3UWSB

Crystal structure of a clostripain (parmer_00083) from parabacteroides merdae atcc 43184 at 1.70 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
228
structure length
228
Chain Sequence
AFGQDGNNWMEIDDLAKGLPDDLFDFILFDACYMASVECTYELRNKAEYILASPTETMADGWPYEEMMPQLFATDLQLEKVGETFYNHYLNNTYPYATVSLTKTSELDNLKSAIHDILADKTESDIYSLDPKNMQRLEYLYRSPGMLYDFNDYIKQLATAEQYDRFISCLDKAVVYKAHTPKSYYAAIGNALPIKSYCGLTIFVPQESLPKMLEWYKQRVGWYKAVYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal Structure and Activity Studies of the C11 Cysteine Peptidase from Parabacteroides merdae in the Human Gut Microbiome.
pubmed doi rcsb
source organism Parabacteroides merdae
total genus 64
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...