3V35A

Aldose reductase complexed with a nitro compound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v35A00
4YVVA 3CV6A 2ACUA 3D3FA 1Z3NA 4WDWA 4AUBA 4XZNX 1M9HA 4WDTA 3M0IA 5AZ1A 3EAUA 3V0UA 3RX3A 1EKOA 4H7CA 4EXAA 4JQ2A 4LAZA 3MC5A 2FGBA 4MHBA 2DUXA 4R9OA 2PDFA 2HVOA 2ALRA 3M64A 1X96A 3BV7A 5KETA 1PWLA 4JTCA 1EF3A 1YNPA 2IPGA 4ICCX 1FRBA 4PMJA 1AZ1A 3ONBA 4EXBA 2HV5A 1PWMA 4PRTA 1SM9A 4GA8A 3EB4A 4IGSA 3CASA 5M2FX 4G5DA 3H4GA 1QRQA 3BCJA 1ADSA 3S3GA 4JIRA 4OTKA 2IKJA 3FJNA 1X98A 3KRBA 4XAPA 4FZIA 4WGHA 1YE4A 3Q67A 3R8GA 2PDCA 3H7RA 1C9WA 3RX2A 4ASTA 4DBWA 3R7MA 4JTQA 1YE6A 1XJBA 3V36A 2IKHA 2BP1A 4I5XA 1RALA 1MRQA 4YU1A 1AFSA 3C3UA 4JTDA 2PDIA 3LNMA 1IHIA 2J8TA 4DBUA 5JH2A 2PEVA 3F7JA 3R43A 2F38A 1T40A 5DANA 4QBXA 2HDJA 3LUTA 4LBRA 4LBSA 3V0TA 3GUGA 2IS7A 2PDWA 3GHUA 3FX4A 5LIKX 1LQAA 2PF8A 2PDXA 2IPJA 2FZ8A 3WCZA 2ISFA 4PRRA 2P5NA 3UYIA 2HEJA 2IKIA 1AH4A 1IEIA 1Z9AA 3CAVA 4LAUA 3EB3A 3WG6A 3B3DA 4GQ0A 2FZ9A 2PDHA 4YVXA 1GVEA 2QXWA 1UR3M 1RY8A 2PDJA 4L1WA 4WDXA 3T42A 4WEVX 2FZDA 3G1RA 2HE5A 3DOPA 2PDUA 2IPFA 1QWKA 4XZHA 3UG8A 2PDKA 3N2TA 1ZGDA 3NTYA 2IKGA 3LN3A 4QXIA 1Q13A 1OG6A 3V0SA 2NVDA 1S1PA 3UZXA 1AH3A 2HE8A 4GQGA 3Q65A 4IJCA 1VP5A 1XF0A 2INZA 1PYFA 1Z8AA 5AZ0A 3O3RA 3R94A 3M4HA 3UZZA 3V35A 2R24A 3GHSA 5JH1A 4YVPA 1PZ0A 3R58A 3H7UA 3R8HA 3WBXA 3LZ3A 3LQGA 3CMFA 4F40A 4GCAA 2NVCA 1A80A 1XGDA 2FVLA 2I16A 4JQAA 2AGTA 2BGSA 1S2AA 4LB4A 4JQ3A 1S2CA 3CV7A 2HVNA 1AH0A 4XZLX 4QX4A 3LQLA 3ERPA 3QKZA 3LEPA 4FAMA 2I17A 2BGQA 2WZTA 3GHTA 5LIXX 3VXGA 4JTAA 4JIHA 2IQDA 2PDMA 3DN5A 1ZUAX 3BUVA 3RX4A 3UWEA 4XZMX 1EL3A 4L1XA 2A79A 4JIIX 5HNUA 3MB9A 2PDPA 4XK2A 4XZIA 4XO6A 2DV0A 5LIUX 2ACQA 3ONCA 1MI3A 4ZFCA 2WZMA 4WDUA 1J96A 3G5EA 4DBSA 1Z89A 1ZQ5A 2PDQA 4GACA 3P2VA 5HNTA 4XVEA 4PUWA 4IJRA 3LZ5A 3COTA 4Q3MA 3U2CA 4WRHA 4RPQA 2INEA 2F2KA 4JQ1A 4XO7A 1AZ2A 5LIWX 4YS1A 1MZRA 2ACRA 3LBOA 3WBWA 4QR6A 3R6IA 4XVDA 2PD9A 2PFHA 3LENA 1PZ1A 1RY0A 4PUUA 1US0A 2PZNA 4HBKA 4HMNA 1K8CA 4FA3A 3UFYA 1S1RA 1ZSXA 2ACSA 2C91A 2DUZA 2PDBA 2R9RA 2PDNA 4Q7BA 3UP8A 1LWIA 4DZ5A 1JEZA 1Q5MA 3UZYA 3N6QA 4NKCA 5HA7A 2PDLA 4PR4A 4JTRA 4JQ4A 3BURA 3WBYA 4GABA 3GHRA 1X97A 3UGRA 2VDGA 1VBJA 1YNQA 1T41A 1HW6A 4FALA 1HQTA 5C7HA 2FZBA 2CLPA 2IPWA 3CAQA 2IQ0A 3O0KA 2PDYA 1R38A 4LB3A 3UZWA 1EXBA 3LD5A 4GIEA 4H8NA 2PDGA 5LIYX 2PD5A
chains in the Genus database with same CATH superfamily
3C8NA 3IJIA 1GPWA 4MOZA 1D7KA 3H26A 1XPGA 3P84A 1WDWA 3OA3A 1OJXA 2CHRA 1TCDA 4CD5A 5HXMA 3BTNA 3ARSA 1EKOA 3BJSA 3VOJA 2V68A 3DXIA 2YCKX 1H7RA 4NIRA 1OX5A 1JGMA 3F4CA 2HVOA 4AZ6A 3IGUA 4AZ5A 2F6UA 5BOFA 2RJGA 2E6DA 3RIKA 1H61A 2PI6A 4C7DA 5E0FA 3NQ2A 2FQIA 1AZ1A 4PSRA 1O5XA 1VFLA 4K1GA 3NO5A 1AQMA 6PTDA 3H7VA 2NQHA 3LM3A 2Y8KA 4DIAA 2YA0A 4PCPA 3W37A 3MU7A 4Q6JA 3H2NA 5E09A 1LOSA 3W75A 5FF7A 2AMGA 4JIRA 3Q37A 1JCJA 2C1GA 1GWJA 5H6HA 2GQ3A 1UKPA 2BHYA 1NOUA 4AEOA 4X3ZA 3FY1A 1MXSA 4QS6A 1VRDA 1PE1A 4NJIA 3W2JA 3FDKA 4F2BA 4XKYB 3C3UA 3N6HA 2PDIA 4PMVA 1Q8AA 2Q01A 4FB7A 2I9EA 2VZUA 1CYGA 2J13A 2F38A 1TB3A 5CQ1A 1TJ1A 5AVHA 2W67A 3K4AA 3OA5A 2GUUA 4LBRA 4LBSA 3OW1A 3SGUA 3FW6A 3I4EA 1XUZA 1SFLA 2EPOA 5IBXC 4PMRA 3N14A 3DH7A 3USBA 4X0VA 2CC0A 4BEQA 3WO8A 4DO6A 1V3JA 5E93A 4LVFA 1I2RA 3AIWA 2P10A 1HF6A 4G7FA 4TV6A 3RLVA 1BYDA 1XC4A 3GU2A 1OYAA 4UXDA 3S2NA 3ANVA 3O6CA 3UXAA 1MQPA 1XYBA 3BGAA 1T8XA 4IFRA 7ENLA 3ARPA 3L4ZA 4CQ8A 1R3QA 3ZVHA 2B81A 5AC7A 2EPMX 2PDHA 2ZX8A 5CH9A 5IRPA 2A3LA 1UR3M 1Q6OA 3TIMA 1O68A 4AY7A 3TR2A 3HBLA 4GISA 2DSKA 4G1KA 1DJIA 1MUMA 3SCWA 2G96A 2Z00A 1ZP4A 1AQFA 5BRQA 3VKBA 2E9BA 1UJQA 2QZRA 3FHQA 4ZO8A 2VEKA 4MLRA 1NQ6A 1GOMA 1JJKA 3S42A 3BLIA 2NX3A 1DEDA 4JTUA 3AISA 1PKYA 3N1AA 1QNPA 3N12A 4YJ5A 4IICA 2XIMA 1MQQA 3IARA 1PCWA 1SZEA 5DFAA 3TNBA 1XKYA 1LCOA 4LNCA 4UNLA 3SCUA 3WBXA 4B91A 2BVWA 3URQA 1VS1A 1FA2A 1LRNA 2FVLA 1K1DA 4O1AA 4C1NA 4GRSA 1W1PA 2QPUA 2QIIA 3PP7A 3EB2A 3V75A 1E6NA 1IWAA 1GOQA 1GZGA 5G1MA 1BYBA 2O92A 3TOPA 3N9KA 3LHUA 4IHCA 5B80A 4WIWA 3I6TA 3LPGA 1CXEA 4Z17A 4GC3A 2ZZ3A 4C91A 3PSVA 4JTAA 5G2IA 3UZ5A 3NJ3A 1E1EA 1JZ5A 3I3BA 4UBPC 2NQ5A 1JYVA 3QH2A 4AIOA 4Q8MA 3NSXA 4DWSA 3THAA 4HPHA 1QT1A 2XH0A 3EDKA 2CZ5A 4V15A 3WL1A 4QLKA 3KTSA 1JZ4A 3EMZA 3KBSA 3H24A 3WEOA 1J96A 1BF6A 1EPVA 1KV8A 1J4EA 1G69A 1TZ9A 3EX6A 1GORA 4XVEA 1AMYA 2NSXA 4AD2A 4AIUA 2AKZA 4MWAD 2Y62A 3GXFA 2XJ7A 4CLMA 4OU1A 3NEHA 4Y90A 1KCXA 4PBFA 2F2KA 3U2ZA 4A8LA 3POHA 3NZGA 2CERA 3A3XA 1TWSA 3DYMA 4IISA 3LBOA 1T8QA 2VGFA 3SB0A 3LHVA 2VNCA 4FNSA 3CV1A 2ATMA 1RH9A 1AUSL 3CMGA 1RY0A 4DJFA 3KL0A 1PAMA 2FMNA 3CLWA 4JXCA 2WHKA 2Z1VA 1S1RA 3DFOA 5HUPA 1OGBA 3H2EA 4ERAA 5F1UA 1UD4A 3MO7A 4BA0A 4IXXA 1E9LA 4W5UA 4FLSA 1GYMA 3RG6A 4GNVA 4N6FA 2JGQA 3XISA 4YYCA 2VM8A 2Z0IA 4R7JA 2VEPA 3LOTA 4KRTA 3H23A 3LCHA 1H50A 2I1OA 1AA1B 3L5MA 4XZWA 5CBIA 4W5ZA 2XIIA 3EWUA 4H83A 3WDQA 3DBNA 4V1YA 4F48A 2ZZ2A 2PPGA 3OZMA 3UR2A 4XSLA 2WMFA 2FHFA 1WBHA 2AQVA 2RKXA 4UFHA 2IPWA 2H3DA 3CAQA 1WKEA 3W85A 2WC3A 1Q4NX 1ZBVA 2PGWA 1EUNA 3PUDA 3PPFA 3GVWA 2Y1HA 3B97A 4DUVA 3W2MA 4HA1A 2OQHA 2PD5A 4UTTC 2QJGA 1CX9A 3AS0A 2RDTA 1OY0A 4YL2A 5KMYA 1CLXA 3LXCA 4LVBA 4HSOA 3LNPA 4DPQA 2OJPA 1OB0A 2CXGA 4LRTA 3U2OA 2BVTA 5FJRA 2B7NA 4HNVA 4RDZA 5KINA 5JBDA 3CU2A 3OB8A 2AAAA 1EQCA 4HIBA 5ABGA 5LXEA 5FA5A 5BXRA 3BV7A 3O7UA 3AFBA 1VFMA 1PWLA 3S9YA 1YLVA 3B8SA 1YNPA 1DP0A 4O18A 3SY1A 1WAWA 2QJMA 2WPBA 5MKGA 3GDTA 3KL3A 3LBCA 5T9CE 3MY9A 3PBVA 1JXKA 2ONEA 1XLEA 4B90A 5ABFB 1TREA 1KGUA 2WC4A 2OLSA 1QRQA 1EH9A 3UYCA 3RF9A 5DY3A 4WF7A 1X6NA 3HV9A 4S2BA 1UH4A 1JZ3A 2CKRA 1TTPA 3RJYA 3WQFA 2J7BA 1FWNA 1KW1A 2ZUUA 1D3GA 3GXTA 3IIZA 1L0PA 3AIRA 2NXHA 2FB3A 4L61A 4AISA 4C1NB 1MRQA 4QDWA 1U5JA 1VD6A 3Q58A 4BF5A 1AFSA 3WMBA 3QEZA 5EMYA 5C8BB 3S2LA 4KS0A 3G6LA 4QLJA 2VR4A 4O16A 3P61A 3ARZA 3BXWA 3BAXA 3WDJA 1V0NA 5J8LA 3IJ6A 3EA2A 4FLRA 1EBHA 4RK8A 2DUAA 4I8YA 3GHUA 4JTSA 1V0KA 3S83A 1UZ4A 1R9YA 3NL3A 2JF6A 4AHQA 3VFLA 4A05A 2PDXA 3N17A 1E6XM 3R0DA 1V6TA 4A29A 1KBJA 5HOSA 2ISFA 5I3KA 3WH8A 1FP9A 4TVCA 3OVGA 1VPXA 2NV1A 1KXVA 4J40A 1XRSA 3FOKA 3CAVA 4J2PA 1RBLA 4R5EA 2WYSA 1XV8A 5EB8A 5FL1A 3E0FA 2W9MA 1GVEA 2VFHA 1R3WA 5DMYA 4UTJA 2W3ZA 1JPHA 1XCXA 3CL6A 2Y5EA 1RK5A 1KFKA 4ACYA 2Y0FA 2BY3A 3O1NA 4L9XA 2RDUA 1OG6A 3BDKA 1S1PA 1KFEA 4XSMA 4FEZA 2V2CA 2YDSA 3F4DA 1EFZA 4GQGA 1F2JA 4WY0F 4EAMA 5BYWA 4XISA 3OP2A 1YPXA 1H7NA 3QHMA 1XBXA 4RE2A 4JDYA 4O8RA 1VQTA 3V7PA 4C5ZA 3MSGA 4PL1A 4ZL1A 2VWTA 5CGTA 1P4CA 1POJA 2DDXA 1J12A 1WXJA 4YVPA 2Y4SA 1J8VA 2ZUSA 3S2JA 1FWAC 1H62A 2Q8XA 3U9IA 1KO0A 3WF1A 4E2DA 3VNIA 2QLYA 3FA5A 1FTXA 2V8ZA 3GNNA 3IANA 2SFPA 2HRWA 3UVAA 3G1AA 1X7IA 1PX4A 2V63A 2OO0A 1A50A 3OBAA 3PB2A 1AD1A 1Q45A 1W3IA 1CXKA 4PMYA 5ABHA 4XBJA 1JI1A 4GY0A 3R5EA 1YKWA 3Q94A 3CMJA 5T26A 4DF2A 2FJKA 3BV4A 1KCKA 5G1YA 2VWSA 1R47A 3IRDA 1JAEA 5E5CA 1BEUA 1WUEA 4ZA0A 3RR4A 5M03A 3VGFA 4GBDA 3B8DA 3RX4A 2WQDA 2W92A 1PPIA 1VKFA 4O1BA 5I07A 4XK2A 1EYEA 3EX4A 2CZVA 3M0MA 2OX1A 2HTMA 1XBZA 4NILA 1PBGA 4GNKB 3G5EA 3H2AA 3CIVA 4FX7A 4MGGA 2PDQA 2RHGA 5ABEA 4CGTA 4NX5A 1U1UA 3AMDA 3MMTA 3VDAA 4Z1YA 2WNWA 4UQDA 4IQJA 3U2CA 3PVFA 2DZTA 2OR2A 4JQ1A 4WVXA 4XO7A 2XZ7A 3UR5A 3ABXA 2BHZA 3TTQA 3O63A 1KRBC 3UY8A 3V1PA 3G1HA 4MJMA 3HN3A 1CGYA 3A9IA 4US5A 4CNTA 1UD3A 1XP3A 1HO4A 3WDRA 2HMCA 2UBPC 3E96A 4IGHA 1DJNA 1G6CA 1CTNA 1UIPA 3NQVA 3BGGA 3BJTA 1V3LA 1AJ2A 2VQUA 3RCNA 3KBVA 3S0CA 3UF9A 1EPXA 3B8UA 1TPEA 1HNYA 2R1NA 5GVJA 1C90A 1JUBA 4MNJA 1H1ZA 1FX6A 4W87A 5TAOA 4AQLA 3LMZA 3W88A 3XINA 1L8NA 2J75A 1G9HA 1MFUA 4LV4A 3MP3A 5C0QA 5IM51 4M80A 4DVOA 5FEXA 1SO5A 2CLPA 3SFWA 4Z2KA 2XIOA 1KLYA 1KBIA 3UGVA 4GKTA 2IMRA 5BU6A 1X6UA 4H6EA 1UKTA 3VAVA 4GQQA 1D2KA 3KVLA 4QE4A 1OD8A 1G4SA 4YVVA 3W22A 3VO0A 1W2VA 3CV6A 1BXCA 4IMFA 1YQ2A 3UJEA 2GJNA 1E6RA 4WJXA 4AF0B 3VGGA 1NTHA 4IG2A 3W71A 3EAUA 1XIBA 2QKFA 1E4IA 5AY7A 3S1XA 3B40A 1LT7A 1R7AA 5K7JA 4MHBA 3G0XA 1R9ZA 3MPGA 4H6QA 3SCOA 1E0TA 1RCXB 4N42A 3MP4A 4J3ZA 1YMYA 3WLRA 3KTXA 3SN4A 2Y61A 1LLWA 2YJQA 4DNMA 2POZA 3REQA 1XLKA 3LS9A 5FSEC 3AMCA 1E51A 2C8NA 2BOEX 4D6FA 5LNUA 2AQOA 2ZXDA 3LXAA 3ES7A 2GOUA 4Q8QA 1H7XA 2ABBA 2FGLA 4CQAA 4JX5A 1EWDA 1JDEA 3CASA 3NQAA 3W7NA 3TX9A 4LNYA 1NOWA 3SSJA 2QT3A 3E1F1 3RAOA 1YE4A 3ZFHA 2NQLA 1CW2A 2PDCA 3TA6A 2CIPA 3MUY1 3PZOA 2CLKA 3WY1A 2WNZA 1UMYA 1DJYA 3AMGA 3PJXA 4B5UA 3PG9A 4DO7A 4QAIA 1ITQA 1RK6A 1F6PA 2DIEA 2G4JA 4URIA 3JR2A 4E6MA 3F5JA 4F79A 4HK7A 1XLFA 3AC0A 3R12A 1AQ0A 4IUGA 2FVMA 3GH5A 4ALDA 1E73M 4P7RA 4GXWA 1EXPA 1TA3A 4CD4A 4NZ4A 3LTSA 4Z0SA 1E0WA 3W1PA 1F6KA 4OVXA 2WMGA 1YBQB 1YX1A 3ABRA 1DKWA 3L4TA 4HPGA 4POCA 4PSPA 2BY2A 2OZTA 1JFXA 1LYXA 3G6MA 1HKKA 3GTIA 1W3LA 1ZFJA 4C6BA 4RZBA 1ML1A 4I8DA 1LZOA 4C5YA 2D23A 1NDYA 2WVVB 3WF0A 4CCDA 3WNKA 3VM5A 4UMCA 2HISA 4HHMA 4O1DA 2XH4A 3CWHA 2VOTA 3CTLA 2WJFA 5HWNA 4LANA 4Q8UA 1EJSC 4W8AA 4HGXA 3W24A 5I00A 5K2ZA 1CLVA 4MJ4A 3QRHA 3CUXA 1GZ1A 2ISDA 2BOGX 3DHPA 4N2YA 4ZE5A 4IFKA 3VFCA 1SMAA 4M3PA 4H4IA 2G37A 3H2OA 5EL1A 3VILA 3GS6A 1KCLA 3ZVIA 1EJVC 1QK2A 4D72A 3PZ9A 3GB6A 1LDCA 3HM7A 3NPXA 4LUTB 1OQFA 3Q65A 3VGEA 5LNWA 1HGWA 4A8RA 1T7LA 1K6WA 1O5RA 4DM1A 1ECEA 5EBUA 4LTSA 3ITLA 3KOYA 5HWMA 5BNKA 4JKMA 3CHEA 1E5NA 1HVQA 3GC5A 3R94A 1G0CA 3CL7A 4IJBA 3N13A 1SVDA 2PWDA 2CYGA 5DRIA 5EFFA 3A9BA 3SY8A 3H2FA 2TAAA 3FIGA 4AD0A 3CMFA 2Z7GA 1TV4A 5C6MA 4FP1A 4IUOA 3RRXA 3RDKA 4ROQA 1WB0A 3TJIA 2DP3A 1T5AA 5CZ0A 3Q45A 3S2MA 4LQ1A 4NJJA 5C2CA 3GM8A 3SCQA 1UOKA 3UA3A 3UG3A 3KHDA 3ERPA 2ZCGA 4R34A 1KA9F 4P7OA 4S3AA 1S3TC 3W26A 5G1TA 2WJDA 1SR0A 3DYPA 1HKVA 3C0SA 1EGZA 2EPLX 3ARRA 4RW3A 3DN5A 4NAEA 3ARYA 1DWJM 2CWXA 1JYNA 2P88A 5C9RA 3GNPA 2QPSA 3MB9A 4XZIA 2C1IA 2XYLA 3N29A 3AHXA 4IZGA 4N9BA 4K7VA 4E8DA 4MWAA 4IPLA 1LBLA 3WF4A 3WUGA 1WKDA 4DBSA 3S5ZA 3QHOA 1TPVA 1XYMA 3M5VA 4A2RA 2O9RA 1Z48A 3GDBA 3KL5A 4AWSA 1J0KA 1HIZA 3A21A 4O50A 3NQFA 2ZXBA 3REQB 2DZBA 1DTNA 4NL1A 3SGGA 4JR5A 4LF2A 4TUFA 4OJYA 4Y9PA 4QHRA 1KC7A 2CETA 1F76A 3VOFA 3R6IA 1J10A 4ERGA 2VFFA 4PRWA 3EOSA 2ZTKA 3TYBA 2WVSA 2QAPA 2ZA3A 3DGBA 4PUUA 3QYSA 1S5MA 3W29A 3WKZA 1QI3A 3N2MA 3WH6A 2XN2A 2X1SA 3DIPA 4GUGA 5HMEA 4L9ZA 1TUXA 1XUUA 3W7HA 4UTUA 1V51A 3KP0A 5HDRA 4BJHA 1MW1A 2NX9A 4RR4A 2OSWA 1XL9A 4M0XA 2GK1B 3VUPA 4IX2A 5DXYA 3RITA 4JQ4A 1RJPA 1S3HA 1TA3B 3VMOA 3MTWA 3CUIA 3HTWA 1R2TA 4DJEA 1N55A 1W54A 4C6OA 2FZNA 2PTXA 1UWTA 4JFUA 4JHMA 1NFGA 1F8MA 3EOOA 2VRQA 3SM0A 1OYCA 1EO5A 3W87A 5C7HA 3BLKA 1E6QM 3C5QA 3A47A 2FB2A 4U3CA 2OSYA 3TN3A 3KOWA 1R38A 5K4XA 1J6OA 5D8ZA 4R33A 1J0YA 4Q4QA 2GZXA 3C2EA 5I0DA 1Z3NA 1NWUA 4AUBA 3FAWA 2ZDSA 3PR2A 1GQIA 4WSJA 3M0IA 2OT0A 4EE9A 3TK7A 4WD0A 4P7LA 4EXAA 4KEVA 1ISYA 2FGBA 2YLLA 1ZBCA 4K3ZA 5CPQA 5XIAA 5KZEA 1OCNA 3OZYA 3UJRA 1SJAA 4IFKB 3ZS4A 4J3VA 2ZUTA 4ZQNA 4NRSA 3QPEA 1JAKA 1YNYA 1UKOA 4RZ4A 3ONBA 1ZLPA 3B04A 2E09A 4EXBA 1KRAC 1JCYA 2QJNA 2OLAA 1SW0A 5JBFA 1SM9A 3A64A 4A3HA 4IP7A 2A6NA 1BGGA 1XH1A 3NCOA 5A1AA 1YDNA 3B9OA 2P0IA 3FJNA 2J7GA 4FZIA 3IVTA 3Q67A 3R8GA 2X8RA 3MA8A 1DWGM 4LX4A 3GXIA 5AYXA 2GVJA 3TW6A 3UWYA 2FFIA 1XYAA 1V02E 3AZTA 8A3HA 2CLHA 3GY1A 3RRAA 4MZ8A 1Q6CA 4ZCWA 1W9PA 4Z08A 3DFNA 2VR5A 1EP1A 1OHLA 2BNJA 5TIMA 1WE5A 5KEZA 1DV7A 2J8TA 1RP9A 4J1OA 1SU5A 1FDZA 3DEQA 2D24A 3MSDA 4NZ3A 1B9BA 3NZRA 1YPFA 3LI1A 3SRFA 1DXEA 3CHDA 2G97A 4AH7A 4E4FA 4MKNA 1RSCA 4PTMA 3BANA 2J8FA 7REQA 1KQZA 2HK1A 4M19A 1W91A 3DYOA 4U31A 4NXKA 3WCZA 1EEPA 1GHSA 1KM6A 1VF8A 3B03A 4MWAB 5FD0A 1S5TA 3JRKA 1MNSA 4BFAA 1OGSA 4GYJA 4M7SA 2HSAA 3R89A 1GG0A 4GG9A 3IJ7A 1H7OA 3R11A 2VX6A 4YTQA 2X0YA 2I5GA 3FNDA 2Z1SA 4QJ4B 1TR9A 2XVKA 3NFUA 3QBUA 3SIZA 4MFEA 2FZ9A 3IAQA 4S3CA 3BG3A 3FKKA 3DI0A 4YTSA 2V5KA 4MUPA 3W4RA 1W9XA 4CCEA 5FJOA 2J7DA 4WXZA 4XAGA 5J04A 3C2OA 3M41A 4I6VA 2RUSA 3RUBL 3WLOA 3RK8A 3VA8A 3MWCA 4KIEA 3E2RA 1PX3A 4MSSA 3LG3A 1SYTA 1O94A 2UY5A 5D03A 2OLHA 3VIGA 2NVDA 1WZLA 3LPOA 1YXYA 1AL7A 4E5TA 1QTWA 3EX3A 2UWFA 3VOGA 4NZ5A 3B9AA 1G67A 2PU0A 1UUMA 4IJCA 2GJXA 1SO4A 3K30A 1E4NA 4JZ5A 3MSYA 1DIKA 2E40A 5AB3A 3N18A 4JS3A 1XLJA 4PULA 1E0UA 5AZ0A 4AAJA 2A3BA 5BRPA 3NM1A 3R79A 5HJYA 3GHSA 4Q4PA 3EWCA 1PZ0A 1XS2A 3BG5A 3RXZA 3AWOA 5M1TA 1DJHA 2ZA1A 1LBMA 2OG9A 4KRUA 3B05A 3UT0A 5GQBA 2VVSA 3MBFA 4F40A 2NVCA 4IPIA 1MRAA 5E6ZA 5A6JA 1K77A 4HYVA 4PFMA 2PS2A 4QNWA 4GMEA 1YIXA 3JUGA 1VBUA 2J62A 1EJRC 1VFFA 1WXYA 3PZVA 3QKZA 1VLIA 3HPAA 4RV8A 3GHTA 3MMUA 3EXSA 1JGIA 3NQ8A 1EL3A 5HNUA 2FTWA 3HPFA 5FL0A 1V0MA 1P1XA 3EYPA 4C65A 3E5PA 3BO9A 2WZMA 3DG3A 2ZUNA 3F4VA 4PTVA 1IXQA 5HNTA 4DBDA 2FH8A 3TMLA 3GTXA 4PC8A 3ITYA 3VCRA 2WSYA 3A22A 4NHVA 3NXFA 3TROA 4GUHA 1J0ZA 4O0ZA 5EMMA 4YS1A 1E56A 1E6SM 5DBTA 3F5LA 1AODA 3G1SA 1GKPA 4TMCA 4B4FA 1R46A 1EHNA 3HGSA 2Z2BA 4JY9A 3T0BA 2J9XA 5CZSA 1DVJA 2X09A 3NURA 4L4OA 3M0LA 4HBKA 2PRHA 3N9RA 4UTFA 2HPMA 3UFYA 3RN6A 3L4VA 3DESA 1E6PA 3H54A 3KCOA 3AXXA 1X1NA 2ZE3A 4KEZA 4PODA 5CSYA 1UROA 4Q4OA 4E0CA 3UP8A 2WVTA 3AUJA 4IQEA 2VMFA 4YCPA 3L65A 2WNQA 1IYXA 3TUUA 2CLOA 4IXHA 1TO3A 1WUFA 2YA1A 3P6LA 5CLWA 2YCEA 3U5UA 5F4WA 2OO6A 3LCIA 4NJHA 1HJQA 2CFFA 3GTHA 3AAMA 1TPWA 4DY1A 2GVLA 5DCBA 1I1WA 3EPOA 3KBJA 4HJWA 3R2GA 3ZT6A 3FEMA 1UR0A 4IWWA 4N6EA 2L5HA 2YB1A 4Z1DA 3CZGA 2J7EA 3PG8A 4X0NA 2Y7GA 4UMBA 1ESWA 4O0KA 1EJXC 4UOQA 1UZ1A 2PUZA 1B57A 4S38A 4WXYA 1EGMA 4PH6A 1NARA 2GVYA 3KTCA 2OZ3A 4ML9A 1M9HA 5D8WA 1E3ZA 3PK7A 3KS6A 4MADA 5I3IA 3W7RA 2PGFA 4AG0A 2E5BA 3AIQA 4IIDA 1OEPA 2CPUA 2NW0A 2X1IA 3IK2A 3W28A 3GH4A 1I45A 1A5OC 3NQGA 5A5WA 1SW3A 4DZHA 1EF3A 2OCZA 1W17A 3FJLA 4AMCA 1TWZA 3TSMA 1W1B1 4Q4RA 1I75A 2CLEA 2VFIA 4OOUA 4JIPA 3QHNA 3HJEA 4IMDA 1L9WA 3TONA 4B5WA 2XN1A 3U0HA 3BW3A 3P5ZA 4FXRA 3MHUA 2GJXB 3FA3A 1KTNA 5EA9A 1ITUA 1JZ8A 1O1ZA 1UWRA 3IGSA 3NO3A 3CZEA 1EA0A 2BXYA 3T55A 5EFDA 3IV8A 4JX4A 4I7WA 1I9CB 1QNQA 2CESA 3PM6A 1QW8A 3T4WA 1OFDA 4WGHA 3G1YA 4K8GA 4GLEA 4J3UA 3GYCA 1W9UA 3LPPA 1P6CA 3URAA 2ABAA 4NU7A 1XPYA 4GGHA 2JKPA 1XDLA 1XLBA 4YU1A 2WLYA 3F1QA 3QMTA 3MQTA 3PFRA 4YXGA 4MYAA 5IDIA 2GSHA 4XIMA 3N4AA 3PPHA 4GUFA 5JH2A 3SCVA 4AIBA 4M29A 4W9TA 2NT0A 1XH2A 1B2YA 3VM7A 5KZMA 3GDLA 3OIHA 4K2SA 4Q4SA 1DBTA 4DUOA 2FPVA 2A2IA 1A5SA 3QV7A 1XGZA 3M07A 3WK0A 1PTGA 3EEGA 4U2YA 2E28A 3WLTA 4MNLA 3VABA 3M44A 1QNVA 3D6NA 2NX1A 4JL2A 1EQPA 3BARA 5CPNA 2ICSA 4WUIA 2IPJA 3SR7A 2HVMA 5EBAA 2X16A 4DLMA 5A6BA 3IJDA 3T08A 1PHWA 4RE4A 2YOCA 2VUYA 4KWVA 4GX9A 3KS5A 1DOSA 3AZSA 1FHLA 2O9OA 3IACA 2BASA 2YW3A 1J2BA 3L67A 2IKIA 4G7EB 4DI9A 1IEIA 5MHBA 3A6OA 1LWHA 4MMWA 1V3KA 4GQ0A 1VPYA 3AUOA 2YBTA 1RQEA 5AHMA 3W83A 4UMAA 4QFUA 4YNGA 3HPSA 4PMNA 1XCFA 3SCTA 4GI6A 4W8BA 4HZMA 1VEOA 4AU0A 1M03A 1YADA 3FEQA 3PNZA 4HA3A 2J47A 3SGZA 3NOEA 4LEFA 4HA4A 1TG7A 3RGTA 4JEJA 2OGYA 3MCNA 3TJXA 1M6JA 4RXFA 1QHZA 1E1FA 3VNZA 1M65A 3GTFA 3QR0A 3QZEA 2Z1BA 4WX2A 1P48A 3MZ2A 2HK0A 1GW1A 4NAFB 1BLIA 4WHBA 2QF7A 2J7CA 5HMFA 2R24A 4Z1CA 4I9JA 5C9ZA 3UXDA 1NIUA 1RJQA 2O7SA 1PB0A 2JEQA 4FF7A 4D6IA 5AKQA 3FHAA 3CZ8A 3NQ6A 3ITVA 1GJUA 3OG3A 1QHPA 4XD5A 1Y5WA 2QGHA 3W38A 2Z6IA 4AXKA 3RM8A 1J6PA 4LB4A 4W86A 3HG4A 3CV7A 2FDSA 1XSIA 3QMSA 4AVFA 2HVNA 2BV9A 2HNEA 4XZLX 2E0PA 4Z0JA 3DKJA 2Z2AA 5BU9A 2EBNA 3DGRA 1QNRA 1W1TA 5AC4A 3IJ9A 1OSEA 1JG9A 1JUKA 4S3BA 3U7VA 3D47A 3NAVA 3GLCA 3ARVA 3WIJA 2E9LA 3WNLA 1FXQA 2XWDA 1FY6A 4L6HA 3VDCA 3NG3A 2W5FA 4O1EA 2F9RA 2PDPA 3EA1A 4PMZA 1OFEA 1KCZA 1XLMA 2FPYA 4AX7A 1LP6A 3TJ4A 1KTCA 3N2BA 4K36A 4KEUA 4FIRA 3PTMA 2I5IA 4NQ1A 1V4YA 1GYNA 1DIDA 3LY0A 2CBIA 1H7WA 3UJFA 3AS2A 2VDIA 1UHVA 4J3SA 4LCQA 4DNHA 2WZHA 5LIWX 5D04C 2BX7A 2Z6JA 3B06A 1K9DA 1Z32X 1A5LC 1JZ6A 4ZE4A 3LENA 4QJ5B 2NQ9A 3PB0A 3VD9A 4S1FA 2D0FA 9RUBA 4C6FA 2Q71A 1TV2A 1K02A 1U2YA 3B4YA 3TC6A 4N7QA 1DIEA 1ONRA 1FWBC 4G6CA 3ZIZA 1F8IA 2VO5A 3T0AA 4GWEA 2DUZA 2J88A 4CN1A 5A6SA 1X6LA 1KQYA 1EJUC 1Q6GA 1WOBA 4ZQMA 1JEZA 3PBWA 3WK2A 4DO4A 4B4HA 4GBUA 1R8LA 3EMQA 3GVQA 1DJQA 3MCMA 2VHLA 4HPJA 1ALDA 1SO6A 2WNNA 5C9XA 3FJ4A 4O54A 4ZQPA 1CXHA 2JF7A 2YBVA 3QLDA 3AXMA 5HATA 5FI8A 1SSGA 3GUWA 3T09A 5A94A 3WDPP 1JUEA 4C1KA 2QDHA 5KSWA 1HJWA 1PYMA 1Y65A 3EWYA 3INPA 3QQWA 3S6DA 2ZXQA 4PUJA 5I23A 3LLXA 3Q2DA 3P93A 5CSSA 1V03A 5AC8A 1WV2A 3MV01 2WSRA 3A4AA 4KH2A 2YLAA 5JXQA 3K2GA 4UZSA 3W01A 1XIFA 4ORIA 3RX3A 1NY1A 1YTEA 3L4UA 3LTYA 3BLOA 5CCZA 5F2MA 6XIMA 1S2WA 1U1HA 3STPA 2OQYA 4DI8A 3T07A 3W7MA 1W3NA 1X96A 2QR6A 4ZODA 4UWMA 4WSHA 5BOEA 3CPUA 4PMJA 2FJUB 2PMQA 1BXBA 4HZ7A 3LDVA 3S4TA 3AIEA 4GA8A 3T2OA 5D09A 2G50A 4ENLA 1EB3A 3NL6A 1J2WA 4KFOA 3GFXA 4UNIA 1EP2A 2VZOA 1BGAA 3W7CA 1W5NA 3KRBA 2WPGA 3BMWA 5IDZA 1SZNA 1UMLA 1KRCC 1XHGA 1US2A 3EMCA 5A8NA 4P2VA 1MQRA 2ZZ4A 3MVIA 1YE6A 4LRSA 3SEPA 7TIMA 4LYKA 1XX1A 2VR2A 2IKHA 8XIAA 4PTNA 2Q8LA 4ML4A 3VE7A 5F2LA 3ABZA 1KM1A 2QCGA 4ILSA 1I4NA 1QASA 1OG0A 4HD5A 2EQDA 3WLMA 1B1YA 7ODCA 3BOLA 4KEMA 2EXOA 3I7RA 3QY6A 2Z24A 3B0YA 2QCCA 1G4EA 2XGBA 4B3LA 3WQGA 5LA1A 2HDJA 1B90A 3RLGA 1EEXA 4TIMA 1LL6A 1AG1O 1S5VA 3QJAA 3LHWA 4GE8A 1SJDA 2BVYA 2VC9A 3EPMA 4PTXA 2E9MA 2P0OA 1HKJA 2E1WA 3BLDA 3LCFA 3MDWA 1BQGA 3POCA 1HXJA 4GIRA 3NZPA 1SZFA 3ZQ9A 3L4XA 4XTIA 4LS1A 2VFDA 4QDMA 3QPZA 2AL2A 5IBXA 1AH4A 1P1MA 3OTRA 4B15A 1ZCCA 5EYWA 2YL9A 1PHQA 4LAUA 1V3HA 1PTDA 3NEVA 2OX4A 4JTHA 1WZAA 3TYAA 4DWSD 1KFCA 2QJHA 4YVXA 3LCXA 2QUTA 1PIFA 4LPCA 3APYA 1DXIA 1RBAA 2F6XA 4TU1A 3M7SA 3DFSA 2FZDA 3W7QA 1PZ3A 2PDUA 2OKTA 4LYPA 3TWAA 1XQLA 1QWKA 2ZX7A 4V27A 3VPLA 2D20A 1IT8A 4C7GA 3LN3A 3LSCA 1Q13A 3E0IA 1OYBA 1RPXA 4A35A 2NV9A 3EZ4A 3HURA 4FK9A 3WYZA 2ZVIA 4LY8A 3W73A 1LL4A 2ODOA 1M3UA 4D6HA 1O7AA 3RFAA 1XF0A 3WUBA 2BG5A 2INZA 4A8IA 3MUIA 3OGSA 1UCWA 1GCYA 4HHPA 1UP3A 2NLIA 2OKOA 1BWKA 1IEXA 2VEIA 1E15A 1W3KA 2I5QA 3UZZA 2WKGA 2V69A 4JTKA 4E2BA 3IIVA 1TMQA 4ZR8A 3S5OA 2EHHA 4UFJA 3MYOA 2O4QA 1T6MA 3R8HA 1PS9A 2ZFAA 2XVLA 1PDZA 4JD4A 4NNCA 3PJWA 2VOMA 2I16A 2DH3A 1GVRA 2HCVA 3P3BA 4LCRA 2V5DA 1S2AA 5AYZA 4JQ3A 4IMAA 5DCEA 1CXIA 4H1ZA 1L6SA 2J27A 3MVTA 3GDRA 4QX4A 1I0BA 1H1YA 4U33A 2I17A 1EBGA 1S2UA 4UQAA 3WLIA 3IJQA 2CLMA 5LIXX 1FCBA 4PB5A 1AW2A 3HV8A 1BTMA 4JYFA 4JIHA 1DJWA 3I6RA 1UWIA 3SO7A 4JAWA 1V79A 4U10A 2AGKA 1DWFM 4D6EA 2AOSA 5H1WA 3QV8A 3ONCA 3HZ3A 3O6AA 4O28A 4ZFCA 5H91A 1V6XA 4C6CA 4V33A 3E6EA 4O13A 2BB0A 1W1A1 2NT1A 3WDHA 1CCWB 5JU6A 3DC0A 1MVYA 3CTTA 1OABA 1R9XA 4FNRA 4LUSB 3PTDA 5A95A 4HYRA 3OLDA 3PS7A 5EY5A 4Y9MA 3IIPA 3W7JA 4JDBA 1PDYA 2D3LA 2W91A 2G3JA 4GFIA 2P8BA 2HPIA 1D9EA 3K8LA 2Y89A 1GUVA 3WQCA 4Q7IA 5FACA 1UUOA 4W93A 1ICPA 1P0EA 2QCMA 1UPMB 4GH1A 2DW7A 4QLLA 4ZSUA 3GD6A 1JYWA 5AYYA 1XYFA 3KX6A 3W82A 2GGGA 3MKCA 4TTGA 2WV8A 1L6WA 1ZSXA 3SN0A 3D46A 3SCRA 1TV5A 2P1FA 1QI0A 2R9RA 4ATWA 1A5NC 3VU2A 3VOIA 1QOPA 1XICA 2CU0A 3ZLGA 3N6JA 2PODA 3IUDA 4F0LA 3BURA 1NJJA 3VVGA 3AYSA 4WLCA 2O9TA 3NPVA 4ATDA 3FYOA 4MLJA 5EMJA 4ICMA 1V3MA 3U4AA 1TVLA 3VGBA 3P0WA 1HW6A 1JI2A 9CGTA 5D2TA 3EEZA 4DM2A 4A3UA 2VELA 1V7YA 3LHYA 3AJ7A 1C7TA 3N2CA 3PAJA 3R0KA 1XDMA 1DE5A 1L2QA 5C9UA 5LIYX 2PCEA 3NXLA 3QSTA 5TF0A 2WHLA 3UXIA 1R87A 4L80A 3J7HA 5BMXA 1NFPA 4YLWA 3ABSA 4GX8A 3NZQA 5DQPA 4WDTA 5AZ1A 2IXVA 1BTCA 5D02A 1A5BA 3W74A 3O05A 3LGGA 3SW6A 4JFSA 3LA4A 4KWWA 4US6A 4GNJA 2XIBA 2ZRZA 3IJLA 4GUJA 4YTTA 3TYEA 2VJXA 1L6GA 1LWJA 3NDOA 3M5YA 3BE7A 1GT8A 2WCGA 3DFTA 2QUMA 3FJ6A 1P7TA 4P5UA 4I9AA 4NZFA 3WUEA 1XQKA 3PF3A 4QE5A 2B4GA 4V2XA 3GU1A 4GXMA 3AIVA 4CKQA 4X60A 3EBVA 5C7VA 4XAPA 3V1HA 4JBRA 3L5LA 3PWGA 4FOKA 4A3YA 2NXGA 3IWPA 5HMDA 1S5NA 5C5YA 5CBJA 3CUZA 5D4YA 4DBWA 2E77A 5CBBA 3KEHA 4I5XA 3S1VA 3UZJA 1RALA 3F03K 3WH5A 2J7FA 1O95A 5A8GA 4EKJA 3CUJA 2YIHA 5DMMA 3K4WA 3ABOA 3JZUA 3NGFA 2YR1A 2PEVA 1XYLA 1EWEA 4H00A 3UR8A 4FO4A 3P62A 2OYMA 3PFMA 4QBXA 3KRSA 4K39A 3LHZA 3UG4A 4OBRA 1W0MA 4YTRA 2E3ZA 1GJWA 4HNLA 3T6CA 2PBGA 3RNDA 4X2RA 1HN1A 1OIMA 2P53A 3PZUA 4IGNA 3MO4A 2CKSA 1OCJA 4QAWA 1G94A 1XLDA 4NXSA 3MKKA 3RYSA 4A4AA 4ATLA 4Q8PA 2YPIA 3TC7A 4JHZA 2TYSA 4XZ9A 2D1ZA 1MZHA 5G5IA 8TIMA 3W27A 1O1HA 4XBSA 1H63A 2PSNA 4BQ2A 4HSHA 5LYRA 4O12A 2H3BA 2D69A 2E4TA 3CPRA 3EWZA 1HL2A 2XVNA 5HJLA 1IE7C 3ZT5A 3BSHA 5FF3A 4PTDA 4M6QA 3R13A 3A24A 3DOPA 3UWWA 1E4MM 3MWAA 3HG2A 2R8WA 1CB7B 3UG8A 1XYZA 4ZO6A 3LRMA 2YCLB 3WN6A 5E70A 1J5TA 4M24A 3QSRA 2GSEA 1C92A 2HROA 3E2SA 4C6NA 1FDJA 1LLOA 3TNOA 4QQ3A 4AD4A 3IIOA 1QPOA 2KZHA 4W7VA 3M4HA 3V35A 1LM1A 4US5D 3BJFA 3M5XA 2BWGA 3IJ8A 1TIWA 3VE9A 3ME3A 3L4YA 3AMKA 4CNOA 3H7UA 3K5XA 1Q63A 1KWKA 4H2CA 3EGJA 3CH9A 1IZKA 2YKKA 4TX8A 5T9BG 5BZAA 2BGSA 3CXOA 1OK6A 1KBBA 3WDIA 2G8ZA 1Q6QA 3SCSA 1FFQA 1ISVA 4B5TA 1A5MC 3GZ3A 1GQLA 2OZ8A 2IUZA 3FA4A 1F6YA 5I3GA 3S8HA 4YWSA 5CGMA 4RCXA 3B0XA 2A21A 2IQDA 4BKNA 3P74A 4MY8A 1FWRA 2O9PA 3BOXA 4LVGA 4RPPA 3KBNA 5HR7A 3D3AA 2V2HA 1BAGA 3H70A 4XZMX 3V5FA 3WJYA 3EOLA 2J7HA 3L2MA 1K7FA 1N82A 3MI3A 4XO6A 5I09A 2DVTA 1UYQA 4AVNA 3C8FA 4NUWA 4H8VA 3HQ1A 1EC9A 4AWEA 4WDUA 1Z41A 2ZZ6A 4G2DA 1AVAA 1RAKA 2ZWZA 3B9DA 1XR2A 1QXLA 4HHHA 1B31A 5C54A 1OFOA 2EF9A 3WLNA 5TNVA 1XD1A 3B8IA 3KBMA 2NQJA 3TTOA 3GR4A 4K37A 2F61A 4EWJA 1WDQA 2ZA2A 2A5HA 4H01A 3TZFA 1F9CA 1BD0A 1XCWA 1P7TB 4FPSA 4DYEA 2ACRA 1CXFA 1WAUA 2WSPA 1QO2A 3V5OA 1TPB1 1A49A 1GZJA 1A3WA 2DZVA 4HCLA 4BY3A 3CEUA 2HZGA 1VRXA 2QEZA 1TPC1 5D05A 2A85A 4DF0A 3M6YA 4Q7BA 1TMLA 1PUDA 2BY0A 3EKGA 4ACZA 1QOQA 2QYGA 1MEWA 1R0MA 2ZZ5A 1UH3A 1PKNA 3G3DA 4FIQA 1OVDA 4PZVA 3EDEA 2Z25A 3CO4A 5FAJA 2CHNA 2VXNA 5A6TC 1KB3A 1F3XA 3OO2A 2MNRA 4JNZA 3ARTA 3VOCA 8XIMA 3ICJA 3H22A 1UC5A 3VD4A 3B0UX 4R7WA 3GXNA 1XLAA 1XXXA 4KCVA 2WMIA 1JDFA 2I7GA 4MWAC 1GVSA 2FZBA 3WQ5A 1V77A 4KCUA 3HB9A 1FXPA 2OEJA 1BVZA 4HZ8A 4V28A 3RJXA 1OCQA 1XGEA 7A3HA 1TTJA 4I5UA 1EXBA 3LD5A 4ZGYA 1XRVA 1BSLA 3TYDA 1EYWA 4NNAA 4UCFA 4WKHA 2ZUVA 3UXLA 3PANA 3TCSA 2BFGA 3DDMA 2F8QA 4YWIA 4OFCA 3TXZA 2E8YA 2Q3RA 3G0SA 5D37A 4R27A 3S46A 4BQ4A 1EDQA 3GFYA 3KZSA 1OZQA 1O5QA 4PBGA 4OBTA 5K9CA 3TLLA 2ALRA 3CQ0A 4ZENA 3UNTA 2XFWA 4QG9A 3BCDA 3VK5A 3GDMA 4RUBA 1NP0A 1F3TA 4JEQA 1PIGA 1GVQA 3TQPA 3APTA 1UA3A 4EF9A 1F74A 4GY7A 4QJ3B 5A8OA 3G1VA 5PTDA 4H9ZA 4AY8A 1X39A 2P8CA 1XLCA 1I1XA 4FNTA 1XISA 3DHDA 5CC6A 4ORMA 1FVPA 1PXGA 2DVXA 4D8LA 1V93A 1PV8A 1K7XA 2QCDA 4JNYA 4O10A 3BGJA 5HUOA 3BICA 3VTRA 5BXSA 2BSLA 3TQVA 4AZGA 2OEKA 4JKKA 1AW1A 1RUSA 1T99A 5CPSA 3V36A 4NP7A 4YMZA 3ARWA 1A3HA 1QNOA 4I90A 4MYXA 1DPMA 3CIWA 1CGWA 3HPXA 2QQ6A 5BMWA 1FWFC 3OPSA 3FN9A 4CVUA 2Y24A 1ZNNA 5LKYA 1IGSA 3N4FA 3WMLA 3VMNA 3CIXA 4DZIA 3G1FA 2AQWA 2FIQA 1AK5A 1D3HA 5DCDA 3WFLA 1REQA 4C6EA 1IGWA 1KFJA 4UFIA 5CXPA 5BW6A 3L12A 2QDEA 1US3A 4DJDD 2Y8UA 1VEPA 4B9ZA 4O19A 2XISA 3FFSA 4JICA 1KTBA 1OT2A 4TX6A 2J6XA 3WJWA 3TTYA 3LK6A 2Z7KA 1XKJA 1TTQA 2ZRVA 5CGQA 1DQXA 5IFPA 1F73A 1BVWA 3V4BA 4DLFA 1FDYA 1UP0A 3LU2A 4RKAA 1WNOA 1DORA 2ZE0A 2PURA 4JIQA 1LL7A 5FSDC 5HBFA 1M04A 2TRSA 4PTWA 2ZWYA 2WJEA 3W76A 1SGJA 3OQEA 3N9SA 3A23A 3ZSSA 1XSKA 2WJZA 1QO5A 1IEQA 3FLUA 1TJRA 4WEVX 1RLDA 3W2UA 1AD4A 1HKWA 1QUMA 4EVZA 5AC5A 1AJZA 1BFNA 4J5NA 1BQCA 1F4AA 3CHFA 1H0IA 4MY9A 3BAWA 2DJXA 1GNXA 1W1VA 5GPRA 3V0SA 3WJSA 4AWUA 3PZIA 1GGOA 1BF2A 1JFHA 2FTPA 2WWDA 2PP1A 3MKVA 3LLFA 2TSYA 3VDBA 1ZBWA 1TYGA 4W84A 3OZOA 2Z1XA 3QMRA 4H19A 5GNYA 5HJXA 4ONVA 1O12A 4UNKA 1HKIA 1OC6A 4NASA 1W5OA 1QJWA 2E8ZA 3M0VA 2INFA 1U22A 1SUXA 3SAZA 2VYOA 1PSCA 4GYKA 3GXMA 3VDGA 3C86A 3VI2A 4R85A 5AECA 4WY0A 3CB8A 3QQ1A 4AIEA 3GBDA 3W2NA 1FWSA 3G8RA 5C2GA 2Y5JA 1H0GA 1EZ2A 1RZMA 4RZ5A 4CNUA 3DX5A 2WMIB 2AGTA 2WMHA 5FJUA 1H5YA 5I79A 3U5YA 2Q3OA 1A53A 2XIQA 2YX0A 4Z1BA 1XBVA 2QNEA 3M0JA 2BY1A 4P7NA 3TU9A 1QNSA 1E6ZA 2XPKA 4DJED 3TKFA 2PDMA 3CUFA 3WMCA 2GL5A 1JCTA 3PBGA 3VIOA 2A79A 1HKMA 2PCQA 4LOCA 3G3MA 4HYWA 1VYSX 1VB9A 1W8GA 3D5HA 3S5NA 1MO0A 1MI3A 4Y8EA 4LJ3A 3VIHA 3UNDA 3L21A 1ZALA 3W6MA 2B7PA 3SUSA 1YXDA 3ZVHB 4HOXA 4KQNA 3O06A 3N73A 2X0HA 2E1DA 3EDFA 4K1WA 2O7QA 3GKAA 3VIIA 4CCZA 4Q3MA 2A3HA 1A5AA 1B3OA 2OQLA 2XM1A 6TAAA 4PB3A 4OBSA 4NRRA 5I3JA 3CQHA 4H8HA 4J4KA 4AHOA 2CEQA 3SSZA 1TVNA 4FHAA 3VDHA 5A8PA 2X7WA 4F0HA 2QCLA 4JN6A 5M17A 4ZFMA 4RJEA 2XINA 4YYFA 3OGVA 2C79A 1NWSA 2V9DA 3BMVA 1Q2SA 3GK0A 2D2JA 4KPLA 5CG7A 3MUCA 4E8GA 1YDOA 3THDA 2VCCA 3DFYA 4GY1A 2V3FA 1F5ZA 2WBGA 3W6LA 3NPWA 3FK4A 1W9DM 4JTRA 1XBYA 2C71A 3W7IA 1E9ZB 3LXBA 2Z4GA 1JRBA 5TD4A 3W9ZA 2UV8G 3CB3A 4IQDA 1REQB 2VDGA 1VBJA 3TYUA 3S9IA 1YNQA 2J6VA 4CCCA 3TFCA 3S47A 2Z1WA 6TIMA 5I7GA 2OTDA 2VFEA 2JE8A 1H1NA 3UZWA 3NVDA 4HTBA 3VZZA 3FXGA 3DI1A 1H5VA 4ZVJA 4UTIA 4X63A 2VCBA 4DWSB 2ACUA 1CNVA 3OHIA 1TQJA 4WDWA 1KBKA 3AU6A 4IFOA 1EA9C 2VI0A 2XG9A 4XAYA 3ZMRA 5KZ6A 1TV3A 1ZAJA 3MMWA 4AVOA 3O9NA 1I2NA 2ZC8A 2ZRUA 3MC5A 3T8QA 5DO8A 2YYUA 4CQ9A 2DUXA 2YCJA 1ZRQA 1X7FA 3C0JA 2YL5A 1KR1A 2HJPA 1Q6DA 3DFQA 4JTCA 3TN6A 1M53A 1CZ1A 1EIBA 5ECUA 1XIIA 3AXKA 2JQXA 4IQLA 1TIMA 4WCJA 4OV4A 3S6OA 5G4WA 3B9NA 2UY4A 2OEMA 3LRLA 3VNJA 1NOFA 4XWUA 2R82A 2YDAA 3VD3A 1PL9A 4HMEA 4F66A 3EB4A 4IGSA 3A4XA 2ZYFA 3AU2A 4BQ5A 3QXBA 4D71A 1HX0A 4Z2GA 1W3JA 2Q09A 3P82A 1KM5A 4E4UA 7PTDA 2DSZA 3ZLFA 2DZSA 3IAPA 1GQJA 2ON3A 3WNPA 1J0JA 3ES8A 4WY0B 1C8QA 4FNPA 1NH6A 2WZEA 1EC7A 1C29A 3KLLA 3T8LA 4LYRA 2XTKA 5JQ9A 4KCWA 1ITCA 2RFGA 1BRLA 1HP5A 3SRHA 3B0VC 1OC5A 1SJBA 1IT7A 3B4UA 1OK4A 1T40A 3AOFA 4O14A 1H4PA 1EDTA 2WSQA 4RXGA 3T0CA 4L4PA 3GVRA 1DIOA 4YN5A 3ECQA 3CH0A 4D9PA 4TMBA 1K8XA 3TMQA 2BLEA 5AC6A 4CQDA 2I57A 1RCOB 1MYRA 4B3ZA 1KR0A 2WAGA 4AYGA 1CT5A 3U48A 3ALFA 4RDVA 1R5YA 2PTYA 1MWOA 3EX2A 5DX7A 2P5NA 4BZYA 5FEZA 3UWVA 3THQA 2G41A 2R1LA 3CQIA 3VKCA 3TQKA 5JUVA 1I0DA 3NUKA 1Q7QA 1S39A 5BOOA 4F0MA 1IIGA 1JPMA 5HQEA 3C2RA 1OCBA 1HJXA 4N9EA 1U5HA 3L68A 3RILA 5LHEA 2CLFA 3GVGA 2HBVA 2W0UA 3OVRA 3OHMB 4MDPA 5MKGB 3PNUA 4PE8A 2DSWA 2IPFA 4XZHA 3NSNA 1CWYA 1ZGDA 4ZB0A 4DB7A 2IKGA 3RR1A 3H8AA 1QW7A 3UZXA 4I9TA 2R1KA 3AHVA 3ZR4A 4LF1A 3SDOA 2WMJA 3ANUA 1VP5A 5JMUA 4QROA 3MT1A 3THCA 1OADA 2HXUA 2E6YA 5FF2A 4H2HA 5F7UA 2DU2A 5EMKA 3CZJA 4PCSA 4EIVA 5E9XA 1J11A 4UOZA 4KETA 4P8UA 3PTQA 1UWUA 1TELA 3LCLA 2ZRWA 3WMSA 2RAGA 2GQ8A 4KMQA 3L23A 2J9ZA 2FPTA 1JIBA 4HPXA 2PB1A 1YTKA 2XSAA 3ZT7A 4HNNA 4OV9A 3GG8A 1WDDA 1YDVA 5GJNA 3QQ0A 4M7TA 2D0HA 2WM0A 2X40A 5DMNA 2YL6A 1GQKA 1CENA 3LQLA 4O57A 1JF6A 4MB5A 3S2CA 2VZSA 4O52A 2XFFA 1NQKA 3DC8A 1BKHA 1YW1A 2BMBA 2GYIA 3G18A 4PFHA 4JTJA 3E3HA 4WJEA 1IR1A 2XH2A 5F4XA 1B3YA 3BUVA 5AN7A 3MJMA 4PMDA 5B7YA 2XWEA 3GE7A 3E2QA 2CZDA 1T96A 2VRKA 4J2MA 1Q6RA 1UR9A 4UTKA 2ACQA 4HNOA 1E3XA 3MYPA 4FMVA 4MNMA 1G5AA 1R3YA 1Q66A 1J0IA 2A0NA 4CD8A 4Q4MA 4GACA 4XUYA 1YRRA 2ZOXA 4D6CA 2A7NA 1R2SA 3COTA 4EPEC 3O07A 3BOFA 3AQUA 3EXRA 1V3IA 3GKFA 3GYEA 2G3FA 4NSBA 2R14A 1GVIA 2INEA 4Y96A 2WHMA 4G56A 1FWEC 4LGXA 1EHAA 3OLEA 3LHTA 4B16A 4PYSA 1OT1A 4H3DA 1JPDX 5BWFA 5C55A 4XVDA 4PBEA 2UY2A 1VFUA 1V6YA 1XI3A 2YFNA 4LSBA 4ZO7A 4CNPA 3BWWA 3A3HA 4NYUA 3WSUA 4BR1A 3DG6A 4PCFA 4PL2A 4S3FA 1K8CA 1UKSA 4LCSA 5F4SA 2NUYA 2Y88A 5T91A 3TJLA 2V3GA 2D73A 4MWAE 3SUTA 1LWIA 3DCPA 2A3EA 3UA4A 2FHBA 3PBMA 1BRLB 3PWIA 1IZJA 2PGEA 2D0GA 1UQYA 5A6AA 1J18A 4BWLC 5CC3A 3OOQA 4B5SA 1J93A 1XLGA 3EWBX 1QPQA 1FCQA 1K9FA 2C1HA 1HTIA 4P7QA 1UQZA 3BG9A 4QSHA 3TFXA 4FLQA 4M82A 4IIFA 4WQ6A 4LB3A 4JYDA 1VCGA 5TQLA 1H7PA 1R3VA 2QPXA 3E9AA 4B3KA 3EOUA 4W7WA 1TMHA 4TV5A 4X9SA 1VYPX 2WMKA 5I24A 4IP5A 3W1XA 4KESA 4IPJA 1FWWA 3R25A 4RE3A 1M7PA 5CC7A 2QCEA 3BQ5A 1UPPA 3AO0A 4KBXA 4H7CA 4LC8A 1JNEA 1IWBA 1IT0A 3DUGA 4LAZA 2RDXA 2VEMA 1RQBA 5A6BD 2CXEA 2WLZA 1C3FA 1FWTA 4JTIA 3PZQA 2DJLA 4H9VA 1C91A 3CWOX 1G7UA 3VZXA 3KOZA 3RO8A 5G2WA 5HR6A 3HG3A 2V38A 3LV6A 3QW4B 4IIBA 1OZMA 5CPLA 1QW9A 4DBEA 4XAFA 3CK5A 1VZWA 3WQVA 1RVGA 4KCTA 1TZ7A 1UP2A 2RDWA 1LF1A 2WBKA 3TSBA 4C6DA 1AMKA 1GTEA 3T2PA 5ABTA 4E3TA 4AZCA 3VGHA 3HQOA 2Y6ZA 4HB7A 1ZJBA 3BZJA 3V3WA 2E25A 4DZAA 3KVMA 5C2XA 3GAYA 4QEEA 3G24A 1VIWA 2W66A 1HJUA 2YXOA 4NNBA 1YYAA 5AYIA 4Z2JA 3WD1A 4EACA 3VD7A 5ENLA 1TWIA 2PWGA 4JTDA 4DBUA 4H41A 4H6KA 3PZNA 3MW7A 3SJNA 4DJDA 3H2CA 2PF0A 4B5NA 5E6YA 2DORA 3V0TA 2H9AA 4EAYA 3KXQA 3TSDA 1B4EA 4R53A 1F05A 3OGRA 3W7GA 5FJTA 1KNWA 3W02A 2A4AA 2H8ZA 2CW6A 2E6FA 5CZJA 4BF9A 3ZO9A 1YHTA 4IG2B 2NLYA 1OGGA 3VIMA 2QHAA 3KDNA 3C52A 1RJRA 2NVAA 3M0KA 2FHCA 3IEBA 3NYZA 2YXXA 3VIJA 1WZKA 2JFEX 3M9YA 2PDJA 5CPMA 2EPNA 3W3OA 3WD2A 3R4IA 4GD0A 1K9EA 4IIGA 1TFVA 3P81A 4Y6GA 3NTYA 4GIAA 1JPIA 4JTLA 2EJAA 4MB1A 1IXPA 2VP8A 5FJIA 1AH3A 4UR7A 1KKOA 4MAVA 1HVXA 4QE1A 1LLZA 3E49A 2G3MA 3ENLA 4ZZ9A 3OQ8A 3AZRA 4K68A 2Y2WA 3I6EA 3W70A 3V5CA 4HU3A 2CBUA 2Q02A 1W1IE 4NG3A 5FF0A 2EPKX 1DJGA 2V5JA 4B2DD 1GVYA 1RQHA 3ARXA 1RD5A 5JBEA 4QDPA 3T78A 1W5MA 4MB4A 5E0KA 4Q32A 1UBSA 2ZVRA 4YTUA 4EF8A 5RUBA 1S38A 1U5VA 2P3ZA 3W07A 1E71M 4D1IA 3GNXA 3C56A 4M5PA 1TX0A 2VURA 3UERA 4PUNA 2O0TA 3UQNA 4DAFA 1SFTA 3AIUA 4PEKA 1POKA 1VR6A 2PRLA 4PCNA 4BI6A 1YEYA 3GR8A 3NR0A 1QMLA 1W9BM 3TV8A 4ZB2A 1MW2A 4YHGA 4A6GA 2WW5A 3CQKA 1F4HA 2ZX9A 2BGQA 4Q8OA 4PMXA 2XSXA 2DT1A 3WQ8A 1PCKA 4IOTA 4GVHA 2DZUA 3LPFA 3R0UA 3UWEA 3E0LA 4LVAA 4ZB5A 4MPQA 1JRCA 2Z28A 4WK9A 1VFOA 3L0GA 4Q8TA 2GQAA 5I3FA 3VCNA 1OINA 2XFRA 2F84A 3C3NA 5I02A 1F61A 3WLJA 5LA0A 4I9MA 1XSJA 4NZJA 2X1TA 3QTGA 1WOAA 1FKWA 2PP3A 5JIPA 4H7VA 1ZP3A 1W3HA 4OOZA 1M41A 4IL0A 4ERIA 3SUUA 1VHNA 3W7LA 1HL8A 1IF2A 6REQA 5ECVA 3T44A 5HK4A 1HZYA 3SFKA 2GUYA 1MZRA 3I3EA 1QI2A 4DQWA 4QR6A 3WF2A 2PU1A 4Y8FA 3O16A 2C0HA 4AZCB 2QCHA 5ABFA 3BAIA 3ARQA 1IEWA 1F3EA 3C2YA 3CYVA 5D2XA 3TW9A 8CGTA 1WDPA 5EPDA 1VFSA 4DRSA 1CB2A 3ELFA 3U8GA 4GKLA 5XIMA 4D8ZA 4HSNA 4O15A 3GSMA 1ME9A 1V6VA 3W1QA 3WELA 2X2GA 2Y7EA 1HP4A 3CL8A 2BTMA 4UCGA 4X22A 3RMJA 3LERA 5F1VA 5KZDA 1VCVA 4H7ZA 2PDLA 1ZY9A 1JZ7A 3PUEA 4HKPA 5CG0A 3QY8A 1Y5XA 3KWSA 1WZMA 2PWFA 3UXKA 3LGDA 5BWAA 2PAJA 2GVEA 3N2XA 3LYEA 3B8VA 2H9AB 3UCQA 3W53A 2OSXA 1KM3A 3A5FA 4HMCA 2OB3A 1ZB5A 3K1GA 4QG6A 4NZ1A 1DQWA 5AVNA 1E1CA 2DSUA 4GIEA 5BROA 3R1ZA 4NAEB 3WQ6A 1TJ0A 5H8UA 2CZFA 2G3IA 4GI9A 3WX7A 1EF2A 3CBWA 3U57A 4O1FA 1BKSA 3D3FA 3ZLHA 2DT3A 3KZPA 3T7VA 5BCAA 2RGLA 1NDZA 1BWVA 1RA0A 4L6DA 1R2RA 1XG3A 4QQUA 4JHOA 3PUOA 1NVMA 4R88A 3SRDA 1EOKA 2PDFA 3SY5A 3ARUA 2J79A 2OOFA 4UTWC 3GWQA 1H2JA 2V0TA 5CZKA 1QHOA 2HS6A 2YYTA 3EDDA 5HQLA 3NOYA 4DX3A 2DZAA 2QF8A 2QMKA 4M6UA 4HP5A 4F3HA 4FNUA 3KLKA 5CKSA 3HQNA 5DF0A 1KGXA 1GG1A 2ADAA 3DENA 3ZYZA 3CWNA 3K4DA 3MMDA 4UQCA 5CSRA 4Q6XA 4JY8A 2YZRA 1ODUA 1L6YA 4M51A 1M01A 1FP8A 2VDHA 1BYCA 4MJZA 4YIWA 1LOQA 4C1LA 3KM8A 1E5JA 4QM1A 1DHKA 4NJGA 4XUGA 2TODA 2D2GA 1ONXA 3AHTA 1QWGA 3QTPA 3W1TA 1Y5VA 2CNCA 3TC3A 3R43A 1JVNA 4GZJA 4F0SA 3LUTA 1JQXA 5KITA 3VINA 3TXVA 2R6OA 4I3GA 4NI8A 3S9ZA 2EJ1A 2QUUA 3N34A 3A5VA 4AYSA 4N0RA 4PA8A 2PDWA 1RV8A 1PX8A 3SECA 4HOWA 4RLIA 5H2ZA 1QCWA 5D2YA 4INFA 3OYZA 4H8UA 1YXCA 1K7EA 1E4LA 2ZBTA 1JCLA 3C0QA 3UYIA 5FESA 2HEJA 2E68A 1RXOB 3WLQA 2C6QA 1G01A 2C19A 5EU9A 3WG6A 1SMDA 2A1YA 3NDZA 3T1GA 1EJWC 5D9OA 2BOFX 1IQ8A 6REQB 2W62A 4DN1A 1PO9A 4UOJA 4IL2A 4IMEA 4HK6A 1PZ2A 3N15A 4N4PA 5DEZA 2CBJA 1MEIA 3FKRA 4J35A 4C90A 5D2WA 4DF1A 1JXJA 1VHCA 3MP5A 2R1MA 3E12A 1KRMA 3NIYA 1W6TA 1VENA 3QOKA 3LX9A 1VBRA 1IXOA 1YPIA 4J28A 4AZBA 1UR2A 3LTPA 2PLCA 3KP1A 3ISIX 3PJTA 3V18A 1GVOA 3R8RA 4U5IA 3PHAA 3GIPA 3CS2A 1Q3NA 7CGTA 2XM2A 1E70M 4B5XA 4GO9A 4GVIA 1GOWA 1TKKA 2REQA 5FKYA 2VFGA 2ALDA 3CAWA 1UW9A 2VX4A 1N7KA 3ITTA 3W00A 3AYVA 4M56A 1WPCA 3FSTA 3I3DA 4DEFA 3URBA 3SQMA 3H2MA 2H8XA 3RLUA 1AH0A 2R91A 5C70A 2BXVA 1H09A 1GOOA 3ITXA 1FWDC 3HMCA 1E1CB 4ZOCA 3N11A 1XH0A 3VKJA 2WZTA 3L2IA 4MNKA 3NQDA 2FKPA 3IVSA 1VH7A 2QVHA 7REQB 1ISWA 5EMLA 4AZHA 2WO5A 3EWWA 1J0HA 1OM0A 4CU6A 4E2VA 1E0VA 2YA2A 1FH7A 4AF0A 4QISA 4S3JA 3M0XA 4XTDA 1B9ZA 1HJSA 5FEWA 1ZQ5A 2QW5A 4O0QA 4UIOA 4KRZA 4C7FA 2JIEA 3CHVA 5D9MA 3G1XA 3ID7A 1TRDA 2NSOA 4IJRA 4R7OA 3W0KA 1Z42A 5DT5A 4W4QA 4CEUC 3GVVA 1UD8A 3PWAA 2QJJA 2QV4A 3GNDA 3XIMA 3CUHA 2IW0A 2WSKA 4F2TA 3UG5A 2BBFA 2GVGA 3EPNA 4GINA 2QUNA 1NEYA 4W89A 5FJPA 1J9YA 4MZ1A 1A0EA 1LRQA 3WBWA 3WLPA 4C6PA 2JIWA 1DWAM 1X1ZA 4K7YA 3F4WA 1DWHM 1JD7A 1MW3A 2UZ9A 2ZDRA 1THFD 1US0A 2XUCA 3UCCA 2VCAA 3C0LA 3W1MA 4DXXA 4JIEA 4Z1AA 2V3EA 5C71A 4YCOA 3WQOA 4HPNA 3GX9A 3GW3A 2V5LA 1Q5MA 1I8JA 4KT2A 1A4LA 4PR4A 1ADOA 3WF3A 1ICSA 2ATSA 2PC8A 3VKAA 5I06A 3VNMA 4J27A 3HA1A 3P8IA 3KHJA 2B0MA 4M8UA 2Q6ZA 2TMDA 1FOBA 1CGTA 2ZC1A 2DZPA 1FWCC 3VIPA 1FKXA 1ZHAA 4D6GA 1X38A 1UASA 3STCA 3AWNA 4FALA 2UY3A 2OELA 1KXQA 1TTIA 1YBQA 2C3ZA 2P50A 4DUWA 2J9YA 2XHYA 2X42A 3L0KA 3WUFA 2BHUA 5HQMA 4H8NA 3GRIA 4JGDA 1CPUA 1W1YA 5BXTA 1CXLA 3E2VA 3II1A 1P43A 5A6MA 4LAMA 1UJPA 1VAHA 1UR1A 3QM3A 4HZ6A 1YTDA 4HCHA 2J24A 1NP2A 3AYTA 4F9DA 3WQDA 2GGIA 2DT0A 4WR3A 2WVVA 2G0WA 2QMJA 3W81A 2WCSA 1SO3A 3W1AA 4A8NA 4RX0A 1LJYA 1Q7MA 2VKZG 3QVQA 1Q2RA 3PBUA 1Q65A 1FUYA 1Q4WA 3LRKA 3IV3A 3TZNA 2FH6A 3B0PA 2WC7A 2BXZA 3HQPA 2IPGA 4LVDA 5A2AA 3OEXA 1M5WA 4BI5A 3BAJA 4JPGA 1OFPA 3H55A 1OFBA 4JX6A 3W7KA 3DECA 2PTDA 4LUTA 3ATZA 1BVNP 4PCTA 1UD2A 1ZCOA 1L6FA 1JD9A 1ECQA 2O55A 2WB5A 1TWWA 3RU6A 4EPBC 1X8FA 2OPJA 3PULA 2WK2A 3JS3A 4K8HA 4ADUA 1XRFA 3WEZA 1NELA 3RX2A 3BLFA 4ASTA 4KGLA 3HFTA 1M1BA 2DZXA 4J3XA 4GYFA 5H8PA 2REQB 3LSBA 1A4MA 3M6DA 5I78A 3A13A 1Z44A 2ASHA 4FOJA 1SPQA 2EKGA 4NVTA 1S2TA 3F7JA 5FF4A 3MV11 3NQ7A 3TWBA 3CM4A 3G77A 2ANUA 1ZJHA 4UTMA 2F7FA 1ISXA 2IS7A 3OBEA 2GUBA 5GJMA 1WQ5A 2DT2A 3FGCA 3HOJA 4C60A 3HGRA 3WQPA 5LIKX 4I7VA 3UWQA 3HF3A 3A3WA 2FZ8A 1IZCA 3GG7A 1KFLA 3BH4A 3I68A 1IIHA 4GVFA 1K4GA 4R3UA 1FHVA 2F6KA 3W1NA 1Z9AA 1BYAA 1DJXA 4Z42C 2YXGA 4XV0A 1DHPA 3WD4A 4B5VA 1IEVA 4HNTA 1MFVA 2JALA 1VBGA 4QSFA 1PVNA 3E5BA 1WYIA 3T42A 3APGA 3CYJA 4RZ6A 1GYLA 1VFTA 3G1RA 4GJIA 4S3KA 4IIEA 4R9XA 3AI0A 3O6DA 1UH2A 1FBAA 4O17A 1P0DA 2V3DA 4MVAA 1FCVA 3NQMA 1A3XA 1O66A 1RBOB 3KFTA 3EWDA 2HE8A 1EGVA 1K70A 1NWTA 2XSBA 3E0VA 4GJ1A 4B2DA 3ZR5A 2GGJA 3EKLA 4GZ7A 4F4RA 1RR2A 3WJXA 4RNFA 5FJJA 3T40A 4EWND 4W8LA 3PC0A 4XD4A 1O6IA 3O3RA 3GAKA 3TLQA 1SW7A 3P8JA 4DO5A 1D8WA 1W1ZA 1LQ0A 2X2YA 3HIJA 1UUQA 2OU4A 4Y9NA 1OIFA 2GK1A 5LXXA 4ROPA 1R7OA 3O15A 3HG5A 3RLHA 1DXFA 4ZTYA 3IRSA 3CO8A 3L5AA 3PJUA 4NT0A 4XG1A 4DWSC 2QVNA 4Z2LA 2YDQA 3BVJA 2PWHA 2J8GA 4FAMA 5GJPA 3FSUA 4XAZA 5K4ZA 4DXKA 3P5YA 4AEEA 1TJPA 2R94A 1EO7A 3WLSA 1MNZA 4AD3A 3WQ4A 1JDDA 3RCYA 4GYPA 4EK7A 1UBPC 4QRNA 3NQBA 1L2UA 2Y63A 1ZUAX 5B7ZA 4OWGA 3ZXWA 3SBFA 3V16A 2HWGA 4LFYA 4L1XA 3LM7A 1LORA 4GI8A 4X61A 3NDYA 5U7SA 4B92A 4F2UA 2XIJA 1MMFA 3KAOA 3P60A 1TPH1 4JN7A 2WQPA 4WGXA 4OIFA 3LV5A 3BQ6A 2OT1A 4Q8WA 2WCAA 3M46A 3NO1A 4DJFC 4C6LA 2GSJA 4IH3A 5DELA 4WRHA 4OHQA 4M6PA 3DKLA 1GQNA 2PBOA 3OVPA 1AZ2A 7XIMA 1VLWA 2C13A 1AW5A 2QCNA 1ZENA 2OFJA 1WP6A 3HU7A 4X9YA 4W7UA 1ENUA 1TVPA 2DY3A 3EWXA 4AFYA 3P14A 3I7QA 4U4MA 3M1ZA 2ZZ1A 4TO8A 2ZICA 4AX6A 5LZLA 4MAZA 4JKLA 3PZMA 2VC5A 4GVGA 4I7UA 3W7OA 2ACSA 2C91A 4J3WA 4E38A 4S3DA 3N04A 3C4UA 3IUIA 4LW7A 3ZOAA 4DWDA 1QAPA 3QF0A 3UZYA 5IFTA 2GQ9A 2YZ5A 4NKCA 3OG2A 1JR1A 1OX4A 4AW7A 3QGAC 4FX6M 4MFDA 1XIDA 2QDGA 3DAQA 4AB4A 4TVUA 4EX4A 1I2OA 1VPQA 1QPKA 2Q8ZA 2PLMA 3TA9A 3NNTA 1B5TA 3VKDA 2Z29A 4ZSTA 5I03A 4IPPA 2PZ0A 2PC4A 3O0KA 3TAOA 1OBAA 2EG7A 3FGCB 4FF5A 3CLMA 3STEA 1PKMA 1GOXA 3AS3A 3W7EA 2C16A 4IM4A 4GOAA 5D9PA 3W1RA 3WH9A 3M0HA 1NSJA 2F2HA 4A3QA 3LCWA 4H9MA 2PRMA 1LQ2A 1MUCA 2GGHA 1BG4A 3KOXA 5GNZA 4QP0A 4WOQA 5IOBA 4MPKA 4XZNX 1Y0EA 4FS9A 3UETA 1ZPTA 1QPRA 5KTLA 3V0UA 3VNKA 1RVKA 1O60A 4TOQA 3QFEA 1C93A 1J5SA 2RGMA 1GKRA 5MF5A 8RUCA 3KOFA 2DQWA 4NJKA 3TQ0A 1TSIA 3D0CA 1UB3A 1HL9A 1C7SA 4BEUA 2ZADA 4I5RA 2ZIDA 1H49A 3WNOA 1BXNA 3BAKA 1U30A 2EKCA 2VZTA 4MZYA 4HQVA 1PWMA 4GI4A 1I60A 1XFCA 3QYQA 4G5DA 3H4GA 1U83A 3FS2A 1VGAA 1ADSA 3N25A 4L56A 1XG4A 3UU0A 1GONA 3S3GA 2AMXA 5HINA 1A5UA 1KFBA 1MXGA 4PUKA 4CNNA 3BW4A 5SWUA 4S23A 1UR8A 2VT0A 3GC4A 1A47A 3KVKA 5JVLA 5HWJA 4F0RA 5DMLA 3R7MA 4UFMA 1XJBA 3H4WA 1SZRA 1LBFA 3SZ8A 3UPBA 2VQTA 4Z2IA 3THUA 1GKQA 2POTA 2XZ9A 5CPOA 1OFQA 4H04A 1ZU8A 4ADSA 3VGDA 2GFTA 2OXNA 3GXPA 1KXTA 3QZAA 1EOMA 5A3HA 3NGJA 1W32A 1L8PA 5DLCA 4Q22A 4ECLA 1O4UA 1O5KA 4Y2WA 4IPNB 1NF0A 1UR4A 4J7RA 3GNOA 4BS0A 2XDFA 3UESA 2ZXAA 1ZL1A 2A3AA 2A6LA 3IVUA 2MANA 3S6TA 4OUEA 4LH8A 2WANA 3EDJA 4HCDA 2OYLA 1V6UA 2P76A 4KW2A 4PRRA 5CAHA 3FYYA 3PPCA 1KV5A 4PMOA 4BQ3A 4LC6A 2D3NA 3QKEA 4LV9A 1SJCA 2B7QA 1EC8A 4GO8A 4LS2A 3I7SA 1A0CA 3L66A 3TN4A 2VD9A 3G1DA 1K03A 4XZBA 2YW4A 5D33A 2J4GA 3FVMA 3QV9A 3LGEA 2C7FA 2VC6A 4C6IA 4FI4A 3CC1A 5DN1A 1KXHA 4WKAA 1Q6EA 2TPSA 2E67A 3QGKC 4O4VA 2CCRA 2HS8A 4RNIA 2ESCA 4JTEA 2J77A 2X1RA 2NUWA 1RA5A 2PDKA 4V1XA 5T8GA 2CWNA 2BVDA 3OBKA 4QXIA 1Q8JA 1XIMA 4AMAA 4OKDA 4HJFA 4QTGA 3WZ0E 2DQXA 4CQBA 4MY1A 2DFAA 4QCFA 3DZ1A 3W2LA 4S3EA 5AHEA 3N3TA 4ZOAA 3UJ2A 2VTFA 5BRBA 4ZBCA 1Z8AA 3MHFA 4L4MA 2DVUA 3ZR6A 3T0DA 3MZNA 1J01A 2CLIA 1WXZA 2I9UA 1ZBKA 1OX4B 4BF7A 1B3WA 1E0XA 3R58A 4G9PA 2WOQA 3TVAA 1AL8A 2QIWA 1VJSA 4FXSA 1TPUA 3MHGA 2ISWA 1ZS2A 4RE0A 4FR6A 2XGZA 2JBMA 1X1OA 2VX7A 3IK4A 5K9DA 4UFKA 2VC7A 1R6WA 3MUZ1 4BCEA 4JQAA 5EKYA 4LAKA 4IT1A 5D32A 4EXQA 1TPDA 3SJ3A 4Q33A 1H60A 2FYMA 2X1UA 3N4EA 4IGMA 3VZYA 2E7FA 3G22A 2CBVA 2EGZA 3VXGA 4L6OA 2GPTA 4ZXLA 4C6KA 2VEGA 1G1YA 3OU8A 4RDYA 1HUVA 1M7JA 1FH9A 3VIKA 4JFTA 3P0XA 4O1CA 3PBYA 5LIUX 3KCJA 2AL2B 1R3RA 4TX9A 4MM1A 2BDQA 3NL2A 4AXNA 5G4HC 1EX5A 2HQAA 4L7ZA 4GZEA 3PPGA 4DHGA 5G4EA 4RNHA 3GXDA 4GHRA 3CAKA 1AJ0A 4BI7A 1E9IA 4S3GA 3LZ5A 4UUIA 4N9CA 2FGZA 4UTTA 3RM9A 4FXFA 4HOZA 4CD6A 3O6YX 4KWOA 3EX1A 4RPQA 1LROA 1PKLA 2PWUA 4LUYA 5AFDA 5REQA 1F7BA 1ME7A 4P61A 3VX1A 2E5CA 1P6WA 3CGTA 4LU0A 1XWYA 2GLKA 3SQSA 1ZAHA 4LY4A 2PWVA 5L6UA 4IP4A 2J25A 1W31A 1BG9A 2C0AA 3I65A 3LB0A 1Y7VA 1JQVA 3OJGA 3QW3A 4ZEPA 1MUWA 3TTSA 3TH6A 5CJ5A 5I3DA 3MS8A 2ZZ7A 2E6AA 1EP3A 1K3UA 3FAXA 3H12A 4ZXOA 3T81A 1VJZA 3W7DA 5M3WA 3ZM8A 2ZTJA 1W3TA 3M47A 2W4XA 2DIJA 3CUGA 1SFSA 2XVPA 1KBLA 4XKMA 1Q6LA 4Q7NA 4Y7EA 2W63A 2W61A 4GABA 1OFAA 3CJPA 1NF7A 4H9TA 4FR1A 3BC9A 3DHFA 1UWAA 2IQTA 2Y7DA 4PUDA 3WQWA 1NM9A 4L9YA 1M7XA 3GNRA 1ONEA 2YSWA 4EANA 3GQYA 4TTUA 3QN3A 4UTLA 4PB4A 3QZ6A 1XLLA 3UWUA 2FMOA 3ANYA 5A2CA 1QVBA 3SUVA 1KD0A 4ADTA 1JDCA 1KM0A 1D7FA 5FCZA 6CGTA 3EOEA 1FHUA 1H11A 1I2PA 3N2OA 3DERA 3T05A 3G8EA 4E3VA 2Y5SA 4ZQCA 3UPMA 4QIUA 3IPWA 3SQLA 4D8AA 3IIXA 5HANA 1V02A 4JFVA 4G7EA 3TW7A 3UWZA 2NV2A 2DGAA 1ZJAA 1XFBA 4D1JA 5K9XA 5IHRA 3CPGA 4GQBA 2BZNA 4LAOA 5KETA 1QFEA 4JTFA 1E9YB 4ICCX 1FRBA 4EOUA 3VC5A 1EX1A 4NX0A 2HNHA 5D38A 5I5RA 1CECA 2H6RA 5LNSA 1QOXA 4FNQA 5E0CA 4OT7A 3UPWA 1FWGC 3SRKA 4UTHA 2JKAA 3EXTA 4TVDA 3LCGA 1QATA 5M2FX 3PY2A 4OECA 3SCPA 2NXIA 2OWXA 3RU8X 2I14A 1GEQA 4QEHA 3OLIA 3H4XA 1X98A 4HN4A 2WM1A 3S5YA 3M16A 4KF1A 4NAFA 5XINA 4BK9A 2VL4A 1HT6A 3ALGA 3NQCA 3NPUA 3Q4DA 4E4PA 3AALA 5CC5A 5AHIA 1M68A 4RV3A 1G7VA 2BODX 5BXPA 2QAFA 4CN4A 1TR1A 1H41A 1A5KC 4IIHA 3AXIA 3I4KA 4IX0A 1TQXA 5DBUA 5DY2A 3M5ZA 1G4PA 4WKFA 1WBJA 4B9YA 3LNMA 4E8CA 1P0NA 3RCMA 3JU2A 2H90A 5F2GA 3FV9A 2VD8A 2VRJA 1RLCL 1C8VA 5CEWA 1KM4A 4O4WA 1XINA 3PSWA 3JW7A 1RD6A 3GUGA 4P8XA 1MW0A 2VVNA 3OLGA 3NYDA 4Q8VA 3W84A 3W86A 3SUWA 3C2FA 1TZZA 4HK5A 1NU5A 3BMXA 5IHSA 4RW5A 1Y8BA 3C6CA 4U3AA 4TXEA 1JL8A 2EG8A 4WZHA 4DUXA 4FXJA 1I2QA 1Q7ZA 2X30A 2EPHA 3H6OA 1W37A 1TWDA 3KUMA 1CGUA 3ZWTA 3EB3A 5CJMA 1OX6A 3TCEA 1UC4A 3PAOA 4DYKA 2NWRA 4PUEA 4AY1A 1K8ZA 4CEXC 4JCLA 9XIMA 2QXWA 2X05A 3UEQA 3PN8A 5REQB 4H9XA 4HNUA 2YDRA 2ISSA 4AZIA 3GIYA 2V2DA 3YPIA 5I2UA 1UZDA 2HE5A 1GOKA 4KWSA 2VUNA 1GK8A 5J5RA 2G3NA 3N2TA 2XH7A 1DTUA 2O56A 3GW0A 5D2VA 3S1GA 5AHLA 1JZ2A 4D2JA 1LG1A 1VJIA 4AD5A 1XYCA 2Y85A 3WENA 3S1UA 4DJDC 1TX2A 4HMDA 3WFAA 4U2ZA 3W72A 3GH7A 4HA0A 1YDYA 2G5WA 2PGRA 3EKZA 2B31A 4XX6A 1OF8A 3NZ1A 2ZX6A 2GJPA 3QC3A 4LS0A 1WKFA 3LZ3A 3W6YA 3H21A 2V5CA 4LXFA 1ICQA 4I6KA 3UVIA 1UOZA 1A80A 4IMCA 2ZX5A 5HNRA 3C2VA 3QLLA 3OYXA 2X41A 2YL8A 1DWIM 4WSKA 1NWRA 3W7PA 3GC2A 3HO8A 2GOKA 5LNRA 1XIEA 5DT7A 1BPLB 1AQHA 1CGXA 1N8FA 4NF7A 1G4TA 4KGJA 3O0FA 2A7PA 1XIHA 3U4FA 1HO1A 4EP8C 3NQEA 1RP8A 2DV0A 1GTHA 1UD5A 1FHDA 3ZJKA 1CGVA 4CUCA 2WKLA 2QGYA 3VNYA 2QV5A 3VX0A 1K4HA 3L7RA 3P2VA 4KKXA 1OFRA 1WDSA 3WK3A 3URNA 4ZQOA 3I10A 4PUWA 5G2HA 4M6VA 2DIKA 3MUAA 3ZJ7A 1FWJC 2NZLA 3NL5A 4AZ7A 1GPFA 1DL3A 3GDKA 3LLDA 1P0BA 3WQEA 3WEMA 4MIMA 3VCCA 2PD9A 3DFPA 1OC7A 4AD1A 1MDLA 2DEPA 4PUMA 4CU7A 1MEHA 4H9UA 3QY7A 4UZUA 4Q4KA 4NY2A 1CEOA 4LT9A 1GJPA 3MJYA 3BLLA 2J78A 1KM2A 3B8TA 2MUCA 4JTGA 2BGNE 4HVXA 2DPEA 3VKKA 5CSUA 2DW6A 2D22A 4DJEC 1RCQA 1KWGA 1C9DA 1KGWA 4D6DA 4L65A 4DZ5A 3N6QA 5DRCA 5HNNA 2VGIA 1ISZA 1W56A 4GQRA 4GC4A 3QFWA 2ZUWA 4MKVA 5J5DA 4IMGA 4X2PA 1B3VA 3GHRA 1X97A 4PMUA 4EPKA 3WD0A 1A0DA 1IR2A 1ODZA 1SSDA 1XIGA 3BW2A 2JK2A 3S5SA 4S2CA 1T41A 1I6NA 3CZKA 3ITCA 2YGYA 2Y70A 2PDYA 3KWXA 9XIAA 3MCOA 3L2LA