ9A 1EETB 1MN9A 1U8SA 4NXNJ 2UUCF 4CM2A 2YVSA 3GZ7A 1V3SA 2PA8D 4X62F 2ZZTA 1G6BA 2AJFE 4AL7A 4DR7F 1FNXH 2B8QA 1NJIT 4KFBB 2L9NA 2AT1B 5E3QA 4OZNA 1K47A 2VQFJ 4Y6IA 5F41A 3AODA 2U1AA 4QWCA 3PVXA 2E1RA 3NOGA 1HBMB 1GH8A 4QU7A 4ID8A 2ATCB 2ZUAA 5DQHA 1Q16B 4CLZA 1IKWA 4P73A 4I6WA 3TUZC 2EG1A 3JTOA 4DEZA 4DCPB 1EQ0A 4K4ZA 3AY0A 4GKKJ 3PO5A 2FVQA 2EW9A 5B0DA 4AUKA 2JLEA 3H42A 2B4VA 4MIVA 4WK1A 4EEYA 5HP1B 3M8RA 4YR1A 1MMLA 2KT3A 4BBYA 1OWXA 3QPIA 1N5SA 5DLVA 3NGTA 1FWPA 1RWUA 1T0TV 2MLXA 5ADZA 3NXZA 4NOHA 3KLIB 3MCSA 3DNCA 3FUYA 5F9LA 5SZTA 2W2MP 2B7CB 1WC5A 1FKOA 4AD6A 5GRRA 2PI5A 3CO0P 2D7SA 5CYJA 4YHHF 3A3OB 3ULHA 4KJIA 2RQKA 4NXMF 3W8GA 4P10A 3BYPA 3T6BA 5KG4A 1GTEA 4EK2A 5BYQA 4P71A 3KMSA 2IM0A 2EFNA 1E1ZP 1EP4A 4ZVEA 2Z30B 3VCDA 4CNZA 4USTA 1PG5B 1YBUA 4MAKA 3JSYA 4YY3J 1O99A 5J2PA 4FPRA 1FEHA 2DY1A 1XN9A 4M8LA 2BRLA 4IRCA 2HQ3A 1YJTA 4ED6A 4KGMA 1HQEB 1ELOA 2AYGA 4B3OA 3T9NA 4NLRA 1BQMA 2IYGA 3R5BA 3CC4S 4I6YA 3P49B 4LFCF 2E44A 3A12A 2MQOA 2OTJS 3Q8RB 4URSA 4FVMA 3LW5C 4MFBB 3R2DJ 2WSEC 3V5RA 1LWEA 1REVA 1TKXA 3JYTB 1M1HA 2YX7A 1SJ3P 1R8BA 2HQFA 2XWYA 3K5MA 2N3LA 3E3XA 4TLRA 1S0VA 2OI2A 1JJ4A 4YR3A 3E2DA 1RB0A 1IR0A 1TV6B 3EX7B 2VOPA 2BM1A 4CLUA 1RTDB 4WE1A 4CYSA 3UR0A 1DARA 5KFVA 1Q81T 1XNRF 3O44A 1PBAA 2UXBF 4NMXA 4P2SA 3US5A 3IBCB 2GX8A 1XR7A 5F8GA 1NJXA 2W8KA 1RHQB 3DRPA 1RTIB 3DLGA 1FK9A 3G82B 4ANCA 5KFUA 1N5QA 1T02A 4C97A 1XR5A 1EHWA 5BR8J 4KSEB 4ED3A 1NKBA 2GQCA 2HQDA 2OTLS 4XPEA 3THTA 5JJBA 4RUCA 2YXLA 3V81A 4ECZA 4U7UK 2PMHA 3QT5A 1SHQA 1RK8A 3PXGa 2GAHC 1B3TA 2NR0A 3OXLA 3QO9A 1S1WA 1X4FA 1BGXT 3HDSA 1WC4A 4DUZF 3NNCA 3KOAA 4ECVA 4LIWA 2LMIA 1HA1A 2LQJA 4F67A 1REGX 3A3PB 1Q82T 1U45A 2V8VA 3P8BB 3DLKA 2X51A 1Q8LA 2YWKA 3DM2A 2VQEF 1T9YA 5T7LB 4RNOA 4NASA 1EKSA 2CJBA 3HHNB 3SSSA 3OVSA 1AB8A 3EZUA 3F0NA 5D0HA 2AP6A 1CC8A 1CJUA 2VZ9A 4O0NA 4TY8A 4PWUA 1I1GA 4F0KA 3NLCA 4OYMA 2ACMA 1L5UA 1RT2B 1FXLA 1NXIA 2DK2A 2GLQA 2YWGA 1VQMS 2EKYA 1N5TA 2N4CA 3HX9A 1SHNA 3V4IA 4N5SA 3MM7A 4DV6F 1N6QB 3GQCA 5DO2A 3GFZA 5F8IA 5IC6B 2Q1LA 3BGUA 4PABA 4HDGA 1N5VA 1IKYA 3DRRB 2PD1A 5JXSA 4ZN1A 4K4UA 2YKQA 3EE3A 4N77A 4QWEA 3IR7B 4A47A 1Q8KA 3JQMA 2KRBA 4K5RA 2HAFA 2NXEA 5IT9Y 2PFDA 1CC7A 3GCWP 1QAYA 3CWJA 3UN2A 4NWJA 1HDHA 1JLAB 2K7KA 2YQ3A 4LQYA 4D3HA 5HSPA 1VQ6S 2O5DA 2GVZA 4IO9Q 2HEKA 2DYAA 2HHHJ 2VG5B 1MWZA 4PAAA 2DHSA 2HNDA 1JWWA 1RT5A 3RJMB 5LQQA 2OMOA 3NNAA 4S0MA 1EQMA 1FTCA 3BO4A 3MPYA 4C0OC 2V8GA 4ECSA 1HMVA 1YRXA 4X4OA 3GFXA 2DGXA 3Q86A 4PEOA 3QSYB 1X0FA 4ZVOB 2XB2D 3MTJA 3AQPA 4Q0BB 1Z4UA 4ZPCA 3LALA 3LANA 4QIGA 1CS4B 4MMOA 3AD7C 2FVRA 5AE2A 4ZMMA 1DTQB 1IKVB 5DLWA 1IBKJ 1MROA 2CJYB 3BR9A 2OPQB 2ZC4A 1HI1A 2M88A 3OR1B 2C3PA 2CPEA 2ALYB 1NK4A 1LW0B 1CSJA 4QCLA 1SH3A 1PJ5A 3EGZA 4X4VA 2C28A 4IFYA 5I3UB 2WONB 5DZ6A 1SBRA 4J9NA 5CD4H 4X4UA 2BANB 1KDNA 1YJRA 1GMWD 2LEPA 2D1CA 2JZ5A 3FVYA 1YWXA 2QFIA 3CULA 3TA1A 1X9WA 1B64A 2VFUA 1OIAA 1Y5LB 4K4YA 4GVLA 1SVDA 1FFWB 1HFEL 5KG5A 5DGAA 4NCGB 3MCMA 3GJQB 4ILRA 1TMJA 1D9DA 4DV1J 2DNOA 2ZH3A 1S0OA 2KHCA 5KG6A 2B4PA 4F4WA 1RLDA 4KGZB 2HFZA 4H4KA 1UPPA 1JB0C 1RTHA 5L0KA 3HHDA 2DCLA 4PXBA 4C8KA 1SJ1A 4JI1J 5K14A 4YHHJ 4MKYA 4FBUA 1QY7A 4PWWA 3G8QA 4WKYA 1P1LA 2EKNA 5T41A 2BX6A 1JLBB 3KLGA 2GHPA 2N7YA 3KK2B 2IMOA 3WC0A 3C14A 3W62A 2L48A 1RT7B 3QIPB 1NK8A 4R0EA 5JVHQ 4NL5A 3RW7A 3TJ9A 2E9ZA 3DU5A 4NLWA 4DUYF 4OQJA 5DRKA 3B54A 5MAOA 1IWAA 4J37A 4B17A 1U7LA 1PYTA 4Y28C 1TK0A 3EDRB 3G96A 2HVDA 2OEMA 1RT3B 3D4JA 5A0YB 3T01A 1YJVA 5KFAA 1E3CP 4EBDA 3U02A 2HBRB 1T03A 3KHLA 4XTTA 1RT4B 2H3EB 4N41A 2R2TA 1D8YA 2C2NA 2EXUA 1R43A 2DIUA 1ZM2A 2M7SA 1YGYA 3C15B 5C66A 2M0GB 5AE1A 1GK8A 4K50A 2R7VA 5HN0A 1HBMA 2XYGB 3Q2TC 3IWLA 3WC2A 4EYHB 3PR4A 3TA2A 3T02A 4FF3A 2M4MA 1F5BA 3I87A 2UXBJ 3RW6A 3H2LA 3ILOA 4NLSA 2IVFB 1YQHA 4DSEA 2ZH4A 2OPRA 4ZLPA 1TVRB 1U26A 1O51A 4A46A 2DGUA 1W2IA 4B56A 2YNGA 4YB7A 1RWKB 4Y2MA 4U96A 4GRSA 2FJAB 4CXSA 3TARA 5I3PA 3QRPA 1KQSR 2NXUA 2V4JB 4DQSA 4LF9J 2WB4A 4YR2A 3OTBA 1G3OA 2D69A 4HI2A 4QU6A 4EFAC 4IQXA 5IWAF 1LWCA 3KLIA 3G2XA 2IFXA 2HRTA 2W5WA 3CJ8A 1S12A 2W4PA 4MIAA 4O44B 3B6BA 3MI7X 2OMLA 4LF1A 3FZ2A 5KG2A 4MKVA 3FRZA 1JLEB 3V6DB 2CADA 1Q79A 2A6MA 3KNAA 8RUCA 3ENQA 3FRYA 1PIEA 2CAJA 5F8HA 4N8OA 2WW8A 2UXCF 1VRTB 3HKZD 1UZDA 3L7UA 2G0IA 1U0HB 3M2RA 4X65J 2ZDPA 2MJNA 3AOAA 2DRBA 2R7TA 2NXNA 1Q5YA 2H54B 2V9WA 1D1UA 4DU7A 2HHSA 3IGYB 1V3RA 4I2PA 4LF8J 1URBA 4A8WA 3HFZB 2NPIA 3ED4A 1FERA 1YZ6A 4CLPA 4CYUB 4FPIA 3OUYB 3SV3A 4RNMA 4TYBA 1T05B 2OSRA 3E8OA 4DR2F 4LT6A 2XZDB 2VUGA 2KJWA 5HMZA 4HHUA 1HQUB 5JUMA 3VTIA 2XEXA 1HR0F 1S76D 4QQBA 4M94A 1R0AA 3PFOA 4QIEA 4FS1A 2BW2A 1XMOJ 3A1YG 3KLHA 3RB6A 4Z37A 2PDAA 2RDJA 4F2SA 1KKHA 2FHJD 1KBRA 2ZFHA 3P5BP 5KTQA 4O3PA 4MFBA 2ZBRA 2CJXB 3JYTA 4F4AA 4J9RA 1RBOB 1RKIA 2P2CB 4B3MF 2HMIB 1KLMA 3GJSB 4HTIA 4DPOA 5AJ3F 1WI6A 3A3NB 3NS7B 4LMZA 2EBEA 3OHBA 3I4HX 4LRAA 4QPTA 1S0NA 3OT9A 2KT5A 5A8RB 1MU2A 3ZZYA 2CZVC 2IRUA 4ECYA 4G3IA 4MIWA 1QUVA 4DDFA 3FNNA 2HHVA 1OPZA 1X4EA 3BGOP 3ENAA 1K1SA 4F26A 1Z2LA 3BKUA 2OPPB 3GYXB 3MM8B 1J5EF 2YH0A 1T95A 3T1YJ 1ED9A 1MSWD 2N3OA 2FHKA 2V2QA 3QAEA 5EX3A 5KOXA 3VGVA 1N36F 4AE5A 1X31C 1PGZA 2ADBA 6FD1A 3QZ8A 4A8YA 2BUNA 1SQGA 2V9KA 4JI5F 4X4RA 3UD4P 4Y2AA 2DNNA 1FF2A 2QRRA 4DR1J 3GPAA 3OR2B 5C42B 1EAYC 1KHVA 1RCOB 5KFLA 3FQKA 1VBKA 5HROA 2W2NP 1WTFA 3KHGA 4XAKA 2FD2A 2CQBA 1SIWB 3PX0A 1UKUA 3KHHA 1P1TA 3CCLS 4ED2A 2ZHOA 2LEBA 2NYIA 4LRCA 4K0KJ 1N33F 3EJMA 2OHDA 3MTKA 5H1SV 1KHNA 5T7LA 2GIFA 4EI2A 3OFFA 4L73A 1AUKA 4X2BA 2J9DA 2IM3A 1S1XA 4RW8B 4DSFA 3R8YA 4LF7F 2DNGA 2MQMA 1OSDA 2AZ1A 4K4TA 3QT8A 5JMNA 1AZSB 5DDQC 4NEYA 3FQLA 3WBZA 3SYZA 1ZA2B 2GZOA 1NZ8A 2XHCA 4J9QA 2CQ2A 1YI2S 3VQTA 4FDJA 4OYOA 5F8MA 3RAQA 1SH0A 3UDVA 2VDHA 1HBNB 2E9RX 3WAXA 2FVCA 2YBVA 4CM0A 2ZKUA 2W9CA 4KC5A 4NLDA 3GE9A 5G4DA 1N6QA 2JFKA 3K5NA 4RBVA 4DV7F 3AQOA 1I3OB 4ZLJA 3WAVA 1MN7A 2MYFA 3SZZA 3DRRA 2H5JB 1FX2A 1WNEA 5IJQA 1X4DA 4NLUA 4GC6A 1D9FA 3R6GB 4PXEA 5D3GB 4CYRA 1ICEB 2DHGA 1HHSA 2IDLA 3W2WA 3L9ZA 4N76A 4DV5J 3JAMU 2AEFA 5EX0A 4DL6A 5I42B 2I8EA 3W64A 1FDAA 2E5GA 1NHKL 4ETXA 1MG7A 5J1NA 2EG2A 3GCXP 4LBIA 2HGLA 3NCQA 1JLGB 1N0UA 2H9ZA 5KFTA 5ETPA 2FQQB 4YB1P 1NJYA 2R8KA 2QA2A 2VBXA 1ZAVA 4ZKAA 3PYGA 3VHQA 2FLLA 2YTCA 2I38A 5B0EA 2KM8C 5ETKA 2Z2YB 4K2XA 5DM7Q 2B7BB 2AJ0A 2ZE2B 4ED8A 1ZH5A 2XCPA 1CS4A 3FC9A 3O1LA 1RACB 4I56A 2W9AA 3OXGA 1IKVA 1NJWA 1AFIA 3E01B 4B3RJ 1VRQC 1W2BR 1NMEB 1KH5A 1QAXA 2IPOB 2FJDB 3OR1A 5AJ9A 2XGQA 4B9MA 1E6YB 2RH3A 3T1HF 3ILIA 5L46A 1FHTA 4DZ6A 2Z58B 2YKNB 2BJDA 5CHCB 3EZ5A 5I3UA 1FE4A 2FLNA 1R27B 3ITHB 2BANA 2BE2A 2HK3A 3GJTB 1U2FA 2NUUG 3QGPA 4LBHA 5KFWA 4KTQA 1EZZB 2DXEA 4G1IA 2VG7A 3RGIA 5F0UA 4YN3B 5E33A 1RBLA 2DNRA 1BWVA 1TR0A 2IFYA 2ZH5A 4OYIA 4RUAA 4KGVB 4DCOB 2RQ4A 2AJQA 3K89A 2LDIA 2WVCA 2SXLA 1HWLA 4NEZA 2OGUA 5BYSA 2GC8A 2HURA 3QGIA 3ZTOA 5IWAJ 4QW8A 1ZOTA 5KT6A 3M8QB 3G8TA 2LU2A 3CJKA 4KM4A 3TO8A 2XMAA 2BXJA 3JSBA 1Q8IA 3AHPA 1WELA 1BY9A 3M30A 4GTXA 2GA7A 3AXMA 2UZAA 5BXIA 4JYAJ 3QFHA 1YSJA 3HSGA 1FNOA 3A8JA 2W8SA 3GYNA 3GR0A 1F6TA 1NSQA 2HFVA 2VPXB 1ED8A 3UN5A 2UXCJ 4G6VB 5IQ6A 4C3KA 1JLBA 5BJRA 2W5TA 2JDJA 3KK2A 2KH9A 3SZ2A 3GB0A 1R7IA 1L3VA 4WXWA 3JAMY 3RBZA 3GU0A 2CQ0A 4ZP8A 1RT7A 2JLGA 2YNFA 4FNHA 3QIPA 1VQYA 3NGKA 1NJZA 1NZAA 2ILYA 4NYZA 3ZTSA 4NYOA 1F2HA 3BKTA 1NDKA 1ZPWX 2YWFA 4FN5A 3L7PA 3TAMB 2PEHA 1Q7LB 2QG9B 3RB3A 2UUBJ 1HR0J 3TEGA 5H9EK 1XMQJ 4PPDA 1RT3A 5A0YA 1E2SP 4HEA9 1NRKA 2HW3A 1Q53A 1RT4A 3DXSX 1YBAA 4CCHA 4ELTA 4ZA1A 4OYWA 3Q22A 1SPBP 4C8NA 3TNVA 2ZWPA 1FRXA 3C15A 4RUBA 3HSJA 3SFGA 5A2QU 2GVDA 1K1QA 2CRLA 3GSIA 3MR6A 2ZH8A 3WAYA 1V6HA 3T5LA 4KKOB 1ANIA 3VGTA 2IA0A 4O3NA 4L76A 4TQRA 2P9CA 2V8PA 3GG1A 1NUEA 2UUWA 3FK4A 2R7QA 5CYMB 1B7FA 2F1FA 2HQCA 2HVEA 1RAIB 2MKSA 3RRKA 1UEUA 3KJNB 3I5AA 4IOAQ 2BACA 1PKUA 1LFWA 2MZSA 3BQ1A 1S9EB 2MSSA 1J2VA 2W1BA 1WJ9A 4F2RA 2DHHA 4OIXA 1S1TB 4O44A 2XY5A 4JI5J 1S6QB 4ZVQB 4DOZA 3OV7A 1Y0HA 3M8PB 2LXIA 4J91A 2ROEA 2KVQE 1JLEA 1AJBA 5GADI 2L41A 2G2ZA 2J6TA 3MK1A 3R1LA 3OJUA 3CNQP 3J81j 3ZTQA 3DYCA 2V94A 1S1VB 1TKZA 3RB4A 1U0HA 3EMTA 2VPWB 4IUFA 3TG0A 4A8KA 2YNHA 1KH9A 3NAIA 1YK9A 1Q0NA 3D7SB 5I4MA 1DQ8A 2ROGA 4KAVA 1NSPA 4DX8H 3K57A 5CZVA 3IN5A 4B3TF 3CJ4A 1FO1A 3IRWP 3NKOA 4DL7A 3CCES 1C0UA 1HWIA 3QJLA 1ZPVA 1ULRA 2IBOA 4ZG7A 2J0XA 1RWNB 1ZEBA 4GO7X 4MK8A 1PJ6A 2VKZG 5ETOA 2LDYA 1S72S 3NMRA 2IYIA 1KVKA 5LMNJ 1Y5NB 2MPUA 5FDLB 5HBMB 1CQNA 5CCLA 1UP1A 2W5QA 3OVAA 2IJRA 3TRGA 1CG2A 3R5AA 2E9TA 4OYAA 4DV7J 2CUYA 1HYSB 1EIYB 2B8PA 1S1UB 4EO6A 3KTQA 2XSJB 5K8PA 2HMIA 4Y2IA 2CPJA 5L9XA 2KI2A 1DBDA 2LA4A 5HRTA 5A6PA 3IM8A 4NWBA 2RKIA 4WJBA 1A7GE 4CLYA 1NPPA 4FKYA 5A8RA 3KMQA 1V5IB 3BBBA 1DY3A 2J9EA 3TQEA 3HO1A 2AQ4A 2G9OA 1M90T 4QJVA 1RTZA 4C48A 1WEYA 3GILA 2D3ZA 1HNVB 1GX5A 1GT8A 2DGQA 2XI2A 1TQLA 4PWDB 4DPTA 2J9CA 3LPYA 3DYAA 4DR3F 2QLJB 4FZVA 2UXDJ 2CG8A 5D4LA 2DR7A 3MPDA 2C42A 3NRBA 1RAAB 3CVKA 3I56S 1KR4A 3BF4A 3SFUA 5ETVA 3UD3P 2WVFA 3P96A 1J27A 1UPMB 4J90A 4KHPJ 3OR2A 3C2PA 4PRFA 3CJQA 4M5LA 2VH7A 2QN6B 3T1HJ 1ACMB 5J2NB 1N52B 2HKEA 4JB8B 1YITS 2XS7A 2BV3A 2WVBA 2QFJA 4NRUA 3TVYA 2DPJA 5GAEI 2OFHX 2EC2A 3TX0A 3KJVB 2MMYA 1B99A 4JI0J 2HIQA 3CXCR 2IC3B 2J7UA 3VAIA 1SKWA 1UZHA 2HHPA 4BHQA 3CCRS 2K06A 1R8PA 4KE5A 1IM4A 3AOCA 4PYAA 4Q45A 3OTCA 4RW8A 2DPIA 2RUSA 2LXFA 1M5OC 1NLKL 2QMUB 3FBBA 3C46A 2VD3A 4JI6F 5A8WB 1V5VA 5KFOA 2OIHA 1X4CA 1R6YA 4PG7A 3LP0B 3NEKA 4YEAA 1HNIB 3CCMS 2QZ8A 4B9LA 2HVHA 4LUBA 5D0RA 3HMJG 1HBNA 3UVJB 4KGKA 4DV0F 3PYEA 4OYZA 4WTOB 3MMCA 2YY3A 4P72A 2XS2A 4ZLLA 2W9BB 3RYLA 2FPHX 3PV8A 4R5PB 4IYQA 3MR7A 3UD5A 4JV1A 1EW9A 1FFSB 5D3GA 3M6UA 5HQ8A 3MR3A 1EW2A 2Y0SD 3G9CA 4HYKA 1M1GA 5I42A 2JEIA 1LK7A 2GNKA 1NSAA 1JLGA 4B9NA 3CMAS 4DS4A 1D9AA 1VDHA 2RDIA 1HI8A 2BRKA 2EFVA 5E3CA 3M9OB 3OLBA 3UQSA 2AWZA 4PXCA 1KSPA 2R7RA 2DNHA 4DV2F 3CPWR 2JNJA 3F44A 1IKWB 1C1CA 2ZJPQ 2NUHA 2FVSA 2ZE2A 2Z57B 2J9DE 1UW9A 4O4GA 1S48A 4WF9Q 1LEOA 2O3DA 5CA5A 2KXFA 4M5DA 3IAS9 1JLCA 3U1MA 4DMZA 4LR2A 5CABA 5MLCV 2Q3PA 2I6WA 2D9OA 4DV4J 5D0EA 1EX8A 2NCKL 5KFCA 2IMWP 2PSZA 4AFFA 3H98A 4Y2KA 5LMUF 1KQGB 3NGUA 1KHJA 3ONQA 4Q43A 3GIJA 4K7QA 2ZOMA 3VAMA 1TELA 3DOLA 2R7XA 1LK5A 2RRAA 2BM0A 3T00A 1VQ8S 4F0HA 1QSYA 5CXTA 3M1VB 2R8GA 1X7VA 1YJ7A 1O6XA 3ZNJ1 1N2LA 4UOCA 4UPHA 5EHHA 4QZVB 1U09A 1SC3B 3AA8A 3LPEA 1HNZF 4ED1A 3HZGA 2BDPA 2RVJA 4UZCA 4ZIWA 2V8HA 2AKWB 3A8EA 4LIRA 2R3VA 1CEZA 4U7UD 4EBCA 3FEXB 3M8QA 2RS2A 1EP4B 2KO1A 5HQMA 1VRUA 3BGLA 1Q7YT 1AJDA 4QWDA 1K0VA 2OD4A 1S4EA 2B5JB 4I2QA 5E3PA 1HWUA 2JVRA 2G1HA 4ZGAA 3TW0A 1GAOA 2ZVIA 5M2UA 1BQXA 4GTYA 4B3OB 1BQMB 2NYHA 1CPZA 1UFKA 4OHZA 2VDIA 2BJ9A 4LR7A 5KXAA 4M5NA 1PSDA 4G1QB 5K9FA 1ANJA 3WAWA 2DHXA 4ED4A 3PW4A 4OX8A 2OLWA 4TU7A 4UW2A 2W7PA 3MEDB 3DGPA 4B3TJ 1LWEB 1REVB 1TKXB 3K5OA 1WORA 2GMHA 2DO4A 5DQIA 3D28A 3I31A 3EDQB 2VQFF 2J0WA 4LSZB 3M2VB 1JK9B 4BWMA 2YKOA 2CIMA 5IOLA 1H7WA 2HG4A 4MIBA 3S01A 1UEKA 2RQCA 2FVPA 5EN1A 1Q4RA 3TX8A 2HLTA 3Q83A 1EB0A 4F4ZA 1B0PA 1S6PA 3TJ8A 4PG4A 1N32F 4LFBJ 2UU9J 4JV5J 4F3QA 4LQ9A 3DRPB 1CJTB 4O3RA 1FK9B 3KD8A 4ZJOA 4ER8A 1X5PA 3N5FA 3QGGA 4O3OA 4RWXA 4DSIA 5ETSA 2ZEJA 3PTWA 1URNA 1B7YB 4OZLA 2NREA 1YBTA 2CXEA 5A8KA 2V2VA 1U6BA 3A13A 2V2ZA 2J76E 3N28A 2MSTA 3D6MB 5EGHA 4KKOA 2CNNB 1NSKL 3M6VA 2NS1B 1RZMA 2XS5A 1FRMA 1TL3B 1VQ7S 1ZM3A 2HZVA 2XBPA 1TUWA 3GJRB 2F63A 4J9SA 5CYMA 4QW9A 5KFPA 4MJKA 2MZJA 3GFYA 3HLUA 1OO0B 4RZRA 2RRBA 3DM2B 3HK2A 2E1PA 4YFUA 2HBQB 1VC5A 3BZQA 1JXLA 2B9WA 3HM9A 2CFXA 2HWHA 1N4LA 5B0FA 2CQ4A 1B0TA 1FXDA 2I5JB 4NCBA 3BYRA 4USUA 4PUOB 1H2VZ 4CO5A 1YJ9S 1CJUB 1S6QA 3T5JA 3R1HA 4L6V3 3C19A 4YY3F 1KHWA 4UY85 3H2UB 1CQMA 1X4AA 3HI9A 1KQKA 1U1QA 4LF6J 1LFPA 5K8NA 2RILA 4WIIA 1S1VA 1G1XA 2RU3A 4WKRA 1X9MA 3ISNC 4ED7A 3KNGA 3FGVA 3H59A 5LXYA 4ATNA 4KT0C 2B9XA 2KB2A 2JEGA 3KDOA 4WP8A 2X1BA 3K59A 2E7WA 1HARA 4ZVGA 4DL4A 2P6TA 5KFQA 3EVMA 2RE1A 5J1EA 1C0TA 4HT7A 4WFBQ 2XI3A 3PEJA 3CIZA 4JI6J 1WOOA 1XC9A 5L8RC 4TKTA 2DGVA 1GXLA 3W9IA 3QT7A 2LXUA 2AZ3A 3CDUA 4DR5J 3P5TL 3FJ2A 2HNDB 1KLNA 5FDLA 4N7TA 1RT5B 5F3ZA 2GQQA 1VJQA 1MW7A 3ETMA 3VQSA 5B09A 2DBBA 5BR8F 2XSJA 1RU2A 2VFRA 4IOBA 2MXYA 1DLOB 2IVMA 2JWNA 4OHYA 3H20A 5CCMA 4F50A 2AHOB 2Z0GA 3M8YA 5HMXA 2EWHA 2Q66A 4OI3A 2NZCA 4DCJB 4LBPA 4X4SA 1R89A 3PW0A 5LRMA 4P74A 5A76A 2BOPA 2Q43A 3PHEA 4Q8EA 1MWQA 4YP3A 1NHUA 3Q2SC 4WIQA 3CTRA 5KFNA 2Q6CA 2BABA 2Q6BA 4UOOA 3KJQB 3OTDA 4AXIA 2FZKB 4R8UB 5HJXA 1GFWB 1RT1A 4I7FA 4NLQA 3DHXA 2HNZB 4CLSA 3ZZZA 4K8RA 5KT7A 3DMJB 4OI1A 1XIQA 1BE4A 4IFYB 1FD8A 5CAAA 2WHOA 3ZC4A 3EM1A 2ZC3A 4TY9A 3DLHA 2XLKA 3FFIA 4NA2A 2HFSA 4DG1B 3SMZA 1D09B 1T9XA 2F9JA 3UPFA 2CA9A 1K44A 3MEGB 2HZAA 4YS2A 2LCWA 2V8DA 4ECTA 1S49A 2GJIA 5GAHU 2MQNA 1DZ5A 1DTTB 2CPFA 1TAUA 3UCZP 4W4MA 3SDEA 3UDCA 1VQSA 3A8IA 1KTQA 1VGYA 1WG4A 1SL1A 1YVFA 3R5GA 4AXJA 2IAJB 4UORA 5LMUJ 2FY1A 1SXLA 3JTNA 2DH8A 3HT0A 3KJVA 2ZDOA 1N48A 4DV3J 4UQTA 2IC3A 4AQYJ 3PM9A 1T8EA 1UFWA 4ZJQA 2FUG9 1RTHB 2DT9A 1KC8T 3D0GE 4CIOA 1KN6A 3CMQA 4WPAA 5K14B 3IRXB 4HACA 4KJGA 3HVWA 2MDAA 3NKPA 3A8KA 1Q1KA 2AJ1A 1OS5A 1VK8A 3O2IA 4CH7A 3KLGB 1VQ9S 4DBQA 1HNZJ 4PKDB 1X8DA 1TKDA 3LP0A 2WTFA 1SB6A 5ITHA 2HHHF 1HNIA 5H9FK 1Y3JA 4K5SA 3JB9k 4LRFA 1VOMA 3UVJA 2W25A 3UDEA 1FESA 7FDRA 5HLFA 2W7OA 2NXCA 5KT5A 1PO6A 2W9BA 1ZYQA 1M5SA 3BDEA 1JXVA 2QA1A 4K59A 2DVIA 1DAXA 3SXLA 5LSRA 4R5PA 3G6XA 4HI1A 4JUZA 4OHVA 5E7OB 4DF8A 1OQ3A 3HVAA 2E5JA 1VHFA 1EJJA 4OI2A 2KRRA 4LVNP 3N0VA 3T6JA 2GO9A 1EW8A 1T03B 3UFCX 2CQCA 1IBKF 5B0CA 3RTVA 3QYYA 4B9VA 1RQ0A 1S5ZA 4F4YA 2AEMA 3GR1A 1VLYA 4NLVA 2QYGA 4YDXA 3MPWA 4OYXA 3B5QA 3SZYA 5DETA 4ECXA 5INHA 2KDOA 2IHR1 4QIWD 3MDFA 3B78A 1NDLA 2VPZB 3BH7B 4IH7A 3R7SB 4R0JA 4MY4A 2A6OA 2WSFC 4ED5A 1UWAA 4FYDA 5B08A 3RUBL 4U6PA 1EARA 3HJFA 4HHJA 1FRHA 2B3TB 4OMFG 1N32J 2MB0B 2WB1D 2OPRB 4UUWA 2H51B 5C2CA 1AT1B 1VHIA 3HSZA 4N47A 1TMMA 2OFGX 2DNMA 2LVWA 2YNGB 3MK0A 3SEOA 4DL3A 2R9LA 1VQPS 5FD1A 2FJBB 2RT3A 3KUGA 3HT3A 4DV1F 3BDHA 2ZKTA 3SIPB 2F9DA 4ZVHA 2HGMA 4ZG9A 1LWCB 1ELZA 4I6AA 3KXDA 2FHJA 4ZVRB 2O01C 3SCLE 4DFMA 3PKYA 2DH7A 3ENWA 2UVRA 3CDBA 1NAQA 1L3UA 4KHMA 5C24A 2DXDA 5KFZA 6FDRA 3C6TA 4JI1F 2NSCA 3M1VA 3DN9A 1S97A 4NZ6A 3H90A 3MF5A 1NPRA 3I4PA 3W9JA 3M2RB 4CT9A 4R25A 1UVJA 4OZJA 1Y00A 1C2PA 4ZPDA 4RW6A 3AFGA 1H73A 4F4KA 5E5NA 4J9MA 3BQ0A 2HHWA 2CPIA 2E5IA 4HVZA 3BN4A 4JV2A 3CDWA 1TL1B 1ZAXA 1QVFR 1FWKA 4I2PB 3K7RA 4WFZA 4U8VA 3MM9B 5KFHA 3T9ZA 2B5JA 1NH7A 1U1PA 2LECA 3UN3A 3X1LB 3TYTA 2GMJA 4H54A 2QTWA 3S6EA 2W2PP 3NGSA 2A2DA 2X1AA 2VBYA 1IVZA 2MJUA 4FKXA 4B9UA 1VS3A 2B51A 1R0AB 1TKTB 1LQ9A 4X66J 4G1QA 3KLHB 3TP2A 2K1RB 3I0SA 4EWTA 2HQIA 3BSNA 3C66A 2JRSA 5L0BA 4LF2A 3MAAB 4CXUA 3MEDA 2GSUA 1O5JA 1SL0A 2MKJA 2MKHA 4F4XA 3KYLA 4ZITA 4WYLA 3OVBA 2GJ2A 1KLMB 5LXRA 5IT9U 3BKFA 5M2PA 1RHJB 3M2VA 4E2FB 3Q8UA 3IGVA 4TU8A 4MH8A 3T5KA 3C3LA 1L3TA 1O98A 5L0EA 1MU2B 2J6UA 2CYYA 3AD8C 4JBCA 4Z2XA 3MR2A 3F41A 3TWZA 3MAQA 1YRTA 1CJTA 2WRMA 3P3DA 5AE3A 3M8WA 4QIFA 5K5MA 4FVCA 1R31A 2XTJP 1UJ4A 4ALZA 3Q8YA 2FHOB 3WX4A 2F5GA 4LF9F 2P9EA 2GQ2A 1S77D 3K17A 2P9GA 3A4TA 4CO3A 7AT1B 2FHMA 2CQHA 4DXLA 2Y1JA 4QYRA 2HSEB 2G1DA 4ZDNA 1FA0A 1I51B 1XMBA 1XWLA 2VPYB 3NGDA 1TL3A 1ZZFA 5HROB 1RA7A 1U1KA 4IO1A 3VF0B 4ZVFA 1S7HA 1NEEA 4NLTA 4ZP6A 1HWJA 2E5LJ 3M7VA 4FNIA 1V3ZA 2OKQA 2D9PA 4U7CA 4X65F 1UJ6A 2CPHA 2R4FA 4H4OB 1BQNA 3N6NA 2ANHA 3DC2A 1ZEDA 3G87A 4ZJLA 4V19J 3RBXA 1OPIA 2E7VA 1S1XB 2I5JA 4JI4J 3QFWA 2HHXA 4LF8F 4PUOA 2IIHA 3DRSA 1H2UX 3IG1B 4A8MP 3BM7A 1GMUA 2XLJA 1PYOB 4KAIA 1WOSA 3ILJA 5D77A 5F8LA 4UT4A 1RWPB 2UUAJ 3FSXA 1Z2ZA 2I2YA 1QUPA 1TAQA 3CC7S 1XMOF 3DCAA 1R8CA 2W9CB 3N6MA 4WWSA 3NCPA 1XEZA 2EBGA 2CQGA 3CO9A 2HVZA 3DDIA 4DFJA 2IY5B 1YRUA 4MKBA 1ZTWA 3G86A 3JTPA 2PMWA 5L1JA 4OYPA 4FXWA 3FBFA 2DEJA 4Y3CA 4XPCA 2ZH6A 5KFYA 2HFOA 3RU0A 2PE8A 1ZZNA 1E6VA 2CJAA 2PN6A 4CT8A 2DNPA 3W2WB 2WCXA 3GYGA 1RGVA 3IBWA 1F0XA 1RAGB 2QJ3A 2DNQA 2KJVA 2DH9A 2AD9A 5E3AA 1J5OB 4MT1A 3VR1A 2GHVC 4USMA 3FCVA 4LF5J 3BBFA 1S99A 3C6UA 3RR8A 2YKMB 1RLCL 1FX4A 3NKMA 1P9YA 3CT9A 2Y1RI 1YZ7A 1ELYA 4M95A 4FYXB 3T1YF 1FD2A 1DLOA 1AJCA 4QIVA 4ZLNA 3P45B 3VAJA 3MECB 5KT3A 3PRBA 1FI4A 4X64J 1BC6A 4TN2A 3HVRA 2OELA 5IXUA 5J2QB 1KTVA 5KFFA 3D6FB 2ZH2A 4CLFA 4KBIA 4K4WA 3HULA 3R2CJ 4NX9A 1FEEA 2DISA 1RKJA 4DR1F 4I69A 3H4BA 4ES2A 3PIOQ 1WKLA 4R8UA 4DX7A 2X98A 5E0OA 2R7UA 5FLXY 1YHQS 2HNZA 5I3QA 2J7WA 3W1YC 3DMJA 2V4RA 2HHTA 4ZP9A 4C3MA 4Q7AA 3QJPA 3VAFA 3KK3A 2RHSB 4K0KF 1ZETA 4OHXA 1RAHB 2X3GA 4AYBD 4LSLB 2BE2B 4JI2J 2G0CA 4UY8T 3U27A 1SUQB 2JL9A 1GQEA 1S10A 4DG1A 4DR4F 2VG7B 3HVTA 4GMKA 1DQ9A 3QATA 4OJ1A 5IS2A 3MEEB 1G4CA 3MEGA 3QAUA 4BWJA 3WBHA 2YWEA 2Z2LA 1RU1A 3BB5A 3RRHA 3KUHA 3UNYA 4OI6A 3S8SA 3FEZA 1HHTP 1DTTA 1FVQA 2WBMA 3UR3C 4PXDA 3M2UA 4QBUA 2E29A 2AX0A 5B0AA 3PJXA 1UA0A 3BGRA 1F9FA 2IAJA 5RUBA 1RAOA 3MAHA 3GWCA 2LQ5A 4IOCQ 2HIYA 1HHQA 1KH4A 2GJFA 3ICLA 2KN4A 4EMDA 1N8RT 1JLQB 3CJKB 4ANDA 1F9EB 2CZ4A 1UL3A 3CJRA 4GO5X 3M30B 1ITPA 2FB0A 3RAXA 2VA3A 1TUVA 4X4NA 4IH5A 2PC6A 2ASJA 4RU9A 3IRXA 2Y3YA 4F7VA 2M70A 5L1LA 2VKRA 4ZPTR 1UMJA 2R8JA 3GIMA 2YKPA 2CVEA 2V4QA 3CCQS 4DV5F 1RWXB 3SBMA 1WHWA 2OP5A 1JLFA 1TTHB 3C16B 4EZ6A 3N6LA 4UTGA 3MMBB 4QR0A 4FDIA 4JOUA 1H72C 4W98A 2YNFB 2DNKA 2H4YB 3VWSA 1AJAA 2DR5A
chains in the Genus database with same CATH topology
1EW8A 1K7HA 3UNYA 2W5QA 5AJ9A 4UOOA 1AJCA 1O99A 5LQQA 4GTXA 3T02A 4UPLA 4CXKA 2XRGA 4KJDA 3IGZB 4LRAA 4YR1A 1KHKA 1P49A 1HJKA 2RH6A 3NKQA 3OT9A 3BDGA 2W8SA 1ALHA 5EGEA 4MHXA 4CYRA 5IJSA 4LRCA 5DLVA 2D1GA 1EQJA 3B5QA 1N2KA 3SZYA 5L0BA 4LRDA 4LREA 4KJGA 1AJBA 4CXUA 1ED8A 2GSUA 3UN5A 3IGYB 3NKPA 1KHNA 3UO0A 1KH4A 5INHA 3MK1A 2IUCB 1URBA 4B56A 4UPIA 1AUKA 2W5TA 2GSOA 2GLQA 4GTZA 3DYCA 3NKNA 1Y6VA 1AJDA 3ED4A 5HRTA 4MY4A 2VQRA 4N7TA 4LRBA 4LR2A 1ALIA 3KD8A 4UPKA 4CXSA 1SHNA 1EW9A 3TG0A 2X98A 1KH9A 2GA3A 5TJ3A 3WAYA 3M7VA 3BDGB 1SHQA 1O98A 4ZGAA 4LRFA 5L0EA 4UOPA 1E33P 2W5SA 3Q3QA 1ED9A 3T01A 5GRRA 2W5RA 4GTYA 1HQAA 3IDDA 5DLWA 5GOVA 1EW2A 4LR8A 1E3CP 3TX0A 4KAVA 2ANHA 4UPHA 1ANIA 3MK2A 3CMRA 1ZEDA 1ZEFA 4LR9A 2XR9A 2IFYA 5LIAA 1KHJA 2W5VA 3LXQA 4ZG6A 4GTWA 4LR7A 3NKOA 5KXAA 1ALKA 1EI6A 3TWZA 2QZUA 3E2DA 4FDJA 5L0KA 2W5WA 5DLTA 1ANJA 1ALJA 3WAWA 3NVLA 3MK0A 1KH7A 5LRNA 4QAXA 3M8YA 2W5XA 2G9YA 4CYSA 3M8ZA 3M8WA 1URAA 4NWXA 3WAXA 4ZG7A 4UORA 3T00A 3UN3A 3UN2A 1Y7AA 1ZEBA 4NWJA 1HDHA 4KAYA 3NKMA 5EGHA 4FDIA 1ELXA 1E1ZP 4LQYA 5C66A 5LRMA 1E2SP 2IUCA 3A52A 1EJJA 2ZKTA 3BDHA 3DPCA 1KHLA 3NKRA 3WAVA 3SZZA 1FSUA 1ELYA 2W8DA 4ZG9A 1AJAA 3BDFA 4KM4A 4TN0A 1N2LA 1KH5A 1ELZA 3WBHA 4MIVA 5K4PA 5IJQA 2GSNA 1B8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EW8 A;  1K7H A;  3UNY A;  2W5Q A;  5AJ9 A;  4UOO A;  1AJC A;  1O99 A;  5LQQ A;  4GTX A;  3T02 A;  4UPL A;  4CXK A;  2XRG A;  4KJD A;  3IGZ B;  4LRA A;  4YR1 A;  1KHK A;  1P49 A;  1HJK A;  2RH6 A;  3NKQ A;  3OT9 A;  3BDG A;  2W8S A;  1ALH A;  5EGE A;  4MHX A;  4CYR A;  5IJS A;  4LRC A;  5DLV A;  2D1G A;  1EQJ A;  3B5Q A;  1N2K A;  3SZY A;  5L0B A;  4LRD A;  4LRE A;  4KJG A;  1AJB A;  4CXU A;  1ED8 A;  2GSU A;  3UN5 A;  3IGY B;  3NKP A;  1KHN A;  3UO0 A;  1KH4 A;  5INH A;  3MK1 A;  2IUC B;  1URB A;  4B56 A;  4UPI A;  1AUK A;  2W5T A;  2GSO A;  2GLQ A;  4GTZ A;  3DYC A;  3NKN A;  1Y6V A;  1AJD A;  3ED4 A;  5HRT A;  4MY4 A;  2VQR A;  4N7T A;  4LRB A;  4LR2 A;  1ALI A;  3KD8 A;  4UPK A;  4CXS A;  1SHN A;  1EW9 A;  3TG0 A;  2X98 A;  1KH9 A;  2GA3 A;  5TJ3 A;  3WAY A;  3M7V A;  3BDG B;  1SHQ A;  1O98 A;  4ZGA A;  4LRF A;  5L0E A;  4UOP A;  1E33 P;  2W5S A;  3Q3Q A;  1ED9 A;  3T01 A;  5GRR A;  2W5R A;  4GTY A;  1HQA A;  3IDD A;  5DLW A;  5GOV A;  1EW2 A;  4LR8 A;  1E3C P;  3TX0 A;  4KAV A;  2ANH A;  4UPH A;  1ANI A;  3MK2 A;  3CMR A;  1ZED A;  1ZEF A;  4LR9 A;  2XR9 A;  2IFY A;  5LIA A;  1KHJ A;  2W5V A;  3LXQ A;  4ZG6 A;  4GTW A;  4LR7 A;  3NKO A;  5KXA A;  1ALK A;  1EI6 A;  3TWZ A;  2QZU A;  3E2D A;  4FDJ A;  5L0K A;  2W5W A;  5DLT A;  1ANJ A;  1ALJ A;  3WAW A;  3NVL A;  3MK0 A;  1KH7 A;  5LRN A;  4QAX A;  3M8Y A;  2W5X A;  2G9Y A;  4CYS A;  3M8Z A;  3M8W A;  1URA A;  4NWX A;  3WAX A;  4ZG7 A;  4UOR A;  3T00 A;  3UN3 A;  3UN2 A;  1Y7A A;  1ZEB A;  4NWJ A;  1HDH A;  4KAY A;  3NKM A;  5EGH A;  4FDI A;  1ELX A;  1E1Z P;  4LQY A;  5C66 A;  5LRM A;  1E2S P;  2IUC A;  3A52 A;  1EJJ A;  2ZKT A;  3BDH A;  3DPC A;  1KHL A;  3NKR A;  3WAV A;  3SZZ A;  1FSU A;  1ELY A;  2W8D A;  4ZG9 A;  1AJA A;  3BDF A;  4KM4 A;  4TN0 A;  1N2L A;  1KH5 A;  1ELZ A;  3WBH A;  4MIV A;  5K4P A;  5IJQ A;  2GSN A;  1B8J A; 
#chains in the Genus database with same CATH topology
 2QL7 B;  2RNE A;  1NKE A;  3PR5 B;  2R2S A;  3H5U A;  3I96 A;  3ZZ0 A;  2AU0 A;  2MKY A;  5HK4 A;  2ACY A;  2BOA A;  7FD1 A;  4IH6 A;  5LJ3 Y;  2V34 A;  3QLH B;  2F3J A;  2RF2 A;  1KON A;  1N5Y A;  2G13 A;  3DKD A;  5LOQ A;  3QRR A;  3FKB A;  4B3R F;  2DCU B;  4DF4 A;  3J7Z 5;  5D4N A;  3FSI A;  1VQL S;  2W5S A;  4OJG A;  4IQM A;  3NBP B;  3I9V 9;  1DRZ A;  1RWO B;  4CLW A;  1FTR A;  4L3N A;  1CUL B;  3PW2 A;  2V0N A;  3H5S A;  3M32 B;  1X9S A;  2GVD B;  2OPS B;  1N88 A;  5KFG A;  1U8W A;  1UAW A;  3OFE A;  3D67 A;  1U6F A;  1A6L A;  1RA6 A;  2C2Z B;  1UET A;  4RKU C;  1LNQ A;  1Y7A A;  4ZS6 A;  5DGB A;  4A8S A;  3LP1 B;  2Z2M A;  5B0G A;  3IBF B;  2C2E A;  1WF1 A;  4DR6 J;  3P4U B;  2N4D A;  3MM5 B;  2EEY A;  3OL9 A;  4B3S F;  2MQP A;  3MD3 A;  1FJ7 A;  1MMD A;  2UVV A;  1KQF B;  3BSO A;  4IR1 A;  3ZZU A;  4ED0 A;  2V68 A;  2W4C A;  3JSM A;  3DDK A;  4OX9 J;  1FDB A;  2C22 A;  2CVI A;  3ENV A;  5EDW A;  3S1T A;  5D4P A;  2VOD A;  1H7X A;  5H9E J;  3LF0 A;  4KRW A;  3M6X A;  1FJC A;  1FRJ A;  4F0M A;  2HLU A;  4DL0 C;  2BA9 A;  3V6K A;  1VIS A;  3EPG A;  1RHM B;  3ZO7 A;  4HT5 A;  4MYU A;  3IGN A;  4QPX A;  2QSF A;  4JYA F;  4GKJ F;  1L3S A;  1NDP A;  2YX4 A;  2B43 A;  3GIR A;  1RWM B;  5CQG A;  3J7A N;  2QT7 A;  1N34 J;  2C3M A;  1VIO A;  3CC2 S;  1LW2 B;  1TKZ B;  1SKS A;  4J9P A;  2V5H G;  2YNH B;  1H98 A;  4E8U A;  2QA4 G;  3CCU S;  2KYZ A;  3W7B A;  3DDN A;  1ZS6 A;  3DPC A;  1KHL A;  4FF1 A;  2PII A;  1F1B B;  3CD6 S;  3WIU A;  2N7C A;  1TL1 A;  4CXK A;  4DWI A;  2RRN A;  2DRA A;  1C0U B;  5DDO C;  2XRG A;  2BQR A;  3MM9 A;  3HFK A;  1AXQ A;  1BLU A;  3IR5 B;  5DDR C;  5D4O A;  4OZ5 A;  5IM0 B;  2XUL A;  3PYF A;  4LRE A;  3T3F A;  3UO0 A;  3K2Y A;  3MM6 A;  2WSC C;  2UUB F;  2YX1 A;  3VAH A;  3R6L B;  1HNW F;  2FJW A;  1XMQ F;  2NZ4 A;  2RU9 A;  1TKT A;  5ETM A;  2VJU A;  1UCN A;  1KOH A;  3DLE B;  3VAL A;  2K1R A;  4A8O A;  3MUR P;  1S9G B;  3RBE A;  2ERR A;  2HS4 A;  3L09 A;  3W5Z A;  5KG1 A;  2XMJ A;  1EKR A;  4PG8 A;  3EGN A;  3MAA A;  1HBO A;  3SCI E;  4PYD A;  4X4T A;  1U4B A;  1Q95 G;  3O6Q A;  4C9D A;  2MY7 A;  4O3S A;  2HHQ A;  2QLF B;  2F7V A;  5HAN A;  4DSK A;  5L1I A;  4EU0 A;  1YX2 A;  3GMG A;  5GAG I;  5LRN A;  1AUD A;  3DOM A;  1SC4 B;  2RKI B;  3TUI C;  2MKK A;  3HKW A;  2C2M B;  3OBI A;  2R2R A;  3F73 A;  2FZC B;  2J8A A;  2F40 A;  4CH0 S;  1IXK A;  3ZZO A;  1B8J A;  4C8O A;  3CD7 A;  1VLO A;  5KT4 A;  3J7Y I;  3CDE A;  4ZP7 A;  1U1L A;  4WTY A;  3DYA B;  4ZPB A;  4TQS A;  4JV0 A;  1T9W A;  1HWK A;  3LH2 S;  5TJ3 A;  3GON A;  3H7H B;  1FNM A;  4UOG A;  4USI A;  1QVG R;  2KM8 B;  3QBC A;  4RNN A;  3QQC D;  2BKN A;  2BJ8 A;  2XC9 A;  3NY0 A;  5KFI A;  3IM9 A;  2F8M A;  1PAE X;  2FLO A;  3IS9 A;  3ISN D;  4U95 A;  2IUC A;  2E7X A;  4H4O A;  3NKR A;  3KLE A;  4HL9 A;  2XO6 A;  5F8J A;  2FIU A;  4DR4 J;  2C2K B;  1WF2 A;  2OO4 A;  3DXB A;  4Q2M A;  4M63 A;  2B9E A;  2CDR B;  5KT2 A;  3IG1 A;  2VIH A;  4K4V A;  1U49 A;  3PHT A;  2B4U A;  3NG8 A;  2VJV A;  3HHL C;  1PYS B;  4DPX A;  5J1P A;  1WC3 A;  5AXM A;  3I5B A;  3CDA A;  2QMW A;  2KFY A;  4H4K C;  1Y6V A;  4J9V A;  4RL1 A;  3R97 A;  4M5G A;  1QTN B;  1FKA F;  1NPK A;  2DR6 A;  1K73 T;  1WAC A;  2VHG A;  3BSC A;  5LMN F;  2D3O 1;  3DU6 A;  1H6K X;  2AGP A;  4LF4 J;  3KK1 A;  3QRQ A;  3N9U C;  4IFV B;  4PG5 A;  1ZM9 A;  2PT0 A;  3MMC B;  2FLP A;  1ZM4 A;  4X4Q A;  2R7S A;  4GTW A;  5T14 A;  4ZIV A;  3ZZR A;  3I55 S;  5DLG A;  4ZCK A;  1RT6 B;  4A8F A;  2QO3 A;  4M5K A;  3AAW B;  3CCT A;  4U8Y A;  8AT1 B;  4ZPA A;  2OJ3 A;  4RX6 A;  1PJ7 A;  3M05 A;  1DJ0 A;  3LUY A;  4NLG A;  5B7W A;  2CWK A;  4IKA A;  2APO A;  2FDN A;  2YH1 A;  2GSN A;  5IJS A;  2DGO A;  2V2K A;  3MEK A;  2B0G A;  1J5O A;  3VZH A;  1ARO P;  4C0H A;  4JI7 F;  3IAM 9;  2MEW A;  1WC1 A;  3JQJ A;  2DY9 A;  2MY8 A;  2VF3 A;  2C2D A;  3J81 Y;  2VG6 A;  3EXY A;  2G4B A;  3ZXW A;  2YKM A;  2YNI A;  5SUH A;  1JJH A;  3N4W A;  4RLE A;  4I67 A;  3JXO A;  2PFF B;  1OMS A;  2ILZ A;  3W63 A;  3CUN A;  5G0R B;  5F0W A;  1XQI A;  3LGM A;  1JKH B;  3FBE A;  3EVW A;  2ZH9 A;  2CPD A;  2UXD F;  2XQC A;  1WF0 A;  3MEC A;  2CJQ A;  1C1C B;  2RUG A;  2V50 A;  1E33 P;  1NDC A;  5HVG A;  1H74 A;  4TVA B;  1TK8 A;  1RXO B;  4O4G B;  5J2Q A;  2XGP A;  4QWB A;  2A1B A;  1RHK B;  3R7N B;  1IUJ A;  3FBC A;  4M5D B;  2QZU A;  1S0M A;  4FP9 A;  1JLC B;  1PC5 A;  4ZHR B;  3NVL A;  2DTJ A;  3TR5 A;  4KHP F;  4BDP A;  4NWX A;  2AGO A;  3UI3 A;  4RBT A;  1HPZ A;  3NNH A;  4ZPW R;  2VB6 A;  1ELX A;  2IM1 A;  4OLO A;  3X3U A;  1N56 A;  4NLO A;  1SJR A;  1XK8 A;  2E1A A;  2H5I B;  2KL8 A;  4JI0 F;  4LSL A;  2EK1 A;  3DOL B;  3PZP A;  1SV5 B;  2J0S D;  1F2G A;  4RW4 B;  2WVE A;  1SUQ A;  3MZI A;  1I94 J;  2C3Y A;  5IFM A;  1P6T A;  3T19 A;  4PR6 A;  2WOM A;  4RW9 B;  4B3S J;  1TUG B;  2CNO B;  2HS3 A;  3MEE A;  2DIT A;  2AV5 A;  2J5A A;  1OY6 A;  1ALI A;  2LKZ A;  1WOP A;  5U47 A;  4KIA A;  1L3K A;  4YME A;  3DRX A;  1BMQ B;  2ZH1 A;  4ZVP B;  2W5V A;  4PG6 A;  5E41 A;  1VRU B;  1JLQ A;  1GXT A;  3H0P A;  1AW0 A;  2O1P A;  2ZBI A;  3MWB A;  4I2Q B;  2GHW A;  1CJV B;  2H5E A;  1NU4 A;  4Y00 A;  4GKJ J;  1OYE A;  1O0P A;  2R8H A;  4W90 B;  2BJ3 A;  3SCK E;  2N82 B;  2W8D A;  4C4W A;  1SCJ B;  2DNL A;  1YJN S;  3O3L A;  4C0B A;  5J2M B;  1IN0 A;  2I0X A;  2FGC A;  4UOH A;  1Q86 T;  4V1A k;  4LSN A;  1JXE A;  4KO0 A;  1SC1 B;  2J6S A;  2PGC A;  1PC4 A;  1OY9 A;  3C16 A;  3J7A 1;  3MMB A;  2MGZ B;  3DGP B;  2HBZ B;  5C25 A;  2WK4 A;  2Z8Q A;  1P8G A;  1KVI A;  5AT1 B;  2HFN A;  2NLW A;  1JQG A;  1XER A;  3R5D A;  2DRD A;  4NI2 B;  2DEI A;  1XJW B;  2D74 B;  1HNW J;  1Y11 A;  1S6P B;  3D68 A;  4A4J A;  3GII A;  4DFP A;  1RYS A;  1FDD A;  3CCV S;  3OTO J;  3QLH A;  2GML A;  1P27 B;  1HI0 P;  2MTL A;  4IG0 B;  2XMV A;  1UVI A;  1CJK A;  3DGV A;  3PX4 A;  1R3N A;  2CQI A;  4FXV A;  3QID A;  5AXN A;  3NBP A;  3SSQ A;  4DV4 F;  1VBX A;  1RYR A;  3TUP A;  4WBF A;  1I6J A;  3D2W A;  1CUL A;  3ADA C;  2UV8 A;  5CD4 A;  4C8M A;  1U02 A;  3H2V E;  3SSR A;  3M32 A;  3FMB A;  1X0P A;  2OPS A;  3AD9 C;  1P49 A;  1LXN A;  2W8L A;  3BDG A;  5EGE A;  5KFK A;  4HR2 A;  5L38 A;  1YDL A;  5A8K B;  3Q8V A;  3UWT A;  2XYP B;  1HD1 A;  2M8D B;  2WAQ D;  2VU5 A;  2RJZ A;  1TL7 A;  4RNF A;  3LP1 A;  3BSA A;  4LFA J;  4NZ7 A;  5C2G A;  6AT1 B;  3MM5 A;  4WFY A;  1LWX A;  1AA1 B;  2R42 A;  1A9N B;  4UOP A;  2EK6 A;  2VFS A;  2VBW A;  3QMQ A;  5KG3 A;  2HNY A;  3K5L A;  4QR2 A;  3EVO A;  3EYZ A;  1S6U A;  4Y34 A;  1B0V A;  2CPY A;  2UUC J;  1QM9 A;  4OZ0 A;  2UV8 G;  4X62 J;  4K4X A;  3LWL A;  5DLF A;  3VVU A;  1U48 A;  2BW7 A;  5KFX A;  4E0D A;  5E3R A;  4DR7 J;  3THP A;  4Q2L A;  1IKX A;  4P9S A;  1H38 A;  2J7K A;  3OSN A;  1NK9 A;  3BPS P;  3PIP Q;  3OLA A;  5IT4 A;  1NK7 A;  2Z56 B;  2RHQ B;  1U25 A;  3I82 A;  1WWH A;  2GGP A;  4Q44 A;  1LW2 A;  4XIU A;  4NLX A;  2JH3 A;  2EPI A;  2BKP A;  1FVS A;  3QJJ A;  3CJ0 A;  1M1K T;  3KHR A;  4WP9 A;  2ZOF A;  5CH7 B;  2BEF A;  2BYC A;  4MK7 A;  1S9F A;  1IBL F;  1T9T A;  4L3K A;  1FJG F;  1RJJ A;  2F4V F;  4NE9 C;  5J1E B;  1C0T B;  2JEF A;  3H5Y A;  4QR1 A;  1IQT A;  3FDS A;  2KU7 A;  1S59 A;  3Q3Q A;  1IQZ A;  5IM0 A;  4RW7 B;  4C3L A;  3GLJ A;  4C8Z A;  4D3G A;  4RWW A;  1F3V A;  1HNX F;  4LR9 A;  2R2U A;  2L3M A;  3J7Z T;  1VFJ A;  5IQQ A;  3EGW B;  1WHX A;  3OTE A;  1ZAW A;  2GO8 A;  2JX2 A;  3CJ3 A;  4ILM A;  3HHL A;  1URA A;  3DLE A;  5HQL A;  4LFB F;  2HWI A;  2A3J A;  2UU9 F;  1UWB B;  4JV5 F;  1NHV A;  1S9G A;  1XBW A;  3PW5 A;  1H3D A;  1M0S A;  1I5O B;  2JHE A;  2KVI A;  1SI9 A;  3LP2 B;  1VC0 A;  3L95 X;  4ICL A;  4XDD A;  3CB4 A;  2QX0 A;  3IC1 A;  4CO2 A;  1NKC A;  4KJD A;  3IGZ B;  3GIK A;  4DSL A;  2XY6 A;  1JNZ B;  5ETN A;  4NXM J;  4ILL A;  2KFN A;  1SH2 A;  2A10 A;  4B9S A;  1D0E A;  4URG A;  1V9O A;  1LV5 A;  3FCW A;  4M5H A;  3HD1 A;  3WZ0 A;  5D8H B;  1FWL A;  4JI7 J;  1YTY A;  2ZNY A;  2WBR A;  1LKZ A;  3K8V A;  2R7W A;  4RPF A;  1HLW A;  1NBE B;  1RT1 B;  3BJY A;  9ATC B;  4I7F B;  2AGQ A;  1RBA A;  2M2B A;  2JC1 A;  1S7I A;  5AXK A;  3D0I E;  3OL8 A;  3IWX A;  2LFV A;  4KH1 B;  3EXC X;  3LXQ A;  2ZHA A;  3UW1 A;  3RRG A;  1IR1 A;  3CE8 A;  1EET A;  3MXH P;  3MPU B;  2GCF A;  3FFI B;  4F36 A;  4Q5V A;  4LFC J;  3CD5 A;  4ID5 B;  3SQG B;  4BLG A;  5L39 A;  4TXS A;  3D66 A;  4U9R A;  3OD2 A;  2FGO A;  1BHN A;  3W3S A;  3OXF A;  1UTA A;  1JX4 A;  4KFB A;  2ABY A;  3RZA A;  2QL5 B;  3SDE B;  3FMW A;  4LF6 F;  2VAS A;  2ZWO A;  4CWB A;  2HYI B;  1Y4Z B;  2B56 A;  4MYT A;  1U1N A;  4IRK A;  4UPI A;  2HRY A;  1XNR J;  3TVK A;  1NCL A;  4RNH A;  4ZPV R;  2XMW A;  2CQ3 A;  1YIJ S;  1GMV A;  3NGR A;  2WW4 A;  2J8S A;  3PKM A;  3NKY A;  2KTQ A;  1WSV A;  5DG9 A;  1RAD B;  4KHR A;  1KD1 T;  4IDK B;  1TL5 A;  2X7I A;  2XY7 A;  1U2R A;  4HAC B;  4EUV A;  1MWY A;  3AA9 A;  1IBC B;  3NMA A;  2XR9 A;  3CGI A;  4HDH A;  4CQ1 A;  1PBU A;  5HP1 A;  1RWV B;  1VQN S;  3HXM A;  1TP7 A;  4OV1 A;  1UVK A;  2K3I A;  4DR5 F;  4C8L A;  2DB1 A;  4U67 Q;  3A52 A;  3CCJ S;  5HLF B;  4IFV A;  1WEX A;  1NND A;  1F60 B;  1HBU B;  3HPO A;  2AX1 A;  4BS2 A;  2OUG A;  1FKP B;  1KHK A;  4DUZ J;  3NKQ A;  4ERD A;  3NCR A;  2RD5 C;  3PRD A;  2MZR A;  3T41 A;  3MPV A;  1RT6 A;  2V6A A;  1VBY A;  2M3D A;  2QGF B;  2BBE A;  2EFP A;  2KG0 A;  3LTO A;  2KKH A;  4J9O A;  4KY3 A;  1GNK A;  1F5C A;  2Y9H A;  2VQE J;  1XNQ F;  3BO3 A;  4PQU B;  3BH6 B;  4UPK A;  2KYX A;  1U1M A;  3GTY X;  5HO4 A;  4WFX A;  4WK3 A;  3NAH A;  4NCA A;  1RP5 A;  2L9W A;  1WDT A;  4DQQ A;  5GAG U;  3M9N B;  2KXH A;  1SJF A;  4ANE A;  4KV8 B;  1FE0 A;  5HAO A;  2KT2 A;  1X4B A;  2HPU A;  4YR0 A;  5G0R A;  1G2E A;  1ALJ A;  2UVW A;  1JKH A;  2ZJR Q;  1HQE A;  4Q8F A;  2FJE B;  4CO0 A;  5F9N A;  4LVO P;  3LOU A;  3J7Y U;  2V67 A;  5H9F J;  2HFU A;  4ZCI A;  3W2V B;  3TZZ A;  4DV6 J;  3DLB A;  4URQ U;  4RU2 A;  2NXJ A;  4ZHR A;  2B4O A;  1C1B B;  1VR6 A;  1GX6 A;  2MLY A;  3ZNU A;  1JMT A;  2AEJ A;  2AJ4 A;  5HMW A;  2IA6 A;  4DQI A;  5EGY A;  2ZOG A;  4CTA B;  3L3C A;  4H4M B;  1VQO S;  1QSS A;  3LA0 A;  1TV6 A;  4L75 A;  1SIZ A;  1RTD A;  1QDU B;  3NL0 A;  5LSO A;  1TZ0 A;  4DV3 F;  2XMK A;  4AQY F;  1SV5 A;  4NML A;  4RW4 A;  4JI8 F;  5EUH A;  2FZG B;  1O8B A;  4I68 A;  1BD6 A;  1VBZ A;  4UQG A;  2H4W B;  1PAU B;  5C24 B;  3AH6 A;  2GV1 A;  1RTI A;  3C6T B;  1KNZ A;  3ZTR A;  3G82 A;  4WFA Q;  4RW9 A;  4HHH A;  3KG0 A;  2GAG C;  4PCQ A;  1WC0 A;  3POT B;  2KXN B;  3IFE A;  2CKW A;  2ASY A;  3D1H A;  1KFS A;  1RIS A;  4JI3 F;  4I64 A;  1CLF A;  2GIQ A;  1Y5I B;  4RW6 B;  3FZB A;  2K8G A;  3MUM P;  3V6J A;  1AUS L;  1U6Z A;  1OJ4 A;  5DDP C;  5DJB A;  4DJB A;  1IJF B;  4XO0 A;  3AJ2 A;  3V6H A;  3IXQ A;  4K4S A;  3IMQ J;  1CJV A;  1H2T Z;  3HF5 A;  1TFY A;  2QA4 S;  3G6Y A;  2L9D A;  5HVH A;  3RG6 A;  1HD0 A;  2QSW A;  4NA3 A;  3R3T A;  1SJ4 P;  5HMY A;  4DL2 A;  5J2M A;  2VFV A;  3CJT A;  3PYD A;  4OI0 A;  3I0S B;  1WC6 A;  2ZHB A;  2BZ2 A;  1W7W A;  1FXR A;  5KFB A;  3BPD A;  3MCN A;  3OJS A;  1XR6 A;  4OJH A;  2QIF A;  2MGZ A;  5FII A;  3QGH A;  1IBL J;  4JP8 A;  1FJG J;  3MMA B;  2VC1 A;  4USH A;  2F4V J;  2FJV A;  4AL6 A;  5IV4 A;  4LQ3 A;  2VC0 A;  3DOK B;  2P6S A;  3ZFV A;  4OZ3 A;  2VON A;  1QAI A;  1URR A;  3OW2 R;  3HHE A;  1Y7P A;  3N5B A;  1HNX J;  4KAY A;  4NI2 A;  3LGH A;  2IJF A;  2D41 A;  1RT2 A;  4DPW A;  4FYW B;  3TI0 A;  3D9B A;  2DGT A;  3RB0 A;  5K4P A;  2MZ1 A;  2IBK A;  4ECR A;  3W5X A;  3CIM A;  2WZ1 A;  4DPU A;  4Y65 A;  4IG0 A;  1HIY A;  3B4M A;  2KG1 A;  4OX7 A;  1MLA A;  3LWM A;  2QE5 A;  2GIR A;  4MTP A;  2CPX A;  4NZ0 A;  1YJW S;  2X1F A;  1VCT A;  3MUT P;  2OSQ A;  2GS8 A;  4OL8 A;  3U1L A;  4DX6 A;  1JLA A;  2CPZ A;  5ETT A;  2ZM6 F;  2W5R A;  3TAQ A;  2HS0 A;  5GOV A;  2XM3 A;  2VG5 A;  3OFG A;  3TAP A;  3PJ9 A;  2ZD1 B;  5K20 B;  3MOJ B;  3U7J A;  2DGW A;  3LQV A;  1Q78 A;  4ZOS A;  1W26 A;  2IRY A;  4NLP A;  2XMT A;  3D3C J;  3AOB A;  4DUY J;  2O66 A;  4USV A;  2VOO A;  3QWU A;  4MK9 A;  1X4G A;  3MMJ A;  2EFQ A;  2ZJQ Q;  1WSR A;  2HQG A;  1BQN B;  1FSU A;  3L7O A;  4Q0B A;  1OQ6 A;  1N0V C;  2Z4P A;  3HCX A;  3AJ1 A;  1SC6 A;  1RSC A;  1HW9 A;  1DHM A;  3MOZ A;  3DRS B;  1DTQ A;  1Y9O A;  1N2K A;  2RML A;  2YWW A;  1C4A A;  2OPQ A;  1UVN A;  4ECU A;  3BGF A;  3EPI A;  1LW0 A;  3FEY B;  1S4F A;  1IR2 A;  3DLJ A;  3MD1 A;  2MKI A;  3HJV A;  1ZA1 B;  2UP1 A;  2WON A;  4ITS A;  4X66 F;  2W2Q P;  3I9Z A;  3BQ2 A;  4FXD A;  3MK2 A;  1FDN A;  2EFG A;  2F8H A;  2LQ8 A;  4IRD A;  1ROF A;  5DZ7 A;  2VV5 A;  4P7V A;  4KR0 B;  2OEJ A;  1E6V B;  4NCG A;  4RW7 A;  1RHU B;  2EC0 A;  4HLB A;  2XYH B;  3G6V A;  3FSY A;  3ISZ A;  2JSX A;  2W7A A;  3H8Y A;  2JOQ A;  4TNO A;  1WTB A;  3JSR A;  3PG9 A;  3C6U B;  1UWB A;  3D6H B;  2D3U A;  2DD8 S;  2PMZ D;  3NP5 A;  4P2M A;  1U24 A;  2B9Y A;  4DLE A;  4OI4 A;  3LP2 A;  3R5J B;  3NKN A;  2YPY A;  2H48 B;  2A18 A;  3DI6 B;  3V4M A;  4DSJ A;  1X60 A;  3G6E S;  4USK A;  2XLI A;  1JIH A;  5DS7 A;  3MUV P;  5L1K A;  4B02 A;  2J0Q D;  1QE1 B;  2Y8Y A;  1SKR A;  1SL2 A;  1GXU A;  3ET6 B;  4J9L A;  1XNQ J;  1C4C A;  4DQR A;  1YKW A;  3MCO A;  3ELH A;  4C98 A;  3Q8S B;  2VIC A;  3PY8 A;  4EBE A;  2ZUG A;  1VQK S;  2A0F B;  4CO4 A;  4P7T A;  3PNI A;  3M8S A;  3TA0 A;  2EFO A;  4OHW A;  4BC7 A;  2BKO A;  4WZQ A;  3HSD A;  2RAQ A;  4OV6 A;  2VA2 A;  5EWG A;  2RB7 A;  4HH1 A;  4DR2 J;  2E5L F;  4TN0 A;  2IVY A;  4KQZ A;  3GSD A;  3KK3 B;  4A8Q A;  3GV5 B;  2ZNZ A;  3VV2 B;  4NLY A;  5IT0 A;  1F5A A;  4ZCM A;  4HTJ A;  1U1O A;  4PQA A;  2QLW A;  5LJ5 Y;  4A48 A;  3DLL Q;  1ZBT A;  4ID5 A;  2F8E X;  2DHA A;  3HVT B;  3SQG A;  3PCO B;  4ELU A;  4JI4 F;  4CLT A;  3HHL D;  2MZQ A;  2HAI A;  4DFK A;  1TL4 A;  4ZVU B;  2MQQ A;  2OEK A;  2BE7 D;  3PJW A;  4B3M J;  2Y0B B;  2ZIT A;  5DG8 A;  4ZN3 A;  2C2R A;  3M2U B;  4IG3 B;  5AJ3 J;  3WIV A;  1NB7 A;  2P8I A;  3BGR B;  2UUA F;  1ZEF A;  3M9M B;  2MQ8 A;  3RAM A;  2KHD A;  4KGX B;  3BV8 A;  1DFD A;  1NO8 A;  1OYD A;  3CJS A;  5GAD U;  4EYI B;  2HHU A;  2GW8 A;  4JI8 J;  2BJ1 A;  5AXL A;  4C8Y A;  4BCA A;  4QAX A;  3VAK A;  3AT1 B;  3HD2 A;  2Q79 A;  3E51 A;  1TVR A;  2FY8 A;  2HZC A;  3W65 A;  4M5M A;  2ROP A;  4IDK A;  1IM6 A;  1VQ5 S;  1J5E J;  3IP0 A;  3UNG C;  4NYP A;  1NH8 A;  2RS8 A;  1VC6 A;  2GFF A;  5GVQ A;  1LWF B;  1D8Z A;  4JI3 J;  3UE2 A;  2V4J A;  2LYV A;  4DN0 A;  5GAH I;  4QYZ J;  2AMC B;  2BJ7 A;  3EUN A;  1JLF B;  3TQ1 A;  1RTJ B;  2D1G A;  3QT6 A;  1N36 J;  3FCH A;  2K2P A;  2B6A B;  4LF5 F;  4CLL A;  2AYM A;  3VVT A;  5CYQ B;  3KLF B;  1HBU A;  2Y1L B;  1FKP A;  4GVB B;  2F65 A;  3V6D A;  2IJN A;  2NSB A;  4C11 B;  2XHW A;  2CJK A;  4C2M A;  5KAK A;  3CME S;  4LR8 A;  1VMB A;  3NS5 A;  1WG1 A;  3RR7 A;  1VRT A;  4NRT A;  4ZG6 A;  4G1P A;  2UUT A;  2HBY B;  4X64 F;  2K3K A;  1N33 J;  3OL6 A;  2RF2 B;  4PQU A;  3OFH A;  1N5Y B;  3DHW C;  3QSI A;  3CF5 Q;  2A2C A;  3WX8 A;  2NQP A;  2ASL A;  4TLQ A;  4Y2C A;  3Q89 A;  2EI5 A;  2DJW A;  3O8W A;  3CCS S;  4KV8 A;  1KFD A;  3CED A;  4CYU A;  4LF7 J;  4NPO A;  3OUY A;  2DIV A;  3ETO A;  4WXO A;  3SQO P;  3BDP A;  1K7H A;  3TOQ A;  3BBC A;  1T05 A;  3KWM A;  4MHX A;  3AB4 B;  1NB2 A;  1VIX A;  3TZX A;  3HZE A;  1R0C B;  2PO4 A;  1HQU A;  1KWM A;  1UA1 A;  4JI2 F;  4X84 A;  1TK5 A;  2QEX S;  4DU8 A;  3W2V A;  1RDR A;  2P5V A;  2VQR A;  2FJX A;  4AT1 B;  9RUB A;  1WHY A;  3U1N A;  1QTM A;  4CDI A;  5HVF A;  1C1B A;  4J5O A;  4F8R A;  4KH0 B;  1EJ7 L;  4YB6 A;  3HP6 A;  3IDD A;  3JSM B;  4L74 A;  3L4B C;  2BQ3 A;  3W9H A;  4CTA A;  3TZW A;  5L9N A;  5KFD A;  4H4M A;  4O3Q A;  3D6T B;  3S7R A;  4XK8 C;  3Q24 A;  1S6O A;  3TJA A;  2FC8 A;  2HK2 A;  2M52 A;  1RUS A;  2ZM6 J;  5B0B A;  3LGN A;  2R7O A;  2JVO A;  5A2Q Y;  3MGJ A;  3CSK A;  2V63 A;  1UW4 A;  2DXF A;  4CZC A;  3K5P A;  1UVL A;  3Q8Q B;  4ELV A;  3ILL A;  4M1K A;  3OL7 A;  2OPP A;  5GAE U;  3POT A;  1JJ2 R;  3W8P A;  3MM8 A;  5K8O A;  2RH6 A;  1S79 A;  1CVJ A;  2W01 A;  2PEB A;  3J80 U;  4LRD A;  3EIC A;  3PFE A;  3IO1 A;  1FRI A;  4ECQ A;  3OPK A;  1TFW A;  5DQG A;  4ECW A;  2Z2Z A;  1D3W A;  2CNK B;  4CO1 A;  2C3U A;  2GA3 A;  2RQM A;  5K8M A;  3P6Y C;  5D78 A;  1FFG B;  2CQD A;  5C42 A;  3EWG A;  3WDO A;  2XNR A;  4HH0 A;  1WI8 A;  4FF2 A;  1IJE B;  4EZ9 A;  3CD0 A;  3D1Q A;  1QLN A;  3MM6 B;  4GC7 A;  2W4D A;  1G7C B;  5ETQ A;  2LQ9 A;  5D15 A;  1SJQ A;  5KFJ A;  2DR9 A;  1SQF A;  2AIR B;  5GMD A;  3H4D A;  3VZI A;  4QWA A;  1Y3K A;  3SCJ E;  2DKO B;  1HBO B;  1GTH A;  4WU3 A;  3MMA A;  4UPL A;  5EWE A;  4L72 B;  4OX6 A;  3DOK A;  5F3T A;  2KZZ A;  3C8Y A;  3LO3 A;  3DOM B;  1AZS A;  5GMK a;  2LA6 A;  3EGV A;  3I0R B;  3K58 A;  4RJV A;  2ATL A;  4RO0 A;  3Q8P B;  2I1R A;  1T7P A;  2PI4 A;  3I32 A;  1HL6 A;  2G2O A;  2ZBP A;  1K9M T;  2RSQ A;  3B82 A;  5FJ4 A;  1QJH A;  3OQ2 A;  4DR6 F;  2LP4 A;  1HQA A;  3OHA A;  1WKK A;  1R0B G;  1P9Q C;  3EZO A;  4EGL A;  4ZK7 M;  3UCU P;  2CDQ A;  3TAN A;  4OX9 F;  4ZVT B;  5DM6 Q;  3R5C A;  3N79 A;  1KH7 A;  3R9L A;  1X5T A;  4P2F A;  4PZV A;  3HHK A;  4ZVS B;  1UEV A;  3PDN A;  4A8X A;  2LQB A;  3THV A;  3V2U C;  1UVM A;  2ALZ A;  4DUT A;  5IV3 A;  1UFL A;  2KFZ A;  3QWP A;  1T9U A;  4YB5 A;  3PX6 A;  5FLX U;  4DPY A;  3NWG A;  2ZD1 A;  1Q5V A;  1B4S A;  3JQK A;  5D0G A;  2EVZ A;  4YUD A;  1RAB B;  4NA1 A;  4J9K A;  5IZH A;  1U2C A;  1N34 F;  3KDN A;  3W60 A;  3IS9 B;  4B08 A;  1EQJ A;  1QAJ A;  2CNL B;  3BRE A;  5THW A;  2IUC B;  2BE9 B;  2MQL A;  3DRY A;  3KLE B;  4LRB A;  2LLZ A;  1R8A A;  3J80 Y;  2M8H A;  1A0O B;  4RBU A;  1APS A;  1WHV A;  4ZCL A;  1WUU A;  2X1G A;  3W5Y A;  4W92 B;  2ZH7 A;  2JC0 A;  3W66 A;  2LU1 A;  3E01 A;  1MNE A;  5BYR A;  4WYW A;  5KG7 A;  1K8A T;  2XG8 A;  1E6Y A;  2ZBQ A;  4F25 A;  2QMX A;  2UVU A;  3M8Z A;  3I5C A;  2E1C A;  2YKN A;  1WG5 A;  1T94 A;  2G2Y A;  3KUE A;  3KLV A;  2MHN A;  4FF4 A;  3KK1 B;  4TYA A;  3ITH A;  3VGU A;  2M9K A;  4PPZ A;  2M5Y A;  4WU2 A;  3NWR A;  2DO0 A;  3ZTP A;  2HRU A;  2JJ4 D;  4WFN Q;  2U2F A;  1GEH A;  1FKO B;  1KOO A;  2DR8 A;  4UUX A;  3DFE A;  5C5J A;  2VL1 A;  1IBM F;  4OYB A;  1U1R A;  1B70 B;  2HVI A;  2O67 A;  4UF4 A;  4UZB A;  2VFT A;  1U0S A;  4M5J A;  4ES3 A;  2MHE A;  5LT5 A;  3KJF B;  1HKA A;  4GTZ A;  3SI8 A;  3HFV A;  4CI0 B;  3KKF A;  1BWE A;  3PW7 A;  1RI7 A;  2C1E B;  2H65 B;  2QC3 A;  2K7J A;  2MKC A;  4TU9 A;  2AYE A;  3I6P A;  2VG6 B;  2V69 A;  5HL7 Q;  2YNI B;  1K0T A;  4WZM A;  3IA0 A;  1HW8 A;  4C7Q A;  1PCA A;  4F3M A;  5J2P B;  3DI6 A;  3B4D A;  3O5T B;  4I1T A;  3H25 A;  4ETZ A;  2PA3 A;  3GV7 B;  4X4P A;  1FCA A;  1LXJ A;  1VI7 A;  1SKU B;  2W24 A;  3NOC A;  1QE1 A;  1KVJ A;  2XZT B;  3ET6 A;  4QOT A;  3ZZT A;  4NXN F;  3IWN C;  2DGS A;  1SQE A;  2MLZ A;  4WCE Q;  4I0W A;  1OSC A;  2CWX A;  2DNZ A;  1OY8 A;  3CCW A;  3LAM A;  2AW0 A;  4Z7Y A;  3MFI A;  1DUR A;  3BR8 A;  3D5M A;  2H1Y A;  1T3O A;  3M6W A;  5EWF A;  5HJY A;  3CW2 C;  3D1O A;  2Y8W A;  2KZM A;  1UJ5 A;  3RBD A;  3KFW X;  1R6V A;  1NK0 A;  3IR6 B;  1HPZ B;  4EO8 A;  3R27 A;  2BVZ A;  5GME A;  2GSO A;  3G71 S;  4USW A;  3Q0A A;  4AL5 A;  3BEG B;  3E2E A;  1YJU A;  1Y10 A;  3TAM A;  1S57 A;  4QYZ K;  2OD6 A;  4WE1 B;  4USJ C;  4DLG A;  4KB7 A;  2ASD A;  2CQP A;  2QV6 A;  4Y0F A;  2QLX A;  2XZW A;  5D6G A;  5ETL A;  3BO2 A;  2LEA A;  4GKK F;  4MKA A;  3DLG B;  2WOM B;  5KFM A;  4RUH A;  1JNR B;  3PO4 A;  2XNQ A;  2W5X A;  5KFS A;  2YPZ A;  1M5V C;  3OSP A;  2ADC A;  4IG3 A;  1BXN A;  4KPY A;  3H5X A;  2ZVS A;  4UOF A;  1RAF B;  3BDF A;  2G0J A;  4LF4 F;  4V19 X;  5DG7 A;  1QD1 A;  3GP9 A;  1KEK A;  2IDE A;  3V81 B;  5CZX A;  4F3O A;  3SV4 A;  1NM2 A;  1WEZ A;  4DN9 A;  3QZ7 A;  3QO9 B;  1T11 A;  3KG1 A;  4ES1 A;  1S1W B;  1RAJ A;  4O0I A;  2QLB B;  4O23 A;  2VBZ A;  2NPF A;  1RCX B;  5KFR A;  3TUJ C;  2JLF A;  1N54 B;  3DLK B;  3PRV A;  4DR3 J;  1LWF A;  3JS9 A;  3D0H E;  4K2J A;  4LSN B;  4KO0 B;  1S9E A;  1RTJ A;  4DX5 A;  1RWW B;  1Z1Z A;  1BUX A;  2QYC A;  5LSL A;  1XTZ A;  2BMB A;  3CMR A;  1FRL A;  2HGN A;  2WVD A;  2B6A A;  5C25 B;  1T9V A;  1S1T A;  5HAT A;  1W25 A;  3GFH A;  1LOU A;  5CYQ A;  3KLF A;  2BQU A;  3M8P A;  4FDF A;  2IRX A;  3N01 A;  4GVB A;  4TY8 B;  4OFZ A;  1YLX A;  1YG0 A;  4C11 A;  1MMN A;  3NS6 A;  3PAC A;  1AFJ A;  4FS2 A;  1VQ4 S;  2RIJ A;  1IWG A;  3QNW B;  3WQP A;  1H0H B;  1AYE A;  3V4I B;  2AJ2 A;  3MM7 B;  3D3B J;  2JEJ A;  4HKQ A;  3ZZP A;  1CJK B;  4KYZ A;  2OH2 A;  3K0J A;  1X4H A;  3G8S A;  1ZTT A;  1IKY B;  2YQ1 A;  2W2O P;  4FBT A;  2F4F A;  3VGS A;  3Q23 A;  1M5H A;  1JJC B;  1WKJ A;  3KG4 A;  3VAG A;  1GMW A;  3BDG B;  3AXK A;  1F9H A;  1RE1 B;  2GVZ B;  4CH1 A;  4CNY A;  3K8W A;  1TL7 B;  3W61 A;  2XMM A;  2FYX A;  2FTR A;  5HBM A;  2C2O B;  1I94 F;  5IC4 B;  1EI6 A;  5E2Q A;  4DV0 J;  5M2R A;  1WD6 A;  1TU0 B;  4IR9 A;  1HYS A;  2POK A;  4OLP A;  2G9Y A;  2FC9 A;  4DHV A;  1S1U A;  1RAE B;  4J7C A;  4ENO A;  1HMV B;  2HNY B;  3GG0 A;  3GV8 B;  8ATC B;  3G4S S;  2ZZN A;  4J9U E;  2L08 A;  4O4R A;  4OJ3 A;  4DI6 A;  2XWX A;  4F04 B;  2QL9 B;  4N56 A;  4DZD A;  3AJD A;  3MR5 A;  1HJK A;  1ALH A;  2CQ1 A;  2X3D A;  4WP3 A;  2XMU A;  1MRO B;  1IKX B;  4M5I A;  2XO7 A;  2COL A;  2D3O R;  5C7P A;  3UCG A;  3PEH A;  5LL6 d;  4P75 A;  1VJW A;  2IM2 A;  1KS2 A;  2CJ9 A;  1HNV A;  3D54 A;  4P6Q A;  2E5H A;  3TEH B;  4CP5 A;  2GGP B;  4KPC A;  4BC9 A;  1U47 A;  4DV2 J;  1R8H A;  4PWD A;  5KG0 A;  1NK5 A;  1FRK A;  4YQW A;  2R8I A;  3UDL A;  4N8N A;  2HWT A;  4RR5 A;  3M4X A;  2C3O A;  4I4B A;  1ALK A;  3T5H A;  4C6A A;  2I9S A;  1HQ2 A;  2XSF A;  3F56 A;  1T3N A;  4CLK A;  1QSL A;  1PIL A;  2ZZM A;  4FYY B;  4B9T A;  1DQA A;  4P2X A;  3B8H A;  2AF6 A;  3MFH A;  2YWH A;  3TVZ A;  1M5P C;  4YOE A;  1WDD A;  2RDD A;  3T1A A;  1KP6 A;  5J2N A;  1NK6 A;  2MZT A;  4CRJ A;  2OAU A;  3CCZ A;  1X5O A;  5KOW A;  2XCA A;  5JVG Q;  3MHY A;  3HHL B;  3OTO F;  5ETR A;  3BN7 A;  2AYB A;  1CBK A;  4OZ1 A;  1X5S A;  4DQP A;  3H40 A;  2JFD A;  2YKA A;  1RHR B;  4OZ2 A;  4ICL B;  2Y1I A;  4Z7C A;  1M5K C;  1IBM J;  3CJ2 A;  5KFE A;  4FYV B;  4DL5 A;  3R7B B;  1FT8 A;  2E1M C;  4P52 A;  3TZY A;  3WHI A;  2CG4 A;  4F02 A;  1F3F A;  5A8W A;  3I0R A;  4LJM A;  1VK3 A;  3CJ5 A;  2DNY A;  2BJE A;  5LIA A;  3C14 B;  3J81 U;  2BR0 A;  4G65 A;  1FJE B;  5DLT A;  5F8N A;  4LFA F;  3BS9 A;  2ZBC A;  4XDC A;  3AB2 B;  5LM7 E;  4YDD B;  1VYA A;  5HI7 A;  1KRP A;  3LAK A;  1Q8B A;  2YQ0 A;  4DS5 A;  5A6W A;  2E66 A;  4E98 A;  2CZ9 A;  1EET B;  1MN9 A;  1U8S A;  4NXN J;  2UUC F;  4CM2 A;  2YVS A;  3GZ7 A;  1V3S A;  2PA8 D;  4X62 F;  2ZZT A;  1G6B A;  2AJF E;  4AL7 A;  4DR7 F;  1FNX H;  2B8Q A;  1NJI T;  4KFB B;  2L9N A;  2AT1 B;  5E3Q A;  4OZN A;  1K47 A;  2VQF J;  4Y6I A;  5F41 A;  3AOD A;  2U1A A;  4QWC A;  3PVX A;  2E1R A;  3NOG A;  1HBM B;  1GH8 A;  4QU7 A;  4ID8 A;  2ATC B;  2ZUA A;  5DQH A;  1Q16 B;  4CLZ A;  1IKW A;  4P73 A;  4I6W A;  3TUZ C;  2EG1 A;  3JTO A;  4DEZ A;  4DCP B;  1EQ0 A;  4K4Z A;  3AY0 A;  4GKK J;  3PO5 A;  2FVQ A;  2EW9 A;  5B0D A;  4AUK A;  2JLE A;  3H42 A;  2B4V A;  4MIV A;  4WK1 A;  4EEY A;  5HP1 B;  3M8R A;  4YR1 A;  1MML A;  2KT3 A;  4BBY A;  1OWX A;  3QPI A;  1N5S A;  5DLV A;  3NGT A;  1FWP A;  1RWU A;  1T0T V;  2MLX A;  5ADZ A;  3NXZ A;  4NOH A;  3KLI B;  3MCS A;  3DNC A;  3FUY A;  5F9L A;  5SZT A;  2W2M P;  2B7C B;  1WC5 A;  1FKO A;  4AD6 A;  5GRR A;  2PI5 A;  3CO0 P;  2D7S A;  5CYJ A;  4YHH F;  3A3O B;  3ULH A;  4KJI A;  2RQK A;  4NXM F;  3W8G A;  4P10 A;  3BYP A;  3T6B A;  5KG4 A;  1GTE A;  4EK2 A;  5BYQ A;  4P71 A;  3KMS A;  2IM0 A;  2EFN A;  1E1Z P;  1EP4 A;  4ZVE A;  2Z30 B;  3VCD A;  4CNZ A;  4UST A;  1PG5 B;  1YBU A;  4MAK A;  3JSY A;  4YY3 J;  1O99 A;  5J2P A;  4FPR A;  1FEH A;  2DY1 A;  1XN9 A;  4M8L A;  2BRL A;  4IRC A;  2HQ3 A;  1YJT A;  4ED6 A;  4KGM A;  1HQE B;  1ELO A;  2AYG A;  4B3O A;  3T9N A;  4NLR A;  1BQM A;  2IYG A;  3R5B A;  3CC4 S;  4I6Y A;  3P49 B;  4LFC F;  2E44 A;  3A12 A;  2MQO A;  2OTJ S;  3Q8R B;  4URS A;  4FVM A;  3LW5 C;  4MFB B;  3R2D J;  2WSE C;  3V5R A;  1LWE A;  1REV A;  1TKX A;  3JYT B;  1M1H A;  2YX7 A;  1SJ3 P;  1R8B A;  2HQF A;  2XWY A;  3K5M A;  2N3L A;  3E3X A;  4TLR A;  1S0V A;  2OI2 A;  1JJ4 A;  4YR3 A;  3E2D A;  1RB0 A;  1IR0 A;  1TV6 B;  3EX7 B;  2VOP A;  2BM1 A;  4CLU A;  1RTD B;  4WE1 A;  4CYS A;  3UR0 A;  1DAR A;  5KFV A;  1Q81 T;  1XNR F;  3O44 A;  1PBA A;  2UXB F;  4NMX A;  4P2S A;  3US5 A;  3IBC B;  2GX8 A;  1XR7 A;  5F8G A;  1NJX A;  2W8K A;  1RHQ B;  3DRP A;  1RTI B;  3DLG A;  1FK9 A;  3G82 B;  4ANC A;  5KFU A;  1N5Q A;  1T02 A;  4C97 A;  1XR5 A;  1EHW A;  5BR8 J;  4KSE B;  4ED3 A;  1NKB A;  2GQC A;  2HQD A;  2OTL S;  4XPE A;  3THT A;  5JJB A;  4RUC A;  2YXL A;  3V81 A;  4ECZ A;  4U7U K;  2PMH A;  3QT5 A;  1SHQ A;  1RK8 A;  3PXG a;  2GAH C;  1B3T A;  2NR0 A;  3OXL A;  3QO9 A;  1S1W A;  1X4F A;  1BGX T;  3HDS A;  1WC4 A;  4DUZ F;  3NNC A;  3KOA A;  4ECV A;  4LIW A;  2LMI A;  1HA1 A;  2LQJ A;  4F67 A;  1REG X;  3A3P B;  1Q82 T;  1U45 A;  2V8V A;  3P8B B;  3DLK A;  2X51 A;  1Q8L A;  2YWK A;  3DM2 A;  2VQE F;  1T9Y A;  5T7L B;  4RNO A;  4NAS A;  1EKS A;  2CJB A;  3HHN B;  3SSS A;  3OVS A;  1AB8 A;  3EZU A;  3F0N A;  5D0H A;  2AP6 A;  1CC8 A;  1CJU A;  2VZ9 A;  4O0N A;  4TY8 A;  4PWU A;  1I1G A;  4F0K A;  3NLC A;  4OYM A;  2ACM A;  1L5U A;  1RT2 B;  1FXL A;  1NXI A;  2DK2 A;  2GLQ A;  2YWG A;  1VQM S;  2EKY A;  1N5T A;  2N4C A;  3HX9 A;  1SHN A;  3V4I A;  4N5S A;  3MM7 A;  4DV6 F;  1N6Q B;  3GQC A;  5DO2 A;  3GFZ A;  5F8I A;  5IC6 B;  2Q1L A;  3BGU A;  4PAB A;  4HDG A;  1N5V A;  1IKY A;  3DRR B;  2PD1 A;  5JXS A;  4ZN1 A;  4K4U A;  2YKQ A;  3EE3 A;  4N77 A;  4QWE A;  3IR7 B;  4A47 A;  1Q8K A;  3JQM A;  2KRB A;  4K5R A;  2HAF A;  2NXE A;  5IT9 Y;  2PFD A;  1CC7 A;  3GCW P;  1QAY A;  3CWJ A;  3UN2 A;  4NWJ A;  1HDH A;  1JLA B;  2K7K A;  2YQ3 A;  4LQY A;  4D3H A;  5HSP A;  1VQ6 S;  2O5D A;  2GVZ A;  4IO9 Q;  2HEK A;  2DYA A;  2HHH J;  2VG5 B;  1MWZ A;  4PAA A;  2DHS A;  2HND A;  1JWW A;  1RT5 A;  3RJM B;  5LQQ A;  2OMO A;  3NNA A;  4S0M A;  1EQM A;  1FTC A;  3BO4 A;  3MPY A;  4C0O C;  2V8G A;  4ECS A;  1HMV A;  1YRX A;  4X4O A;  3GFX A;  2DGX A;  3Q86 A;  4PEO A;  3QSY B;  1X0F A;  4ZVO B;  2XB2 D;  3MTJ A;  3AQP A;  4Q0B B;  1Z4U A;  4ZPC A;  3LAL A;  3LAN A;  4QIG A;  1CS4 B;  4MMO A;  3AD7 C;  2FVR A;  5AE2 A;  4ZMM A;  1DTQ B;  1IKV B;  5DLW A;  1IBK J;  1MRO A;  2CJY B;  3BR9 A;  2OPQ B;  2ZC4 A;  1HI1 A;  2M88 A;  3OR1 B;  2C3P A;  2CPE A;  2ALY B;  1NK4 A;  1LW0 B;  1CSJ A;  4QCL A;  1SH3 A;  1PJ5 A;  3EGZ A;  4X4V A;  2C28 A;  4IFY A;  5I3U B;  2WON B;  5DZ6 A;  1SBR A;  4J9N A;  5CD4 H;  4X4U A;  2BAN B;  1KDN A;  1YJR A;  1GMW D;  2LEP A;  2D1C A;  2JZ5 A;  3FVY A;  1YWX A;  2QFI A;  3CUL A;  3TA1 A;  1X9W A;  1B64 A;  2VFU A;  1OIA A;  1Y5L B;  4K4Y A;  4GVL A;  1SVD A;  1FFW B;  1HFE L;  5KG5 A;  5DGA A;  4NCG B;  3MCM A;  3GJQ B;  4ILR A;  1TMJ A;  1D9D A;  4DV1 J;  2DNO A;  2ZH3 A;  1S0O A;  2KHC A;  5KG6 A;  2B4P A;  4F4W A;  1RLD A;  4KGZ B;  2HFZ A;  4H4K A;  1UPP A;  1JB0 C;  1RTH A;  5L0K A;  3HHD A;  2DCL A;  4PXB A;  4C8K A;  1SJ1 A;  4JI1 J;  5K14 A;  4YHH J;  4MKY A;  4FBU A;  1QY7 A;  4PWW A;  3G8Q A;  4WKY A;  1P1L A;  2EKN A;  5T41 A;  2BX6 A;  1JLB B;  3KLG A;  2GHP A;  2N7Y A;  3KK2 B;  2IMO A;  3WC0 A;  3C14 A;  3W62 A;  2L48 A;  1RT7 B;  3QIP B;  1NK8 A;  4R0E A;  5JVH Q;  4NL5 A;  3RW7 A;  3TJ9 A;  2E9Z A;  3DU5 A;  4NLW A;  4DUY F;  4OQJ A;  5DRK A;  3B54 A;  5MAO A;  1IWA A;  4J37 A;  4B17 A;  1U7L A;  1PYT A;  4Y28 C;  1TK0 A;  3EDR B;  3G96 A;  2HVD A;  2OEM A;  1RT3 B;  3D4J A;  5A0Y B;  3T01 A;  1YJV A;  5KFA A;  1E3C P;  4EBD A;  3U02 A;  2HBR B;  1T03 A;  3KHL A;  4XTT A;  1RT4 B;  2H3E B;  4N41 A;  2R2T A;  1D8Y A;  2C2N A;  2EXU A;  1R43 A;  2DIU A;  1ZM2 A;  2M7S A;  1YGY A;  3C15 B;  5C66 A;  2M0G B;  5AE1 A;  1GK8 A;  4K50 A;  2R7V A;  5HN0 A;  1HBM A;  2XYG B;  3Q2T C;  3IWL A;  3WC2 A;  4EYH B;  3PR4 A;  3TA2 A;  3T02 A;  4FF3 A;  2M4M A;  1F5B A;  3I87 A;  2UXB J;  3RW6 A;  3H2L A;  3ILO A;  4NLS A;  2IVF B;  1YQH A;  4DSE A;  2ZH4 A;  2OPR A;  4ZLP A;  1TVR B;  1U26 A;  1O51 A;  4A46 A;  2DGU A;  1W2I A;  4B56 A;  2YNG A;  4YB7 A;  1RWK B;  4Y2M A;  4U96 A;  4GRS A;  2FJA B;  4CXS A;  3TAR A;  5I3P A;  3QRP A;  1KQS R;  2NXU A;  2V4J B;  4DQS A;  4LF9 J;  2WB4 A;  4YR2 A;  3OTB A;  1G3O A;  2D69 A;  4HI2 A;  4QU6 A;  4EFA C;  4IQX A;  5IWA F;  1LWC A;  3KLI A;  3G2X A;  2IFX A;  2HRT A;  2W5W A;  3CJ8 A;  1S12 A;  2W4P A;  4MIA A;  4O44 B;  3B6B A;  3MI7 X;  2OML A;  4LF1 A;  3FZ2 A;  5KG2 A;  4MKV A;  3FRZ A;  1JLE B;  3V6D B;  2CAD A;  1Q79 A;  2A6M A;  3KNA A;  8RUC A;  3ENQ A;  3FRY A;  1PIE A;  2CAJ A;  5F8H A;  4N8O A;  2WW8 A;  2UXC F;  1VRT B;  3HKZ D;  1UZD A;  3L7U A;  2G0I A;  1U0H B;  3M2R A;  4X65 J;  2ZDP A;  2MJN A;  3AOA A;  2DRB A;  2R7T A;  2NXN A;  1Q5Y A;  2H54 B;  2V9W A;  1D1U A;  4DU7 A;  2HHS A;  3IGY B;  1V3R A;  4I2P A;  4LF8 J;  1URB A;  4A8W A;  3HFZ B;  2NPI A;  3ED4 A;  1FER A;  1YZ6 A;  4CLP A;  4CYU B;  4FPI A;  3OUY B;  3SV3 A;  4RNM A;  4TYB A;  1T05 B;  2OSR A;  3E8O A;  4DR2 F;  4LT6 A;  2XZD B;  2VUG A;  2KJW A;  5HMZ A;  4HHU A;  1HQU B;  5JUM A;  3VTI A;  2XEX A;  1HR0 F;  1S76 D;  4QQB A;  4M94 A;  1R0A A;  3PFO A;  4QIE A;  4FS1 A;  2BW2 A;  1XMO J;  3A1Y G;  3KLH A;  3RB6 A;  4Z37 A;  2PDA A;  2RDJ A;  4F2S A;  1KKH A;  2FHJ D;  1KBR A;  2ZFH A;  3P5B P;  5KTQ A;  4O3P A;  4MFB A;  2ZBR A;  2CJX B;  3JYT A;  4F4A A;  4J9R A;  1RBO B;  1RKI A;  2P2C B;  4B3M F;  2HMI B;  1KLM A;  3GJS B;  4HTI A;  4DPO A;  5AJ3 F;  1WI6 A;  3A3N B;  3NS7 B;  4LMZ A;  2EBE A;  3OHB A;  3I4H X;  4LRA A;  4QPT A;  1S0N A;  3OT9 A;  2KT5 A;  5A8R B;  1MU2 A;  3ZZY A;  2CZV C;  2IRU A;  4ECY A;  4G3I A;  4MIW A;  1QUV A;  4DDF A;  3FNN A;  2HHV A;  1OPZ A;  1X4E A;  3BGO P;  3ENA A;  1K1S A;  4F26 A;  1Z2L A;  3BKU A;  2OPP B;  3GYX B;  3MM8 B;  1J5E F;  2YH0 A;  1T95 A;  3T1Y J;  1ED9 A;  1MSW D;  2N3O A;  2FHK A;  2V2Q A;  3QAE A;  5EX3 A;  5KOX A;  3VGV A;  1N36 F;  4AE5 A;  1X31 C;  1PGZ A;  2ADB A;  6FD1 A;  3QZ8 A;  4A8Y A;  2BUN A;  1SQG A;  2V9K A;  4JI5 F;  4X4R A;  3UD4 P;  4Y2A A;  2DNN A;  1FF2 A;  2QRR A;  4DR1 J;  3GPA A;  3OR2 B;  5C42 B;  1EAY C;  1KHV A;  1RCO B;  5KFL A;  3FQK A;  1VBK A;  5HRO A;  2W2N P;  1WTF A;  3KHG A;  4XAK A;  2FD2 A;  2CQB A;  1SIW B;  3PX0 A;  1UKU A;  3KHH A;  1P1T A;  3CCL S;  4ED2 A;  2ZHO A;  2LEB A;  2NYI A;  4LRC A;  4K0K J;  1N33 F;  3EJM A;  2OHD A;  3MTK A;  5H1S V;  1KHN A;  5T7L A;  2GIF A;  4EI2 A;  3OFF A;  4L73 A;  1AUK A;  4X2B A;  2J9D A;  2IM3 A;  1S1X A;  4RW8 B;  4DSF A;  3R8Y A;  4LF7 F;  2DNG A;  2MQM A;  1OSD A;  2AZ1 A;  4K4T A;  3QT8 A;  5JMN A;  1AZS B;  5DDQ C;  4NEY A;  3FQL A;  3WBZ A;  3SYZ A;  1ZA2 B;  2GZO A;  1NZ8 A;  2XHC A;  4J9Q A;  2CQ2 A;  1YI2 S;  3VQT A;  4FDJ A;  4OYO A;  5F8M A;  3RAQ A;  1SH0 A;  3UDV A;  2VDH A;  1HBN B;  2E9R X;  3WAX A;  2FVC A;  2YBV A;  4CM0 A;  2ZKU A;  2W9C A;  4KC5 A;  4NLD A;  3GE9 A;  5G4D A;  1N6Q A;  2JFK A;  3K5N A;  4RBV A;  4DV7 F;  3AQO A;  1I3O B;  4ZLJ A;  3WAV A;  1MN7 A;  2MYF A;  3SZZ A;  3DRR A;  2H5J B;  1FX2 A;  1WNE A;  5IJQ A;  1X4D A;  4NLU A;  4GC6 A;  1D9F A;  3R6G B;  4PXE A;  5D3G B;  4CYR A;  1ICE B;  2DHG A;  1HHS A;  2IDL A;  3W2W A;  3L9Z A;  4N76 A;  4DV5 J;  3JAM U;  2AEF A;  5EX0 A;  4DL6 A;  5I42 B;  2I8E A;  3W64 A;  1FDA A;  2E5G A;  1NHK L;  4ETX A;  1MG7 A;  5J1N A;  2EG2 A;  3GCX P;  4LBI A;  2HGL A;  3NCQ A;  1JLG B;  1N0U A;  2H9Z A;  5KFT A;  5ETP A;  2FQQ B;  4YB1 P;  1NJY A;  2R8K A;  2QA2 A;  2VBX A;  1ZAV A;  4ZKA A;  3PYG A;  3VHQ A;  2FLL A;  2YTC A;  2I38 A;  5B0E A;  2KM8 C;  5ETK A;  2Z2Y B;  4K2X A;  5DM7 Q;  2B7B B;  2AJ0 A;  2ZE2 B;  4ED8 A;  1ZH5 A;  2XCP A;  1CS4 A;  3FC9 A;  3O1L A;  1RAC B;  4I56 A;  2W9A A;  3OXG A;  1IKV A;  1NJW A;  1AFI A;  3E01 B;  4B3R J;  1VRQ C;  1W2B R;  1NME B;  1KH5 A;  1QAX A;  2IPO B;  2FJD B;  3OR1 A;  5AJ9 A;  2XGQ A;  4B9M A;  1E6Y B;  2RH3 A;  3T1H F;  3ILI A;  5L46 A;  1FHT A;  4DZ6 A;  2Z58 B;  2YKN B;  2BJD A;  5CHC B;  3EZ5 A;  5I3U A;  1FE4 A;  2FLN A;  1R27 B;  3ITH B;  2BAN A;  2BE2 A;  2HK3 A;  3GJT B;  1U2F A;  2NUU G;  3QGP A;  4LBH A;  5KFW A;  4KTQ A;  1EZZ B;  2DXE A;  4G1I A;  2VG7 A;  3RGI A;  5F0U A;  4YN3 B;  5E33 A;  1RBL A;  2DNR A;  1BWV A;  1TR0 A;  2IFY A;  2ZH5 A;  4OYI A;  4RUA A;  4KGV B;  4DCO B;  2RQ4 A;  2AJQ A;  3K89 A;  2LDI A;  2WVC A;  2SXL A;  1HWL A;  4NEZ A;  2OGU A;  5BYS A;  2GC8 A;  2HUR A;  3QGI A;  3ZTO A;  5IWA J;  4QW8 A;  1ZOT A;  5KT6 A;  3M8Q B;  3G8T A;  2LU2 A;  3CJK A;  4KM4 A;  3TO8 A;  2XMA A;  2BXJ A;  3JSB A;  1Q8I A;  3AHP A;  1WEL A;  1BY9 A;  3M30 A;  4GTX A;  2GA7 A;  3AXM A;  2UZA A;  5BXI A;  4JYA J;  3QFH A;  1YSJ A;  3HSG A;  1FNO A;  3A8J A;  2W8S A;  3GYN A;  3GR0 A;  1F6T A;  1NSQ A;  2HFV A;  2VPX B;  1ED8 A;  3UN5 A;  2UXC J;  4G6V B;  5IQ6 A;  4C3K A;  1JLB A;  5BJR A;  2W5T A;  2JDJ A;  3KK2 A;  2KH9 A;  3SZ2 A;  3GB0 A;  1R7I A;  1L3V A;  4WXW A;  3JAM Y;  3RBZ A;  3GU0 A;  2CQ0 A;  4ZP8 A;  1RT7 A;  2JLG A;  2YNF A;  4FNH A;  3QIP A;  1VQY A;  3NGK A;  1NJZ A;  1NZA A;  2ILY A;  4NYZ A;  3ZTS A;  4NYO A;  1F2H A;  3BKT A;  1NDK A;  1ZPW X;  2YWF A;  4FN5 A;  3L7P A;  3TAM B;  2PEH A;  1Q7L B;  2QG9 B;  3RB3 A;  2UUB J;  1HR0 J;  3TEG A;  5H9E K;  1XMQ J;  4PPD A;  1RT3 A;  5A0Y A;  1E2S P;  4HEA 9;  1NRK A;  2HW3 A;  1Q53 A;  1RT4 A;  3DXS X;  1YBA A;  4CCH A;  4ELT A;  4ZA1 A;  4OYW A;  3Q22 A;  1SPB P;  4C8N A;  3TNV A;  2ZWP A;  1FRX A;  3C15 A;  4RUB A;  3HSJ A;  3SFG A;  5A2Q U;  2GVD A;  1K1Q A;  2CRL A;  3GSI A;  3MR6 A;  2ZH8 A;  3WAY A;  1V6H A;  3T5L A;  4KKO B;  1ANI A;  3VGT A;  2IA0 A;  4O3N A;  4L76 A;  4TQR A;  2P9C A;  2V8P A;  3GG1 A;  1NUE A;  2UUW A;  3FK4 A;  2R7Q A;  5CYM B;  1B7F A;  2F1F A;  2HQC A;  2HVE A;  1RAI B;  2MKS A;  3RRK A;  1UEU A;  3KJN B;  3I5A A;  4IOA Q;  2BAC A;  1PKU A;  1LFW A;  2MZS A;  3BQ1 A;  1S9E B;  2MSS A;  1J2V A;  2W1B A;  1WJ9 A;  4F2R A;  2DHH A;  4OIX A;  1S1T B;  4O44 A;  2XY5 A;  4JI5 J;  1S6Q B;  4ZVQ B;  4DOZ A;  3OV7 A;  1Y0H A;  3M8P B;  2LXI A;  4J91 A;  2ROE A;  2KVQ E;  1JLE A;  1AJB A;  5GAD I;  2L41 A;  2G2Z A;  2J6T A;  3MK1 A;  3R1L A;  3OJU A;  3CNQ P;  3J81 j;  3ZTQ A;  3DYC A;  2V94 A;  1S1V B;  1TKZ A;  3RB4 A;  1U0H A;  3EMT A;  2VPW B;  4IUF A;  3TG0 A;  4A8K A;  2YNH A;  1KH9 A;  3NAI A;  1YK9 A;  1Q0N A;  3D7S B;  5I4M A;  1DQ8 A;  2ROG A;  4KAV A;  1NSP A;  4DX8 H;  3K57 A;  5CZV A;  3IN5 A;  4B3T F;  3CJ4 A;  1FO1 A;  3IRW P;  3NKO A;  4DL7 A;  3CCE S;  1C0U A;  1HWI A;  3QJL A;  1ZPV A;  1ULR A;  2IBO A;  4ZG7 A;  2J0X A;  1RWN B;  1ZEB A;  4GO7 X;  4MK8 A;  1PJ6 A;  2VKZ G;  5ETO A;  2LDY A;  1S72 S;  3NMR A;  2IYI A;  1KVK A;  5LMN J;  1Y5N B;  2MPU A;  5FDL B;  5HBM B;  1CQN A;  5CCL A;  1UP1 A;  2W5Q A;  3OVA A;  2IJR A;  3TRG A;  1CG2 A;  3R5A A;  2E9T A;  4OYA A;  4DV7 J;  2CUY A;  1HYS B;  1EIY B;  2B8P A;  1S1U B;  4EO6 A;  3KTQ A;  2XSJ B;  5K8P A;  2HMI A;  4Y2I A;  2CPJ A;  5L9X A;  2KI2 A;  1DBD A;  2LA4 A;  5HRT A;  5A6P A;  3IM8 A;  4NWB A;  2RKI A;  4WJB A;  1A7G E;  4CLY A;  1NPP A;  4FKY A;  5A8R A;  3KMQ A;  1V5I B;  3BBB A;  1DY3 A;  2J9E A;  3TQE A;  3HO1 A;  2AQ4 A;  2G9O A;  1M90 T;  4QJV A;  1RTZ A;  4C48 A;  1WEY A;  3GIL A;  2D3Z A;  1HNV B;  1GX5 A;  1GT8 A;  2DGQ A;  2XI2 A;  1TQL A;  4PWD B;  4DPT A;  2J9C A;  3LPY A;  3DYA A;  4DR3 F;  2QLJ B;  4FZV A;  2UXD J;  2CG8 A;  5D4L A;  2DR7 A;  3MPD A;  2C42 A;  3NRB A;  1RAA B;  3CVK A;  3I56 S;  1KR4 A;  3BF4 A;  3SFU A;  5ETV A;  3UD3 P;  2WVF A;  3P96 A;  1J27 A;  1UPM B;  4J90 A;  4KHP J;  3OR2 A;  3C2P A;  4PRF A;  3CJQ A;  4M5L A;  2VH7 A;  2QN6 B;  3T1H J;  1ACM B;  5J2N B;  1N52 B;  2HKE A;  4JB8 B;  1YIT S;  2XS7 A;  2BV3 A;  2WVB A;  2QFJ A;  4NRU A;  3TVY A;  2DPJ A;  5GAE I;  2OFH X;  2EC2 A;  3TX0 A;  3KJV B;  2MMY A;  1B99 A;  4JI0 J;  2HIQ A;  3CXC R;  2IC3 B;  2J7U A;  3VAI A;  1SKW A;  1UZH A;  2HHP A;  4BHQ A;  3CCR S;  2K06 A;  1R8P A;  4KE5 A;  1IM4 A;  3AOC A;  4PYA A;  4Q45 A;  3OTC A;  4RW8 A;  2DPI A;  2RUS A;  2LXF A;  1M5O C;  1NLK L;  2QMU B;  3FBB A;  3C46 A;  2VD3 A;  4JI6 F;  5A8W B;  1V5V A;  5KFO A;  2OIH A;  1X4C A;  1R6Y A;  4PG7 A;  3LP0 B;  3NEK A;  4YEA A;  1HNI B;  3CCM S;  2QZ8 A;  4B9L A;  2HVH A;  4LUB A;  5D0R A;  3HMJ G;  1HBN A;  3UVJ B;  4KGK A;  4DV0 F;  3PYE A;  4OYZ A;  4WTO B;  3MMC A;  2YY3 A;  4P72 A;  2XS2 A;  4ZLL A;  2W9B B;  3RYL A;  2FPH X;  3PV8 A;  4R5P B;  4IYQ A;  3MR7 A;  3UD5 A;  4JV1 A;  1EW9 A;  1FFS B;  5D3G A;  3M6U A;  5HQ8 A;  3MR3 A;  1EW2 A;  2Y0S D;  3G9C A;  4HYK A;  1M1G A;  5I42 A;  2JEI A;  1LK7 A;  2GNK A;  1NSA A;  1JLG A;  4B9N A;  3CMA S;  4DS4 A;  1D9A A;  1VDH A;  2RDI A;  1HI8 A;  2BRK A;  2EFV A;  5E3C A;  3M9O B;  3OLB A;  3UQS A;  2AWZ A;  4PXC A;  1KSP A;  2R7R A;  2DNH A;  4DV2 F;  3CPW R;  2JNJ A;  3F44 A;  1IKW B;  1C1C A;  2ZJP Q;  2NUH A;  2FVS A;  2ZE2 A;  2Z57 B;  2J9D E;  1UW9 A;  4O4G A;  1S48 A;  4WF9 Q;  1LEO A;  2O3D A;  5CA5 A;  2KXF A;  4M5D A;  3IAS 9;  1JLC A;  3U1M A;  4DMZ A;  4LR2 A;  5CAB A;  5MLC V;  2Q3P A;  2I6W A;  2D9O A;  4DV4 J;  5D0E A;  1EX8 A;  2NCK L;  5KFC A;  2IMW P;  2PSZ A;  4AFF A;  3H98 A;  4Y2K A;  5LMU F;  1KQG B;  3NGU A;  1KHJ A;  3ONQ A;  4Q43 A;  3GIJ A;  4K7Q A;  2ZOM A;  3VAM A;  1TEL A;  3DOL A;  2R7X A;  1LK5 A;  2RRA A;  2BM0 A;  3T00 A;  1VQ8 S;  4F0H A;  1QSY A;  5CXT A;  3M1V B;  2R8G A;  1X7V A;  1YJ7 A;  1O6X A;  3ZNJ 1;  1N2L A;  4UOC A;  4UPH A;  5EHH A;  4QZV B;  1U09 A;  1SC3 B;  3AA8 A;  3LPE A;  1HNZ F;  4ED1 A;  3HZG A;  2BDP A;  2RVJ A;  4UZC A;  4ZIW A;  2V8H A;  2AKW B;  3A8E A;  4LIR A;  2R3V A;  1CEZ A;  4U7U D;  4EBC A;  3FEX B;  3M8Q A;  2RS2 A;  1EP4 B;  2KO1 A;  5HQM A;  1VRU A;  3BGL A;  1Q7Y T;  1AJD A;  4QWD A;  1K0V A;  2OD4 A;  1S4E A;  2B5J B;  4I2Q A;  5E3P A;  1HWU A;  2JVR A;  2G1H A;  4ZGA A;  3TW0 A;  1GAO A;  2ZVI A;  5M2U A;  1BQX A;  4GTY A;  4B3O B;  1BQM B;  2NYH A;  1CPZ A;  1UFK A;  4OHZ A;  2VDI A;  2BJ9 A;  4LR7 A;  5KXA A;  4M5N A;  1PSD A;  4G1Q B;  5K9F A;  1ANJ A;  3WAW A;  2DHX A;  4ED4 A;  3PW4 A;  4OX8 A;  2OLW A;  4TU7 A;  4UW2 A;  2W7P A;  3MED B;  3DGP A;  4B3T J;  1LWE B;  1REV B;  1TKX B;  3K5O A;  1WOR A;  2GMH A;  2DO4 A;  5DQI A;  3D28 A;  3I31 A;  3EDQ B;  2VQF F;  2J0W A;  4LSZ B;  3M2V B;  1JK9 B;  4BWM A;  2YKO A;  2CIM A;  5IOL A;  1H7W A;  2HG4 A;  4MIB A;  3S01 A;  1UEK A;  2RQC A;  2FVP A;  5EN1 A;  1Q4R A;  3TX8 A;  2HLT A;  3Q83 A;  1EB0 A;  4F4Z A;  1B0P A;  1S6P A;  3TJ8 A;  4PG4 A;  1N32 F;  4LFB J;  2UU9 J;  4JV5 J;  4F3Q A;  4LQ9 A;  3DRP B;  1CJT B;  4O3R A;  1FK9 B;  3KD8 A;  4ZJO A;  4ER8 A;  1X5P A;  3N5F A;  3QGG A;  4O3O A;  4RWX A;  4DSI A;  5ETS A;  2ZEJ A;  3PTW A;  1URN A;  1B7Y B;  4OZL A;  2NRE A;  1YBT A;  2CXE A;  5A8K A;  2V2V A;  1U6B A;  3A13 A;  2V2Z A;  2J76 E;  3N28 A;  2MST A;  3D6M B;  5EGH A;  4KKO A;  2CNN B;  1NSK L;  3M6V A;  2NS1 B;  1RZM A;  2XS5 A;  1FRM A;  1TL3 B;  1VQ7 S;  1ZM3 A;  2HZV A;  2XBP A;  1TUW A;  3GJR B;  2F63 A;  4J9S A;  5CYM A;  4QW9 A;  5KFP A;  4MJK A;  2MZJ A;  3GFY A;  3HLU A;  1OO0 B;  4RZR A;  2RRB A;  3DM2 B;  3HK2 A;  2E1P A;  4YFU A;  2HBQ B;  1VC5 A;  3BZQ A;  1JXL A;  2B9W A;  3HM9 A;  2CFX A;  2HWH A;  1N4L A;  5B0F A;  2CQ4 A;  1B0T A;  1FXD A;  2I5J B;  4NCB A;  3BYR A;  4USU A;  4PUO B;  1H2V Z;  4CO5 A;  1YJ9 S;  1CJU B;  1S6Q A;  3T5J A;  3R1H A;  4L6V 3;  3C19 A;  4YY3 F;  1KHW A;  4UY8 5;  3H2U B;  1CQM A;  1X4A A;  3HI9 A;  1KQK A;  1U1Q A;  4LF6 J;  1LFP A;  5K8N A;  2RIL A;  4WII A;  1S1V A;  1G1X A;  2RU3 A;  4WKR A;  1X9M A;  3ISN C;  4ED7 A;  3KNG A;  3FGV A;  3H59 A;  5LXY A;  4ATN A;  4KT0 C;  2B9X A;  2KB2 A;  2JEG A;  3KDO A;  4WP8 A;  2X1B A;  3K59 A;  2E7W A;  1HAR A;  4ZVG A;  4DL4 A;  2P6T A;  5KFQ A;  3EVM A;  2RE1 A;  5J1E A;  1C0T A;  4HT7 A;  4WFB Q;  2XI3 A;  3PEJ A;  3CIZ A;  4JI6 J;  1WOO A;  1XC9 A;  5L8R C;  4TKT A;  2DGV A;  1GXL A;  3W9I A;  3QT7 A;  2LXU A;  2AZ3 A;  3CDU A;  4DR5 J;  3P5T L;  3FJ2 A;  2HND B;  1KLN A;  5FDL A;  4N7T A;  1RT5 B;  5F3Z A;  2GQQ A;  1VJQ A;  1MW7 A;  3ETM A;  3VQS A;  5B09 A;  2DBB A;  5BR8 F;  2XSJ A;  1RU2 A;  2VFR A;  4IOB A;  2MXY A;  1DLO B;  2IVM A;  2JWN A;  4OHY A;  3H20 A;  5CCM A;  4F50 A;  2AHO B;  2Z0G A;  3M8Y A;  5HMX A;  2EWH A;  2Q66 A;  4OI3 A;  2NZC A;  4DCJ B;  4LBP A;  4X4S A;  1R89 A;  3PW0 A;  5LRM A;  4P74 A;  5A76 A;  2BOP A;  2Q43 A;  3PHE A;  4Q8E A;  1MWQ A;  4YP3 A;  1NHU A;  3Q2S C;  4WIQ A;  3CTR A;  5KFN A;  2Q6C A;  2BAB A;  2Q6B A;  4UOO A;  3KJQ B;  3OTD A;  4AXI A;  2FZK B;  4R8U B;  5HJX A;  1GFW B;  1RT1 A;  4I7F A;  4NLQ A;  3DHX A;  2HNZ B;  4CLS A;  3ZZZ A;  4K8R A;  5KT7 A;  3DMJ B;  4OI1 A;  1XIQ A;  1BE4 A;  4IFY B;  1FD8 A;  5CAA A;  2WHO A;  3ZC4 A;  3EM1 A;  2ZC3 A;  4TY9 A;  3DLH A;  2XLK A;  3FFI A;  4NA2 A;  2HFS A;  4DG1 B;  3SMZ A;  1D09 B;  1T9X A;  2F9J A;  3UPF A;  2CA9 A;  1K44 A;  3MEG B;  2HZA A;  4YS2 A;  2LCW A;  2V8D A;  4ECT A;  1S49 A;  2GJI A;  5GAH U;  2MQN A;  1DZ5 A;  1DTT B;  2CPF A;  1TAU A;  3UCZ P;  4W4M A;  3SDE A;  3UDC A;  1VQS A;  3A8I A;  1KTQ A;  1VGY A;  1WG4 A;  1SL1 A;  1YVF A;  3R5G A;  4AXJ A;  2IAJ B;  4UOR A;  5LMU J;  2FY1 A;  1SXL A;  3JTN A;  2DH8 A;  3HT0 A;  3KJV A;  2ZDO A;  1N48 A;  4DV3 J;  4UQT A;  2IC3 A;  4AQY J;  3PM9 A;  1T8E A;  1UFW A;  4ZJQ A;  2FUG 9;  1RTH B;  2DT9 A;  1KC8 T;  3D0G E;  4CIO A;  1KN6 A;  3CMQ A;  4WPA A;  5K14 B;  3IRX B;  4HAC A;  4KJG A;  3HVW A;  2MDA A;  3NKP A;  3A8K A;  1Q1K A;  2AJ1 A;  1OS5 A;  1VK8 A;  3O2I A;  4CH7 A;  3KLG B;  1VQ9 S;  4DBQ A;  1HNZ J;  4PKD B;  1X8D A;  1TKD A;  3LP0 A;  2WTF A;  1SB6 A;  5ITH A;  2HHH F;  1HNI A;  5H9F K;  1Y3J A;  4K5S A;  3JB9 k;  4LRF A;  1VOM A;  3UVJ A;  2W25 A;  3UDE A;  1FES A;  7FDR A;  5HLF A;  2W7O A;  2NXC A;  5KT5 A;  1PO6 A;  2W9B A;  1ZYQ A;  1M5S A;  3BDE A;  1JXV A;  2QA1 A;  4K59 A;  2DVI A;  1DAX A;  3SXL A;  5LSR A;  4R5P A;  3G6X A;  4HI1 A;  4JUZ A;  4OHV A;  5E7O B;  4DF8 A;  1OQ3 A;  3HVA A;  2E5J A;  1VHF A;  1EJJ A;  4OI2 A;  2KRR A;  4LVN P;  3N0V A;  3T6J A;  2GO9 A;  1EW8 A;  1T03 B;  3UFC X;  2CQC A;  1IBK F;  5B0C A;  3RTV A;  3QYY A;  4B9V A;  1RQ0 A;  1S5Z A;  4F4Y A;  2AEM A;  3GR1 A;  1VLY A;  4NLV A;  2QYG A;  4YDX A;  3MPW A;  4OYX A;  3B5Q A;  3SZY A;  5DET A;  4ECX A;  5INH A;  2KDO A;  2IHR 1;  4QIW D;  3MDF A;  3B78 A;  1NDL A;  2VPZ B;  3BH7 B;  4IH7 A;  3R7S B;  4R0J A;  4MY4 A;  2A6O A;  2WSF C;  4ED5 A;  1UWA A;  4FYD A;  5B08 A;  3RUB L;  4U6P A;  1EAR A;  3HJF A;  4HHJ A;  1FRH A;  2B3T B;  4OMF G;  1N32 J;  2MB0 B;  2WB1 D;  2OPR B;  4UUW A;  2H51 B;  5C2C A;  1AT1 B;  1VHI A;  3HSZ A;  4N47 A;  1TMM A;  2OFG X;  2DNM A;  2LVW A;  2YNG B;  3MK0 A;  3SEO A;  4DL3 A;  2R9L A;  1VQP S;  5FD1 A;  2FJB B;  2RT3 A;  3KUG A;  3HT3 A;  4DV1 F;  3BDH A;  2ZKT A;  3SIP B;  2F9D A;  4ZVH A;  2HGM A;  4ZG9 A;  1LWC B;  1ELZ A;  4I6A A;  3KXD A;  2FHJ A;  4ZVR B;  2O01 C;  3SCL E;  4DFM A;  3PKY A;  2DH7 A;  3ENW A;  2UVR A;  3CDB A;  1NAQ A;  1L3U A;  4KHM A;  5C24 A;  2DXD A;  5KFZ A;  6FDR A;  3C6T A;  4JI1 F;  2NSC A;  3M1V A;  3DN9 A;  1S97 A;  4NZ6 A;  3H90 A;  3MF5 A;  1NPR A;  3I4P A;  3W9J A;  3M2R B;  4CT9 A;  4R25 A;  1UVJ A;  4OZJ A;  1Y00 A;  1C2P A;  4ZPD A;  4RW6 A;  3AFG A;  1H73 A;  4F4K A;  5E5N A;  4J9M A;  3BQ0 A;  2HHW A;  2CPI A;  2E5I A;  4HVZ A;  3BN4 A;  4JV2 A;  3CDW A;  1TL1 B;  1ZAX A;  1QVF R;  1FWK A;  4I2P B;  3K7R A;  4WFZ A;  4U8V A;  3MM9 B;  5KFH A;  3T9Z A;  2B5J A;  1NH7 A;  1U1P A;  2LEC A;  3UN3 A;  3X1L B;  3TYT A;  2GMJ A;  4H54 A;  2QTW A;  3S6E A;  2W2P P;  3NGS A;  2A2D A;  2X1A A;  2VBY A;  1IVZ A;  2MJU A;  4FKX A;  4B9U A;  1VS3 A;  2B51 A;  1R0A B;  1TKT B;  1LQ9 A;  4X66 J;  4G1Q A;  3KLH B;  3TP2 A;  2K1R B;  3I0S A;  4EWT A;  2HQI A;  3BSN A;  3C66 A;  2JRS A;  5L0B A;  4LF2 A;  3MAA B;  4CXU A;  3MED A;  2GSU A;  1O5J A;  1SL0 A;  2MKJ A;  2MKH A;  4F4X A;  3KYL A;  4ZIT A;  4WYL A;  3OVB A;  2GJ2 A;  1KLM B;  5LXR A;  5IT9 U;  3BKF A;  5M2P A;  1RHJ B;  3M2V A;  4E2F B;  3Q8U A;  3IGV A;  4TU8 A;  4MH8 A;  3T5K A;  3C3L A;  1L3T A;  1O98 A;  5L0E A;  1MU2 B;  2J6U A;  2CYY A;  3AD8 C;  4JBC A;  4Z2X A;  3MR2 A;  3F41 A;  3TWZ A;  3MAQ A;  1YRT A;  1CJT A;  2WRM A;  3P3D A;  5AE3 A;  3M8W A;  4QIF A;  5K5M A;  4FVC A;  1R31 A;  2XTJ P;  1UJ4 A;  4ALZ A;  3Q8Y A;  2FHO B;  3WX4 A;  2F5G A;  4LF9 F;  2P9E A;  2GQ2 A;  1S77 D;  3K17 A;  2P9G A;  3A4T A;  4CO3 A;  7AT1 B;  2FHM A;  2CQH A;  4DXL A;  2Y1J A;  4QYR A;  2HSE B;  2G1D A;  4ZDN A;  1FA0 A;  1I51 B;  1XMB A;  1XWL A;  2VPY B;  3NGD A;  1TL3 A;  1ZZF A;  5HRO B;  1RA7 A;  1U1K A;  4IO1 A;  3VF0 B;  4ZVF A;  1S7H A;  1NEE A;  4NLT A;  4ZP6 A;  1HWJ A;  2E5L J;  3M7V A;  4FNI A;  1V3Z A;  2OKQ A;  2D9P A;  4U7C A;  4X65 F;  1UJ6 A;  2CPH A;  2R4F A;  4H4O B;  1BQN A;  3N6N A;  2ANH A;  3DC2 A;  1ZED A;  3G87 A;  4ZJL A;  4V19 J;  3RBX A;  1OPI A;  2E7V A;  1S1X B;  2I5J A;  4JI4 J;  3QFW A;  2HHX A;  4LF8 F;  4PUO A;  2IIH A;  3DRS A;  1H2U X;  3IG1 B;  4A8M P;  3BM7 A;  1GMU A;  2XLJ A;  1PYO B;  4KAI A;  1WOS A;  3ILJ A;  5D77 A;  5F8L A;  4UT4 A;  1RWP B;  2UUA J;  3FSX A;  1Z2Z A;  2I2Y A;  1QUP A;  1TAQ A;  3CC7 S;  1XMO F;  3DCA A;  1R8C A;  2W9C B;  3N6M A;  4WWS A;  3NCP A;  1XEZ A;  2EBG A;  2CQG A;  3CO9 A;  2HVZ A;  3DDI A;  4DFJ A;  2IY5 B;  1YRU A;  4MKB A;  1ZTW A;  3G86 A;  3JTP A;  2PMW A;  5L1J A;  4OYP A;  4FXW A;  3FBF A;  2DEJ A;  4Y3C A;  4XPC A;  2ZH6 A;  5KFY A;  2HFO A;  3RU0 A;  2PE8 A;  1ZZN A;  1E6V A;  2CJA A;  2PN6 A;  4CT8 A;  2DNP A;  3W2W B;  2WCX A;  3GYG A;  1RGV A;  3IBW A;  1F0X A;  1RAG B;  2QJ3 A;  2DNQ A;  2KJV A;  2DH9 A;  2AD9 A;  5E3A A;  1J5O B;  4MT1 A;  3VR1 A;  2GHV C;  4USM A;  3FCV A;  4LF5 J;  3BBF A;  1S99 A;  3C6U A;  3RR8 A;  2YKM B;  1RLC L;  1FX4 A;  3NKM A;  1P9Y A;  3CT9 A;  2Y1R I;  1YZ7 A;  1ELY A;  4M95 A;  4FYX B;  3T1Y F;  1FD2 A;  1DLO A;  1AJC A;  4QIV A;  4ZLN A;  3P45 B;  3VAJ A;  3MEC B;  5KT3 A;  3PRB A;  1FI4 A;  4X64 J;  1BC6 A;  4TN2 A;  3HVR A;  2OEL A;  5IXU A;  5J2Q B;  1KTV A;  5KFF A;  3D6F B;  2ZH2 A;  4CLF A;  4KBI A;  4K4W A;  3HUL A;  3R2C J;  4NX9 A;  1FEE A;  2DIS A;  1RKJ A;  4DR1 F;  4I69 A;  3H4B A;  4ES2 A;  3PIO Q;  1WKL A;  4R8U A;  4DX7 A;  2X98 A;  5E0O A;  2R7U A;  5FLX Y;  1YHQ S;  2HNZ A;  5I3Q A;  2J7W A;  3W1Y C;  3DMJ A;  2V4R A;  2HHT A;  4ZP9 A;  4C3M A;  4Q7A A;  3QJP A;  3VAF A;  3KK3 A;  2RHS B;  4K0K F;  1ZET A;  4OHX A;  1RAH B;  2X3G A;  4AYB D;  4LSL B;  2BE2 B;  4JI2 J;  2G0C A;  4UY8 T;  3U27 A;  1SUQ B;  2JL9 A;  1GQE A;  1S10 A;  4DG1 A;  4DR4 F;  2VG7 B;  3HVT A;  4GMK A;  1DQ9 A;  3QAT A;  4OJ1 A;  5IS2 A;  3MEE B;  1G4C A;  3MEG A;  3QAU A;  4BWJ A;  3WBH A;  2YWE A;  2Z2L A;  1RU1 A;  3BB5 A;  3RRH A;  3KUH A;  3UNY A;  4OI6 A;  3S8S A;  3FEZ A;  1HHT P;  1DTT A;  1FVQ A;  2WBM A;  3UR3 C;  4PXD A;  3M2U A;  4QBU A;  2E29 A;  2AX0 A;  5B0A A;  3PJX A;  1UA0 A;  3BGR A;  1F9F A;  2IAJ A;  5RUB A;  1RAO A;  3MAH A;  3GWC A;  2LQ5 A;  4IOC Q;  2HIY A;  1HHQ A;  1KH4 A;  2GJF A;  3ICL A;  2KN4 A;  4EMD A;  1N8R T;  1JLQ B;  3CJK B;  4AND A;  1F9E B;  2CZ4 A;  1UL3 A;  3CJR A;  4GO5 X;  3M30 B;  1ITP A;  2FB0 A;  3RAX A;  2VA3 A;  1TUV A;  4X4N A;  4IH5 A;  2PC6 A;  2ASJ A;  4RU9 A;  3IRX A;  2Y3Y A;  4F7V A;  2M70 A;  5L1L A;  2VKR A;  4ZPT R;  1UMJ A;  2R8J A;  3GIM A;  2YKP A;  2CVE A;  2V4Q A;  3CCQ S;  4DV5 F;  1RWX B;  3SBM A;  1WHW A;  2OP5 A;  1JLF A;  1TTH B;  3C16 B;  4EZ6 A;  3N6L A;  4UTG A;  3MMB B;  4QR0 A;  4FDI A;  4JOU A;  1H72 C;  4W98 A;  2YNF B;  2DNK A;  2H4Y B;  3VWS A;  1AJA A;  2DR5 A; 
#chains in the Genus database with same CATH homology
 1EW8 A;  1K7H A;  3UNY A;  2W5Q A;  5AJ9 A;  4UOO A;  1AJC A;  1O99 A;  5LQQ A;  4GTX A;  3T02 A;  4UPL A;  4CXK A;  2XRG A;  4KJD A;  3IGZ B;  4LRA A;  4YR1 A;  1KHK A;  1P49 A;  1HJK A;  2RH6 A;  3NKQ A;  3OT9 A;  3BDG A;  2W8S A;  1ALH A;  5EGE A;  4MHX A;  4CYR A;  5IJS A;  4LRC A;  5DLV A;  2D1G A;  1EQJ A;  3B5Q A;  1N2K A;  3SZY A;  5L0B A;  4LRD A;  4LRE A;  4KJG A;  1AJB A;  4CXU A;  1ED8 A;  2GSU A;  3UN5 A;  3IGY B;  3NKP A;  1KHN A;  3UO0 A;  1KH4 A;  5INH A;  3MK1 A;  2IUC B;  1URB A;  4B56 A;  4UPI A;  1AUK A;  2W5T A;  2GSO A;  2GLQ A;  4GTZ A;  3DYC A;  3NKN A;  1Y6V A;  1AJD A;  3ED4 A;  5HRT A;  4MY4 A;  2VQR A;  4N7T A;  4LRB A;  4LR2 A;  1ALI A;  3KD8 A;  4UPK A;  4CXS A;  1SHN A;  1EW9 A;  3TG0 A;  2X98 A;  1KH9 A;  2GA3 A;  5TJ3 A;  3WAY A;  3M7V A;  3BDG B;  1SHQ A;  1O98 A;  4ZGA A;  4LRF A;  5L0E A;  4UOP A;  1E33 P;  2W5S A;  3Q3Q A;  1ED9 A;  3T01 A;  5GRR A;  2W5R A;  4GTY A;  1HQA A;  3IDD A;  5DLW A;  5GOV A;  1EW2 A;  4LR8 A;  1E3C P;  3TX0 A;  4KAV A;  2ANH A;  4UPH A;  1ANI A;  3MK2 A;  3CMR A;  1ZED A;  1ZEF A;  4LR9 A;  2XR9 A;  2IFY A;  5LIA A;  1KHJ A;  2W5V A;  3LXQ A;  4ZG6 A;  4GTW A;  4LR7 A;  3NKO A;  5KXA A;  1ALK A;  1EI6 A;  3TWZ A;  2QZU A;  3E2D A;  4FDJ A;  5L0K A;  2W5W A;  5DLT A;  1ANJ A;  1ALJ A;  3WAW A;  3NVL A;  3MK0 A;  1KH7 A;  5LRN A;  4QAX A;  3M8Y A;  2W5X A;  2G9Y A;  4CYS A;  3M8Z A;  3M8W A;  1URA A;  4NWX A;  3WAX A;  4ZG7 A;  4UOR A;  3T00 A;  3UN3 A;  3UN2 A;  1Y7A A;  1ZEB A;  4NWJ A;  1HDH A;  4KAY A;  3NKM A;  5EGH A;  4FDI A;  1ELX A;  1E1Z P;  4LQY A;  5C66 A;  5LRM A;  1E2S P;  2IUC A;  3A52 A;  1EJJ A;  2ZKT A;  3BDH A;  3DPC A;  1KHL A;  3NKR A;  3WAV A;  3SZZ A;  1FSU A;  1ELY A;  2W8D A;  4ZG9 A;  1AJA A;  3BDF A;  4KM4 A;  4TN0 A;  1N2L A;  1KH5 A;  1ELZ A;  3WBH A;  4MIV A;  5K4P A;  5IJQ A;  2GSN A;  1B8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...