3V35A

Aldose reductase complexed with a nitro compound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v35A00
3V35A 3UZZA 5LIXX 3F7JA 4WEVX 4GCAA 1M9HA 3H4GA 4DBSA 3WBYA 1LWIA 3UZYA 2FZBA 3CV6A 3O3RA 1RY8A 4GA8A 1S2AA 3V0SA 5AZ0A 1PWMA 2HDJA 5LIUX 3LBOA 3KRBA 1IEIA 2PDIA 1X97A 2HEJA 2PDGA 3ERPA 4LB4A 2IKIA 1PWLA 3R43A 1PYFA 2BP1A 3LNMA 4GQGA 4JQ2A 4LAZA 2C91A 2HE5A 4XVEA 3GHSA 3EAUA 4JQ4A 1C9WA 1PZ1A 2PDNA 3D3FA 4G5DA 3GUGA 5C7HA 4H7CA 4R9OA 3MC5A 3S3GA 2ACQA 3GHUA 4YVPA 2ACRA 3EB4A 3DN5A 4JTRA 4YS1A 2FGBA 3BCJA 4QBXA 2ACSA 4JQ1A 2FZ8A 5KETA 3O0KA 4YVVA 2IQDA 2PDUA 2PZNA 3CMFA 2PDBA 2NVDA 1JEZA 2DV0A 4YU1A 1EKOA 2FVLA 4HMNA 4WRHA 4XZIA 4LBRA 4EXAA 4WDXA 5HA7A 4JTAA 1Q13A 5HNUA 2IPFA 3T42A 3UYIA 2FZ9A 4FA3A 2CLPA 2PDQA 4DZ5A 5LIKX 3GHTA 3WBXA 3QKZA 2INZA 1T41A 2I16A 3COTA 2BGSA 2PF8A 3UP8A 1Q5MA 5HNTA 2PDJA 5DANA 1LQAA 1R38A 4ICCX 3ONCA 1Z8AA 3ONBA 4LBSA 3P2VA 4IGSA 1SM9A 3UGRA 1ZSXA 4Q3MA 3R6IA 4QXIA 2F38A 3R8GA 1MI3A 1AZ2A 3RX4A 4XVDA 1HW6A 3CASA 3FJNA 2FZDA 2PDCA 5JH2A 3C3UA 1ZGDA 2WZTA 4NKCA 3BUVA 4JQ3A 3Q67A 4RPQA 2IS7A 1A80A 4PR4A 3EB3A 4XO7A 4JTCA 1YNQA 3R7MA 3R58A 4DBWA 4MHBA 4ZFCA 3LN3A 1S1RA 1VP5A 1RY0A 2VDGA 1YE4A 5LIYX 4XO6A 1AZ1A 2PDKA 3M64A 3N6QA 3WCZA 4XZNX 4PUWA 3Q65A 3LD5A 1VBJA 2INEA 3R8HA 1US0A 2IKJA 1EXBA 4HBKA 2PD5A 4XAPA 2R24A 1Z9AA 3UWEA 3V0TA 4GABA 3WBWA 4FAMA 2ALRA 1J96A 1ZQ5A 3RX2A 1XJBA 5JH1A 3FX4A 4JTDA 2R9RA 3LQLA 1QRQA 5LIWX 2DUXA 3LQGA 2PDMA 1S1PA 3M0IA 4XZMX 4GIEA 2HV5A 3N2TA 3UZXA 4EXBA 1AFSA 2BGQA 4XZLX 1T40A 3UZWA 1YE6A 1K8CA 2AGTA 4GQ0A 2IKGA 3WG6A 2PDFA 4AUBA 1Z3NA 4YVXA 3G5EA 1ADSA 4L1XA 4PRTA 2PFHA 3UFYA 2F2KA 2IPGA 2PDLA 4FALA 1RALA 4JTQA 2I17A 2J8TA 1OG6A 3MB9A 1GVEA 4DBUA 4WDTA 4H8NA 1XGDA 3VXGA 3RX3A 3CAVA 1MZRA 3V36A 2WZMA 4JIHA 4XK2A 1EF3A 1MRQA 1AH3A 2IQ0A 3UG8A 1XF0A 4LB3A 2HVOA 1EL3A 4Q7BA 2QXWA 3CV7A 2A79A 2PD9A 5AZ1A 4PMJA 1UR3M 3R94A 2HVNA 3LUTA 2PDXA 4XZHA 1Z89A 1YNPA 3G1RA 4JIRA 3BV7A 1X98A 1FRBA 1QWKA 1AH4A 3CAQA 4WGHA 2PDWA 3B3DA 4F40A 4JQAA 1S2CA 2PDYA 4FZIA 2IKHA 2DUZA 4PRRA 4OTKA 4L1WA 4I5XA 4JIIX 3LZ5A 2ACUA 3NTYA 1AH0A 2IPWA 2PDPA 1PZ0A 1ZUAX 4PUUA 3U2CA 4WDWA 2ISFA 1IHIA 3BURA 3DOPA 4GACA 4QR6A 3V0UA 4IJCA 2P5NA 2HE8A 2IPJA 4IJRA 1HQTA 3GHRA 5M2FX 3LENA 2PDHA 4QX4A 3LZ3A 4ASTA 2PEVA 1X96A 4LAUA 3M4HA 3H7RA 2NVCA 4WDUA 3LEPA 3H7UA
chains in the Genus database with same CATH superfamily
3NZRA 1QW9A 4ZQOA 2WMHA 4IG2A 2Z7KA 2CLEA 3FCPA 2C1IA 3BL3A 1JCYA 4AIEA 1W1IE 4TVDA 3TN6A 3FK4A 3NQ6A 1QW7A 1UWAA 1S2WA 3LNPA 1E55A 1YRRA 3GNOA 1VIWA 3THUA 1RJRA 1RY8A 4WKFA 1AW1A 1XYFA 4F4RA 4WOZA 3W7RA 2ZRXA 3EWBX 1UR8A 3M7WA 3MO7A 3WK3A 2PBGA 3WLOA 1RCQA 1CNVA 2VRJA 4H00A 4JEQA 2V69A 1UWRA 2PTZA 3FY1A 1DQUA 3G24A 4GMEA 1C9WA 1NP0A 5D8ZA 3BLEA 3EWYA 3W28A 1G7VA 3VK5A 2V68A 4WSJA 1BXCA 3NQBA 3CHCA 2PC4A 2VVNA 2G37A 2PS2A 3BJSA 5FA5A 3EKGA 4AMCA 3MC5A 3HA1A 3WLLA 1XLCA 1PCWA 2WMIA 3G1HA 4U33A 3VKBA 1TV2A 3WMCA 3MZ2A 1KR0A 3PNZA 4ORMA 4DJFC 4GXMA 3AYRA 1KCXA 4DVOA 4GCXA 1K70A 2VTFA 1M7JA 4DXKA 4MJMA 1E43A 2WWDA 3ICJA 3LXCA 3W4RA 4F9DA 2UV8G 4GIYA 5FEWA 4AIOA 1EKOA 2ISVA 4XZIA 4UBPC 4AHOA 3KS6A 1BFNA 1QPKA 2E6YA 3PZUA 4KWVA 3IPWA 5HNUA 3UYIA 5A8PA 2ISDA 1MEIA 1MW3A 4Y7EA 5IDZA 5XIMA 3FKRA 1GVQA 3LMYA 1OK4A 3L4UA 1SJAA 4KIRA 2BBFA 4I5UA 2PDJA 1T5AA 2HTMA 1ZJAA 2G0WA 5FF7A 2V5DA 4UFJA 3SADA 1PDYA 1SM9A 3T2OA 3IGHX 1ZTVA 1F76A 1REQB 1E6QM 4GIRA 5HJYA 4NQ1A 1Q6LA 3GR7A 4N9DA 2Z6IA 2Z29A 1M6JA 2VFIA 2QQ6A 4PCTA 3HZ3A 4Q7IA 2NZLA 3EKZA 2VDGA 5HR6A 2XVPA 1YDOA 5BZAA 4JTFA 4MNLA 3RM4A 2ADAA 5BNKA 1QNSA 3DESA 4GYPC 3LD5A 4O1BA 4PE8A 3WFLA 2PGEA 3BOXA 1OZMA 3M6DA 4A22A 1UWIA 5EL1A 4DM2A 3GB6A 1CXLA 3AS2A 4LUSA 2RKXA 1XJBA 1IXOA 4FEZA 3UETA 1FWAC 3W71A 3SZ8A 1QRQA 3VAVA 1LWJA 1LT8A 1FA2A 3GIPA 4LNYA 3Q45A 3S1VA 3EZ4A 2Q09A 3IV3A 1F6YA 1QHOA 3SCRA 4BQ2A 3MQTA 1LBLA 3DERA 3OBEA 3QOKA 1DWJM 4LRSA 1A3HA 1H7PA 4Q6JA 3PM6A 4LALA 1UH4A 3W7PA 2E1WA 4GY0A 5C2GA 5F2GA 4X0NA 4DWSB 4C6OA 2GUBA 4GO9A 3T4CA 1XBXA 2ZUWA 2BXZA 1E0WA 3CPRA 4EP8C 4EPBC 2H8XA 1K7XA 4IXXA 3ARRA 4C6KA 4DNMA 3E38A 1BSLA 3ABQA 5BW6A 1V6UA 1MFVA 4QS5A 2E5CA 2Y62A 4Y9NA 3PFMA 4JTUA 3VNKA 3DYMA 3T8LA 1XIHA 4DPQA 3RU8X 1Q6OA 3S1UA 3QY6A 2VC9A 4CD7A 1IZCA 3EOSA 2C1GA 5JBDA 4G7FA 5HQMA 3RPMA 1Q3NA 4D2JA 3CWOX 1LF1A 1JNDA 5DY2A 3L4ZA 3VIPA 3BJTA 1TR1A 1VENA 3LCLA 3T0TA 1S5NA 1I45A 3AU2A 2ZX9A 2W91A 5DELA 2W5FA 5LNWA 3CAQA 4HP5A 2VZUA 4OUIA 1ADDA 1A0CA 4JQAA 5FD0A 2WCGA 4LU0A 2NUYA 2XWDA 1WXYA 1TA3A 3DIPA 3NURA 3MSGA 1EDGA 1L8PA 4HPGA 1X8CA 4LUTB 2BVYA 1ZU8A 3DI1A 3USBA 3TU9A 3U2CA 3SN1A 1K7EA 3NQMA 5G1YA 3O2LA 4WF7A 4Q8WA 1O5RA 3UJFA 3VGBA 3AHVA 1T6MA 2TYSA 3WDJA 3W1NA 2XWEA 1X96A 4IMEA 5DCBA 1UR2A 3CLMA 2C79A 2QUUA 2VZSA 1HJVA 1IR1A 4NT0A 1OT2A 3ISIX 2DSVA 3F7JA 2WQPA 1KXVA 2EHHA 1M9HA 3HG5A 1XYLA 3WK0A 4NI3A 2OZTA 1QK2A 2PP3A 1CB2A 2WSPA 1LWIA 3NIYA 3OJGA 1E6XM 3DFSA 1HJSA 5FCZA 4EF8A 4GA8A 1DJGA 5AZ0A 4TVCA 5D04C 1R0MA 2BWGA 5CZ0A 4ZCWA 3ARZA 3T9PA 3SO7A 1OADA 4DJFA 1M7OA 4KKXA 5CPTA 1E15A 2OTDA 2ZWYA 4CU7A 1GQNA 3F2BA 4MFDA 1G0CA 2V67A 2PDNA 1US2A 3P67A 1JGIA 3WJXA 2J25A 3ARVA 1D8WA 4P8XA 4O8RA 3SUTA 1JQVA 4NU7A 5FL1A 4JTKA 2BV9A 1HJUA 1ZL1A 4O54A 1F3TA 2QCCA 2QAFA 4CKQA 1WDWA 1LQ2A 3K1DA 5E1QA 5FOOA 5CPNA 3BSMA 4NJGA 4YS1A 3FV9A 2HISA 3WLTA 3VKAA 1FHLA 2OKTA 3TFXA 2OT0A 3LOTA 4HMDA 1RK5A 4K8GA 3RPDA 3PZMA 1IXQA 2FTYA 4S3FA 4MYXA 2L5HA 1RPKA 3NO1A 3OLGA 1TE6A 3ARWA 3T1GA 1WZAA 1MSSA 3ATYA 4DQWA 1ISYA 1FWTA 2ZRYA 2EPKX 2HNHA 3WKZA 4FF7A 1LG2A 4GZIA 1OBAA 1XYZA 3MYOA 3G0XA 3SEPA 2E25A 3NPVA 1CPUA 3LHYA 4DNHA 2Q3OA 4AXKA 2J7GA 3DAQA 4PTMA 2OSWA 4AY7A 4MSSA 4B5NA 1KFEA 2WSKA 4TIMA 2WC7A 3Q58A 5G4HC 5BCAA 5E93A 1VLWA 4QG8A 4TTUA 3QM3A 3KW3A 3C61A 3TQKA 3ONCA 3ID7A 1HO1A 2XJ7A 1OVDA 5HUPA 2XIJA 3C56A 4XKYA 1A3WA 2UWFA 3AIWA 5I77A 1MXGA 3BTNA 3RX4A 3W2MA 3GH4A 4GISA 1DTUA 2CBVA 4DN1A 4QRNA 4MLJA 3PAJA 4KFOA 1XPYA 3AHZA 2YXXA 3RRAA 1PIGA 1DE5A 2AAMA 1NQ6A 3DFYA 1A80A 4ZO6A 4AX6A 2W9MA 3AQUA 4OV4A 4JTCA 4GVIA 5JUVA 3MWCA 2XVKA 4ERGA 1QUMA 4FXRA 4C6FA 2CEQA 1S1RA 2X16A 5I3DA 3SIMA 7REQB 1GONA 3OPSA 2JF7A 3KVKA 3VGEA 4CNNA 4INFA 2X0YA 4GYFA 4BZYA 4K37A 4XBSA 4R7JA 1XYCA 4QISA 3G1SA 3AMGA 3BOFA 1EC8A 4FP1A 3R8HA 1L6SA 2IKJA 4YL2A 3O9NA 3WQWA 4DYJA 3VUSA 3NEHA 3OA5A 2Z1VA 3CYJA 3CZLA 4BK9A 2CWNA 1E72M 1UW9A 3STGA 1B3XA 2GLKA 4Q4QA 4ZQNA 4ZB2A 3V4BA 3KTSA 4FR6A 4TOQA 2QPSA 5G4EA 5EYWA 1JF5A 1EEPA 5D9OA 1HJXA 4Q6XA 4ENLA 2GQAA 3GIQA 1YE6A 3H2CA 1EUAA 1B54A 5REQB 4HNOA 5F1VA 1UC4A 2A3LA 2JGQA 3G5EA 2W66A 3AIEA 4IIEA 4NNAA 1DEDA 4G8TA 3ABSA 4X9SA 1I2OA 3DFNA 2FPTA 1G6CA 1XLMA 4AX7A 1VYRA 3NZ1A 3WLIA 4UQ9A 4WK9A 3SIZA 1HNYA 5C8BB 1DJXA 5D2WA 1OG6A 4PUEA 2QCMA 3GU2A 4ORIA 1CENA 1W9XA 2XFFA 2PGFA 4HNNA 1SO3A 1XGDA 2GOUA 4KWWA 3CAVA 4YWIA 1WBHA 4BI7A 3SY5A 3VGGA 3V36A 2QDDA 3KWXA 2WJDA 4BF9A 4DJDC 1AH3A 1EJUC 2QZRA 2GQ9A 3TQ0A 3PSWA 2W61A 1OX6A 4DELA 3CQ0A 3UCDA 4ZXLA 4H8UA 2X2YA 3NVTA 3PVFA 1P1XA 1TMHA 3LGEA 1OABA 1ZAHA 1Z48A 3W70A 1ICPA 1Q85A 4HPNA 3A21A 4H6KA 1Q45A 3TC6A 1BLIA 1NF0A 1ZP4A 1PTGA 4URIA 2UZ9A 1IQ8A 1QWGA 4H9ZA 6PTDA 1TV5A 3M0MA 2D2HA 3N4EA 5LHFA 2E3ZA 4QROA 5J5DA 5A6MA 5HUOA 1IIHA 1E5JA 1CLXA 5AB3A 3W2JA 2AGKA 3WQGA 1BHGA 4FZIA 4AWUA 3PBWA 1A5UA 2B7QA 1ONEA 1XLHA 3BSGA 5JVLA 4BEQA 1A5CA 3GK0A 1UKQA 1ZUAX 3SBFA 3EDDA 3GC5A 4U2ZA 1XIBA 3V0UA 1NDVA 3T8QA 2HE8A 3GKAA 5JIPA 3B8IA 2OYLA 1BVZA 4DAIA 4ASTA 4IIHA 2A3BA 4JDBA 1LZOA 3VOCA 4JFSA 4PMRA 5HR7A 1H1ZA 3NL6A 1K7FA 3H7UA 4ACYA 5AC6A 2XSXA 3PUOA 3VOIA 1EXPA 4WY0B 3EWDA 2IXVA 1JCXA 1PX8A 4GI4A 1QASA 1XQLA 1A5LC 3RLVA 2Z00A 1J01A 3GFXA 4OBRA 3HJEA 5CZKA 3GYCA 4ZEPA 1FWBC 4R33A 1W6TA 3ZVIA 5BROA 1EP2A 3HPAA 4J40A 3CIXA 4F66A 1C8QA 1XIGA 4MNKA 3C0LA 4RKAA 5CZTA 2DZBA 4B5WA 3GWQA 2X2GA 1KRAC 5HULA 4AD5A 2TODA 1YKWA 1FWJC 4N9EA 1J0KA 5C9XA 2DT0A 3ARYA 4ZSTA 2WAGA 1PX3A 4AVFA 4B92A 1XRVA 3GLCA 3INPA 4MG4A 3EAUA 4LYPA 1QK0A 1WZMA 4JIPA 4D9PA 4S3CA 2X30A 3KBWA 2D20A 5CPOA 3OGVA 3M07A 3REQB 3WEMA 1XBZA 3CXOA 3PG9A 2D73A 1SZGA 7PTDA 2DW6A 4D1JA 3AMLA 5DN1A 4HCHA 1XFBA 5BYWA 1B9ZA 4KRZA 1FFQA 1W9DM 2EAWA 3CIWA 1AUSL 3N19B 1B2YA 4ZO9A 1JCJA 4FNPA 3THCA 4JS3A 3BO9A 1YEYA 3VZZA 3O0KA 2V5JA 3EEZA 3H4XA 3LGGA 4FS9A 4PL1A 4UTJA 3QV6A 4WR3A 3AMKA 1QMLA 3N29A 3AIRA 4O13A 1Q6CA 2P53A 3C2YA 1PX4A 2V3EA 1C7TA 3PSVA 1LL7A 4JTEA 4WDXA 3GH5A 3GXIA 5CJNA 3AIUA 3WNNA 3M5VA 3L0NA 3NQ2A 1E1CB 1MXDA 1SYTA 3P5ZA 3ZMRA 1CCWB 5DEZA 1EGMA 3SY8A 5DRCA 3M46A 3DFPA 4K7VA 4XSMA 2NV1A 5AVHA 5KMYA 3EWCA 3QKZA 1IXNA 1LOQA 4JTLA 2XG9A 4PB5A 1NVMA 2PF8A 1KR1A 2VX7A 1DIKA 7XIMA 1O7AA 3W7EA 1OIMA 3GH7A 3TH6A 1H1NA 3MSRA 3ORWA 3CZJA 1JVNA 3LHUA 1LQAA 1TZZA 1VFMA 4IP4A 4F0LA 3LERA 4REQB 3F03K 3NO5A 2E40A 3LLFA 1KXHA 4PFMA 1UJQA 1R3QA 1I6NA 3SCPA 1ITUA 3ITCA 5LHEA 4IT1A 1JZ5A 1E6RA 4WD0A 1LG1A 4HJFA 3V16A 1E4IA 5J04A 3AOFA 1TX2A 4X3ZA 1K02A 2ZA2A 4KMQA 3VYLA 4AZ6A 1V02E 1W1ZA 1E4LA 5G2IA 1F61A 2I57A 3CTLA 4PB3A 2VDIA 3EA1A 4GNVA 3LTSA 1BD0A 2OO0A 1QHZA 4JY8A 2PLJA 4E4FA 4RUBA 2J7EA 4H83A 4C1NB 2YYTA 3NFUA 2QJIA 3QF0A 4JX4A 5BRBA 3YPIA 2HPMA 1PKLA 3EXRA 1WKYA 2D23A 3NJ3A 1B3OA 1VFOA 4GLEA 4IQJA 3F5KA 4CD5A 1XYBA 2H9AB 1I75A 3E0FA 4WZHA 1US0A 2QDEA 4JTSA 4P61A 2WVVA 5I3HA 2NLIA 1TV7A 1J5SA 4K38A 4W8BA 5I23A 1Z9AA 1JDCA 4JDYA 1MVYA 2OODA 2VENA 4IXHA 1JD7A 3FX4A 1Q7QA 3TQPA 4D6IA 5I79A 3TKFA 2XH4A 2YLLA 2ZIDA 2GSJA 4EXBA 3H24A 5D38A 3WD4A 3KE0A 1K77A 1DQXA 4PC8A 2WB5A 2AGTA 1SSGA 5CEWA 1VEMA 1OCNA 2QV5A 1Z3NA 4O50A 4S3DA 4EAYA 4JFUA 4TX9A 3W7QA 4PRTA 3CLWA 3IACA 1EX1A 1F8MA 1TRDA 3CH0A 2WXDM 2NWSA 4Z1YA 1P48A 3V5CA 4O0KA 3IJ9A 3CU2A 3OEXA 3AC0A 4DBUA 3FXGA 3MV11 1V7YA 1QPQA 3GM8A 2J8GA 2QVNA 2QCFA 3BC9A 1XGEA 3HQOA 3CEUA 1OGSA 4H6QA 1N55A 3DHUA 3UG8A 1T96A 2BHYA 2JFEX 1W1B1 1JJKA 1I4NA 2B7PA 2DH3A 1EL3A 4M19A 2QUNA 3UERA 3IUIA 5A2BA 1V3KA 2QCGA 3RJXA 2CZ5A 3C2FA 3SRDA 1RQEA 4ZOCA 3R94A 1GEQA 2C7FA 2YDQA 4D72A 1VBUA 4WQ6A 3U8GA 5CZJA 1E4MM 4N9CA 1TRIA 2NQZA 4JIRA 1KTNA 3ZZ1A 4HPXA 3BWWA 3T7VA 1JNEA 1EJWC 4J3ZA 3VOGA 2QF8A 4UFIA 3KM8A 1E0UA 2GPTA 4PA8A 2DUZA 3CZGA 5CC7A 1XLGA 1OC6A 3OBKA 3UPBA 2P10A 5DCEA 3WK1A 2ACUA 3NTYA 3OVRA 4JN8A 5EY5A 4YYFA 2GVEA 2PP1A 1JPHA 3CPGA 3TCSA 3N3MA 2VEPA 1ZLPA 1ITXA 3LV6A 1EGZA 3DOPA 4R53A 1PXGA 3CAWA 1OM0A 3TMLA 2YL6A 3MHFA 1V03A 2XFWA 1QNQA 5I6SA 1FWFC 1W1YA 2B0MA 1IWBA 1JZ6A 3NPWA 5LIXX 1S5TA 2XUCA 1WKDA 4IZGA 3A6OA 3N15A 3HTWA 4D1IA 1OF6A 3PPCA 4GVFA 3W7CA 1DP0A 4LJ3A 4CVWA 1QPNA 2Z2AA 1O4UA 2ZRUA 1X6LA 2FZBA 4FXJA 2Y1HA 4AZCA 4MYAA 2ZCGA 4P7OA 2Y70A 4KRTA 1JUKA 1PB0A 1IEIA 2Z7GA 4FX8A 3WLQA 1ZZMA 4X63A 1K4HA 3EDKA 4HMCA 4LRTA 4CEUC 4DLFA 2JGYA 3GR4A 4H7VA 1EPVA 1FCVA 2FMOA 4L4PA 5BOOA 3GC2A 1CT5A 1RSCA 4IISA 4UFLA 1JCMP 3IGSA 1E1EA 1JULA 1HP5A 1QJWA 4RDWA 1XG3A 1RVGA 3VD5A 4CLMA 2BZNA 4B2DA 3NSNA 1PCKA 3QC0A 1PZ1A 3OU8A 2YB4A 3QR0A 3SUUA 1JPDX 2CBIA 1GG0A 3HN3A 3ANVA 3W25A 5GNXA 3M0XA 1DWGM 2WKGA 4R9OA 1H7XA 2AQVA 1LRTA 3QSTA 3NOYA 5CSSA 1LLZA 4O8AA 4Z0SA 3W7KA 4NX5A 3THQA 3RCMA 1WDDA 3N9KA 4LS2A 1VBRA 3NSMA 3LMZA 1YLVA 4FOUA 2RDUA 4UQDA 2EO7A 3PN8A 4JZ5A 4LYQA 3UVIA 3VA8A 1W3HA 1FDZA 2FZ8A 1H7RA 3MKCA 2DIKA 2ZVIA 4H6RA 5EFFA 3W1QA 2ZUUA 5I0DA 4KPLA 4JFWA 4QP0A 1GZJA 2SFPA 4E5TA 4LQ1A 1J2BA 4AIBA 4V1YA 4LY8A 2XFYA 2ZADA 1SFLA 2B4GA 4O12A 4LSBA 3CZKA 1U30A 3I4KA 3R11A 1WQ5A 2YBTA 3MP4A 1LLWA 2VX4A 2CLPA 4WLCA 1JF6A 1TTPA 1OD0A 1T41A 1XC6A 4W7VA 1D7KA 3GRIA 3WLMA 5EA9A 4AEFA 2VI0A 5KZDA 1XKJA 3LBCA 3L0KA 1KBLA 1VBGA 5M03A 3KTCA 4ZTXA 1V08A 4GBDA 2GGJA 3SFWA 2Q02A 8A3HA 1QO2A 4JKLA 3DEQA 1TX0A 4LW7A 5FIPA 4E2VA 1SU5A 2VFHA 1JGMA 1I0DA 1EO5A 3KP1A 1KV5A 2HWGA 3EDEA 1BYDA 1V3HA 1OX4B 4Q8MA 3HIJA 4C7FA 3ABXA 3E1F1 1VF8A 4JQ3A 3GXPA 4AFYA 2ON3A 1M5WA 4O57A 5K9DA 2VGIA 3RPTA 1CEOA 3L4VA 4J9JA 1E3XA 3VINA 4Q8TA 3DFOA 5ENLA 1VFLA 1Q8JA 2V9DA 1MNZA 5HWMA 1XSJA 1RLDA 4YIWA 3N18A 4P2VA 4JCMA 3EWUA 4QJ1A 4W88A 3A64A 4I7WA 5A6TC 2V5BA 4JAWA 1IGSA 4AF0A 3ARPA 3CH9A 3I6RA 3T2PA 4PUWA 4C6EA 2CLFA 2WMJA 4AAJA 1U22A 2R6OA 3VOHA 4D8ZA 4Q22A 4W9TA 1XWYA 4PUJA 4IQLA 3H23A 1HP4A 3B8WA 4IG2B 3N2CA 4RL3A 1OGBA 1ZCOA 1TTQA 2F9RA 4MZ1A 3TYZA 3F2DA 2IQTA 2F61A 4I6VA 3O1NA 4OT7A 3HURA 1I2RA 5LIWX 4P7RA 3BOLA 1BF2A 2HBXA 3BE7A 2Y7EA 1XICA 2A7RA 3CGTA 2O9TA 3N3TA 3UR8A 2Y24A 4BQ5A 1TWSA 1O12A 1BWKA 1VAHA 4J27A 4A05A 4LCRA 3G6LA 1KW1A 4MB5A 1YPFA 1V6TA 2OZ0A 3PG8A 3EDFA 5CGTA 3SFKA 2PDLA 3ANYA 2VO5A 1EHAA 3ZVHA 3L67A 4NZ1A 1BYBA 5DY3A 7REQA 1JRCA 3E5BA 2GVJA 4ACZA 1KBBA 4CEXC 2JIEA 1BTMA 4LPCA 3QY7A 1GJPA 3EYPA 1HZYA 3VFCA 2WM1A 4LX4A 5LNUA 1DJWA 3GX9A 2VQTA 1TIWA 4MZ8A 4H8NA 3BCFA 3U4AA 4MNMA 4YTQA 2QDHA 4X2PA 4XK2A 3WMBA 4N02A 2OLAA 4A3HA 1K9EA 3EPNA 4ES4A 2X09A 1P0NA 2CLKA 1UKOA 4TXEA 2R14A 4HIBA 5K7JA 5CC6A 3LPFA 4NJJA 5M17A 1LUCA 3TJIA 2PDXA 4HKPA 4NIRA 3UBPC 4LNCA 4QIUA 1SSDA 2P8CA 3TC7A 2QCNA 3EMQA 1NOWA 4RJEA 4DJEA 3VCRA 3AISA 3ZFHA 3ZR6A 1A5NC 3AFBA 4GVGA 4Q4KA 1RCXB 2DT1A 5LNRA 3QZAA 3IK2A 4AWSA 4IM4A 5JMUA 1J0IA 4XD6A 4XB3A 6CGTA 1C8XA 5AHMA 2PBOA 4UQAA 4NASA 3BW3A 3N11A 4PTVA 1WZKA 4QR6A 2YBVA 1GOOA 3WF1A 1KM0A 1IR2A 1ICSA 1VFUA 3FIGA 3ZOAA 1V79A 3LENA 4B3KA 4B15A 1PS9A 3P82A 2F8QA 2J8FA 1H11A 4LYKA 5MF5A 4ZTYA 2ZDRA 2QCDB 1W17A 1HGYA 5HBFA 2BOGX 3NZQA 4PCSA 1ZBKA 1EP1A 2E7FA 4MPKA 3ALFA 2P1FA 3T0CA 2BASA 2QNEA 3LXAA 3WF2A 2QJMA 3UZYA 1CZ1A 2FHCA 3NNTA 1GORA 5C71A 3AZTA 3CUJA 4L6HA 1ODUA 2VR5A 2W0UA 3V18A 2QUMA 1YDYA 3B9AA 5ECUA 1W54A 4GJIA 1UYQA 1EA0A 4PMUA 4LB4A 3E2SA 1WUFA 2HXTA 4Q8UA 2ZZ6A 4TTGA 4O1EA 2HK1A 1SW0A 4EVZA 3VIMA 2C91A 3P6LA 3RILA 3B8VA 3D3FA 4C91A 4RXGA 2WYSA 3XINA 3P14A 5E9XA 2BOFX 1TPB1 3AWOA 2BG5A 1C91A 3PWGA 4P7NA 3VDGA 3L7RA 3AMCA 3SY1A 4DHGA 2WHLA 3LSCA 2VRKA 3AYSA 4AHQA 4JQ1A 4R9XA 4M6QA 3LRKA 3WMLA 7TAAA 1JAEA 1XRTA 3NQFA 5KETA 3CHVA 4LANA 3RDKA 2G95A 1M7XA 2VGFA 3GKFA 5A5WA 1LRNA 3NSXA 5CGQA 2PDBA 2NVDA 2XH0A 1DWAM 5FF3A 2CLIA 3LBMA 3BARA 4BKNA 4C7DA 2J77A 2PRHA 1J93A 3EMCA 4RLIA 5CXPA 2GGHA 1NWTA 1C3FA 1UB3A 1QBBA 1Q2RA 3L2MA 4CCZA 1HT6A 4DBEA 2XVLA 2FTPA 2UY4A 4QS6A 3CO8A 3PBVA 4V1XA 4DZ5A 1SJDA 3S6TA 3W76A 3W01A 4F2UA 2ZZ4A 1KLZA 1XXXA 3GZ3A 4WIWA 3KBSA 1TZ7A 1RP9A 1R38A 1XIIA 4DYEA 1NWRA 4CU8A 3N12A 1W5QA 3PHAA 1OFQA 6XIAA 3B05A 3T4WA 3WJYA 1IYXA 4JKKA 1B3WA 1MI3A 3ZIZA 3GC4A 4QDWA 4G1NA 5T9BG 1VEOA 3D6NA 1PVNA 4TMCA 3E96A 2X05A 1TUXA 1TV3A 3FJ4A 1D9EA 3PZGA 4RPQA 4RV8A 2EG7A 4CQBA 5E0CA 2DQXA 4US5D 3C0QA 3EB3A 3W7JA 2EG8A 4KWSA 3CMJA 3Q37A 3F2CA 3B06A 4U31A 3WQOA 3MCNA 2GWGA 1Q6QA 5BXRA 1KM3A 3UXDA 4X0VA 3S5OA 4FNTA 3WNKA 4GKLA 3B0UX 1PTAA 3OB8A 1D7FA 4IP5A 3CYVA 3A3HA 4U3AA 4QM1A 1H50A 3WQEA 2PWFA 2INFA 3LU2A 3FKKA 4C6PA 1VBJA 2H3BA 4YTUA 1CX9A 1K6AA 1PSCA 2O9OA 3UVAA 3PC0A 3I3BA 3DKLA 3FHAA 1BEUA 3NYZA 3H54A 3GVWA 4NRSA 3W6MA 4B3ZA 1H60A 2Z24A 3AIQA 5HWNA 5D9PA 3CHDA 3E0WA 4CQ8A 3TTSA 2J7CA 4PL2A 5D37A 4AZ7A 5FJRA 5JBEA 1EGVA 3S5NA 3KZSA 1OYBA 3MUAA 8XIMA 8XIAA 4E3TA 2D3NA 1T8QA 4HOXA 4TVUA 2YR1A 4AWEA 3SGGA 4PTDA 5CPLA 3U0HA 3QHOA 4B3LA 5FSDC 4AW7A 3RXZA 2Y8KA 3UFYA 2F2KA 2ZUSA 2DZXA 1FWHC 1WAWA 3EWXA 4QFUA 4NAFB 2J9ZA 3LYEA 4WGXA 3L4WA 2ZUTA 4MLRA 3IIPA 1FKXA 3A9BA 2VP8A 2FB2A 1A3XA 2ZXDA 3TTQA 4KF1A 2JKEA 3MCOA 1EYEA 1WE5A 4J3XA 1EJ7L 4LUSB 2HMCA 3VD9A 4JIHA 2WKJA 1Q6EA 3W83A 3KEHA 2UY5A 1XDJA 1OY0A 3QW4B 2D2GA 3T78A 3MMWA 4HK6A 4MFEA 3PTMA 2R94A 2F6KA 1LDCA 4KGJA 4C90A 3WK2A 5DCDA 3CQKA 3I65A 5EMUA 4NF7A 4S3AA 3QV7A 4HZ8A 1YMYA 2DVXA 4YTTA 2YIHA 4CVUA 5I7GA 4NZCA 3PZTA 1P0KA 4HQVA 5TQLA 1NY1A 2EEXA 2QMJA 4B5VA 4ZOBA 3AO0A 4FI4A 4E2BA 3NZGA 2DIJA 4DZAA 4OTKA 2WMFA 4C6IA 4QHRA 2J47A 3R5EA 1WB0A 4I5XA 2VEFA 4DPPA 3LZ5A 4R7OA 3KAOA 5DXYA 4IWWA 6TIMA 3R79A 1U5HA 2PB1A 3UA4A 4WUIA 1KO0A 1RCOB 3QQ0A 3NQDA 4O16A 5I2UA 1NDYA 2Y61A 3GHRA 3WEZA 3QMTA 3VDCA 3VNJA 4LAUA 3VGFA 3AU6A 3SDOA 3BAXA 1H41A 3BLDA 5E6ZA 4KCTA 3QR1A 2VCAA 3QLLA 3EA3A 3QLDA 1EB3A 3OG2A 3ELFA 3MANA 5EKYA 2ZX6A 4XUGA 4S3GA 2X1UA 4U3CA 5AKQA 1H61A 4GINA 3RJYA 3ENLA 4IIFA 2TMDA 1C9DA 5DBTA 4C5YA 1BQCA 1MNSA 1UIPA 2OQLA 3FGCB 3VIIA 3K46A 4LY4A 4IUOA 1ICQA 3G77A 4IJBA 3OHIA 2WSQA 2Q8LA 1JPMA 1PPIA 3QGKC 2PDIA 3DH7A 4US5A 1OFEA 2O56A 4S3KA 1UH3A 3VNYA 2BY3A 2VKZG 4ERIA 4GQGA 2GDVA 3WH8A 3UU0A 4PUKA 4AZHA 4HTBA 1P0DA 1B30A 2GSEA 4CNSA 1HKKA 3S2NA 1I0BA 1GKQA 4A3RA 4Y6GA 6A3HA 1DJIA 4HZ6A 1RD6A 4GYPA 4CNOA 4PYSA 2DJLA 5E5CA 2FTWA 5C9ZA 2CFFA 3H2NA 2JBMA 3O15A 5AC8A 2RH9A 1A0DA 3NEVA 3N04A 2PTWA 4K39A 1TWWA 4G9PA 5AC4A 3BICA 3TVAA 2J7FA 3K5XA 2NXHA 1OYAA 4LVDA 2WLYA 2V5LA 1CXIA 3W9ZA 5FJOA 5EBAA 3UR2A 2NWRA 4XZ9A 3URBA 1EOMA 2J6VA 3SN4A 3OLEA 3S5ZA 1NU5A 2XYLA 1UQYA 1CLVA 4XAYA 4QEHA 4FX6M 2TAAA 1ZRQA 1KKRA 3V1PA 3QOMA 2ZYFA 4DRSA 2OLHA 3GXNA 1QNRA 2QULA 3G1VA 3TAKA 3O6CA 5AHLA 1G9HA 1XGZA 3ONBA 3MI6A 5LNVA 5DT7A 4MWAA 2OFJA 3O06A 5BRPA 3CAKA 4Q3MA 4Y8FA 1J2WA 5A3HA 4RDZA 5CBIA 4G7EA 1A0EA 4QQUA 3TROA 3GDLA 3RGTA 3IEBA 2RJGA 5K3VA 1W32A 1WX0A 4Q8VA 3UYCA 4N6FA 2FZDA 3N9SA 5JH2A 1XDMA 1T99A 2XZ9A 4YHGA 2QCHA 3H8AA 3UWUA 3KBNA 2IS7A 4S3EA 3TZNA 5ABFB 2FGLA 4PULA 4U10A 1TSIA 1QI0A 4RNJA 1KQYA 1WOAA 5FI8A 1XCWA 3GBDA 4ZFCA 1KTBA 3LN3A 1E9LA 1HG3A 1J0YA 3TYAA 4H19A 1QI2A 3UJRA 4HK7A 2Y6ZA 2O4MA 1YTDA 1UZ1A 3M64A 2XGBA 6REQB 1SVDA 3CQHA 2JIWA 3UJSA 3BANA 3I7SA 3TDFA 2XN1A 3DG7A 3C86A 3MUY1 2CPUA 4X61A 4H01A 3W07A 3HB9A 1KM6A 1KM4A 3W1UA 1W37A 2E77A 2OMAA 4UR8A 3NOEA 4XQ6A 5JU6A 2P88A 1FOBA 2BVWA 2QVHA 2B7NA 2GZXA 2WZIA 2REQB 4XSLA 1UOKA 3H22A 4IX0A 4UR7A 1JDDA 3AIBA 1QXLA 1JUBA 3UG3A 4CCCA 4QDMA 3GNDA 2YL8A 4D6HA 1W8GA 2FVKA 5FESA 1L2UA 1RJPA 5GVJA 2HV5A 4O28A 3U57A 5HNRA 1T8XA 4OZOA 4F3HA 3GU9A 4A2SA 1WAUA 1N7KA 2E4TA 5EMKA 3NQ8A 2VZVA 4HOZA 3C8FA 4L1XA 1EJXC 2ZZ3A 3KVJA 3MYPA 1Q6DA 4UTTC 1P1MA 1QT1A 2OX4A 1JL8A 4A29A 4O15A 3N1AA 1KLYA 1ML1A 3AUJA 4EKJA 1UMLA 3TX9A 4AU0A 5D2TA 3W2UA 4JNMA 3GTIA 2VYOA 2D0HA 3BMVA 1UHVA 1MZHA 3ME3A 3BPWA 4TV6A 1S5MA 4FNQA 4PMDA 2PODA 3MJYA 3ITXA 5JXQA 2CIPA 5GJNA 3UJ2A 3FVDA 3ZJ7A 1OYCA 2OOFA 2ZBTA 1Z44A 2OSXA 3T0AA 2HZGA 2Z1BA 3JR2A 4LEQA 3WUBA 4R34A 1FWGC 4WOQA 2HS6A 3HBLA 4UTUA 4B9ZA 3R2GA 5MHBA 3HOJA 3SGUA 3LDVA 5EGRA 3B3DA 2QDGA 3DFQA 4WKHA 5A8NA 3LXBA 3LM3A 2BSLA 2QJHA 3K2GA 4TO8A 2J66A 3EXTA 4IH3A 4H9YA 4LVBA 1KB3A 5EB8A 4O52A 1UR4A 3P0XA 1K8YA 2X40A 2CESA 3KP0A 5T9CE 1UD5A 3N14A 4WDWA 4EWND 3II1A 4IJCA 4PTXA 4JN6A 3MUCA 2CHNA 4DBDA 5I06A 2W4XA 4PMNA 4J3WA 3W1AA 7A3HA 2PDHA 4H7ZA 2PEVA 1V77A 2OG9A 3ZJ8A 4M1BA 4BWLC 1POJA 2FH6A 2WANA 4AY1A 3CBWA 1HN1A 1H0IA 4HNCA 4IMAA 1DXEA 3SGZA 1UBSA 2EJ1A 4HT3A 1QNVA 4UNKA 2PU0A 3WH7A 4J4KA 3S1WA 1SZNA 1GNXA 1J9YA 5T26A 3G18A 5CZSA 3L23A 3LGDA 5CQ1A 5A6LA 4HSHA 1A47A 4ZVJA 3VTRA 4UFHA 2ZZ2A 3H21A 4YYCA 4LUYA 3BLFA 4GUHA 1JPIA 1LLOA 3GD6A 1R47A 3LHTA 1PYFA 1PIFA 3CL6A 2R8WA 2C16A 2CXEA 4LAZA 3TOYA 2E5DA 2GQ8A 1XPGA 1ONXA 5AFDA 4KEMA 1DORA 4K1WA 1IWAA 1O5QA 2B7OA 3SQMA 3HGSA 4UOQA 1HKJA 2OZ3A 2FZNA 5XINA 3VZXA 2PMQA 4FHAA 2QW5A 4O0QA 2ACRA 2I5GA 1QVBA 3EB4A 1KWKA 3G1XA 3ABRA 3ITYA 1V02A 3UR5A 1V0NA 5F4XA 3WD3A 1XG4A 3RLHA 4D6FA 4QCFA 1UP3A 5CSYA 4O4VA 1VZWA 1MWOA 2PLMA 1Q66A 4Z2KA 4TX6A 3TTOA 1RAKA 1O5XA 1PUDA 4J3UA 4YVVA 2IQDA 5J8LA 4JTJA 1V8EA 1ONWA 3ZT5A 8TIMA 4WRHA 3W74A 5K4ZA 1F6KA 4GHRA 2CNCA 2QPUA 2ZTJA 3KVMA 4CQ9A 3HQNA 2V8ZA 4NRRA 2DVUA 5FF4A 3T42A 1R85A 4H2CA 1F2JA 3UNDA 5C9RA 3B8DA 3GNRA 5HNTA 3WLJA 1XP3A 4NVTA 1XH1A 1M1BA 1Q6GA 3NCOA 5KTLA 3S0CA 3FYPA 3R13A 2A21A 3MMTA 3H2FA 2QEZA 4M51A 3P2VA 5HMEA 4KEZA 4GYJA 2FVMA 4KGLA 4I6KA 4KT2A 3R0UA 3NL2A 1UA7A 3P8JA 7ENLA 2PWDA 5C9UA 2V81A 2F38A 1S3HA 3AMDA 5EU9A 4XVDA 3SCQA 1G5AA 1P4CA 2PDCA 3CZ8A 4GZJA 3E49A 4NKCA 5C55A 4L64A 3HGJA 3OZYA 2D3LA 5SWUA 1UP0A 3SI9A 1EQPA 4XD5A 1U1HA 3S42A 3R58A 1CXFA 2IW0A 4M29A 1K1DA 3WFAA 1M01A 5CLWA 3HG3A 1RBAA 3CUIA 3N17A 5LIYX 1AZ1A 2JF6A 1DL3A 4Z2HA 1TB3A 1OF8A 3WQVA 1HX0A 3KS5A 4FK9A 2I9EA 3G3DA 2C8NA 3FOKA 2PA6A 4JX6A 3N4AA 3TE9A 3NDOA 1M65A 2AAAA 4YTSA 4UCFA 3L4TA 2BS9A 4WJXA 4RXFA 3IVSA 4GABA 2ALRA 3WH5A 4WVXA 5FJPA 2PP0A 4JTDA 4PFHA 2R9RA 1ZBWA 1RK6A 4WXZA 4E0CA 3K8MA 1S1PA 2VC6A 2J78A 4TMBA 1KTCA 1EWDA 2P50A 2YL5A 4OJYA 4HN8A 1OFRA 3UWQA 2AL2A 2XINA 2BGQA 3OG3A 4YPJA 1T40A 4DAFA 3HMJG 2J7HA 2PDFA 1RBLA 1ADSA 3RHGA 4GC4A 4EAMA 1BYAA 4M0XA 3PAOA 3U5UA 4JYFA 4CQAA 1CGUA 4F48A 2WWCA 4DI9A 3H53A 3L9CA 5C54A 2D69A 3VO0A 2QPXA 3NYDA 2B81A 1JFXA 1P43A 4DZHA 3ITGA 4W85A 3DBNA 1M41A 1B31A 1I9CB 4HHHA 1L0PA 3IJLA 2IQ0A 1SQ7A 5D2VA 2MNRA 4GX9A 7CGTA 1PZ3A 4PZVA 4Q7BA 2QXWA 5TNVA 3AALA 1BG4A 3CV7A 2A79A 3KBMA 3PTDA 5BXTA 2HPIA 3ITVA 5B80A 2G3MA 2BHZA 4C7GA 3WFZA 3LRLA 2V3FA 5C2XA 3G1RA 3PTQA 3VM5A 4QDPA 1L9WA 1ODZA 2BXVA 1DJHA 4ZFMA 1KM1A 2E0PA 4P7LA 4UIOA 3AYTA 2WNNA 3CQIA 2Q6ZA 4BJHA 4I90A 5BMXA 3VC6A 3CHEA 3T40A 3TTYA 4REQA 2AOSA 4GXWA 1FWCC 1JG9A 1Y65A 2Y88A 4GJJA 3QFWA 4GQQA 2W92A 4UWMA 3VOJA 3DKJA 1KC7A 4J3TA 2WSRA 4BI6A 2ZZ1A 2EBNA 4DWSD 1GHSA 1F05A 4MKVA 2IUZA 1UWTA 2P5NA 5FKYA 4JKMA 4IJRA 2YZ5A 2G8ZA 2NUWA 4RNFA 1EJSC 3M44A 3TQVA 1THFD 1PHWA 1GCYA 4OKDA 4A3QA 4ADUA 5H2ZA 1TWZA 3LB0A 4NP7A 3NO3A 1ZHAA 4LCSA 2YFNA 5HMSA 3WUGA 4LS1A 2F6XA 4DUVA 1MQPA 5BOEA 1SO4A 4ICMA 2OB3A 3LTYA 3OVPA 1KKOA 1ZBCA 1ZS2A 4W7UA 3E2QA 4L4LA 1WZLA 2NXIA 4DO7A 1J8VA 5A8MA 4QJ3B 1J0HA 1ZJBA 4PCNA 3WH6A 4AD4A 4I9AA 2QLYA 3ITTA 3V0SA 5C0QA 2HDJA 1HL2A 2Z1WA 1E73M 2GJXB 4KW2A 4LAMA 2CITA 1XLKA 4UOZA 1UR9A 1GWJA 1XCFA 1YTEA 3N2BA 4Z08A 3N6JA 1W9BM 3TXZA 2Y89A 3GHSA 4JIQA 1UA3A 2GVGA 1EJTC 3PBGA 2WJFA 4Y8EA 2Y4SA 4NY2A 4RZ5A 5AYZA 4HMEA 2XTKA 4AZGA 3C3NA 3B9OA 1IE7C 3APYA 3F1QA 4MZYA 3S3GA 4CNUA 1DHKA 3FEQA 1HVQA 1AL7A 3BGJA 4JTRA 3PBYA 3VKKA 1LYXA 4UQBA 4QBXA 1TPH1 5IHSA 1Y7VA 1FVPA 1WPCA 3P84A 1G7UA 1TVNA 3OVGA 3TOPA 1XW8A 3C6CA 4Z2LA 4EOUA 5GJMA 4L6DA 5T8GA 1NSJA 1KM5A 1WCGA 1I1WA 1EZWA 1JEZA 3QGVA 4YU1A 5E6YA 4L5ZA 2I1OA 5IBXC 1GOWA 4W93A 3UW6A 4JYDA 2REQA 1KCLA 3SCVA 4UMBA 3UT0A 3L68A 1QBAA 5A1AA 4AC1X 4U2YA 2HS8A 3WBXA 3T07A 2I16A 3COTA 2VFDA 2X1IA 2MUCA 5FAJA 9XIMA 1J6PA 3B8SA 5HJXA 6ENLA 1XH0A 3H6OA 1GZ1A 3AI0A 4KWOA 3W02A 3E3HA 4AEEA 4EF9A 4HSOA 1E4NA 5F2LA 4JICA 2BY2A 4MMWA 3W38A 3WF4A 2OVLA 4NSBA 3UGRA 4PMOA 3ZO9A 4A8NA 4BFAA 4H41A 5ABFA 5BMWA 4J2PA 2GOKA 3CASA 3LCIA 4PN2A 1JDAA 1P0EA 2I56A 3L66A 5A6BA 3BUVA 1MW1A 1A5KC 4G7EB 1GK8A 3FS2A 1JZ7A 1XI3A 2P76A 3B8TA 1NFBA 3TSMA 4J35A 1O5KA 1KNWA 1IIGA 4IL0A 3RFAA 3B0PA 3SECA 3PWAA 4BQ3A 1YTKA 1DWFM 4M1RA 5D03A 2JQXA 3VE9A 1B3ZA 3CUFA 2EPOA 1E6ZA 4K36A 1JFHA 4XD4A 5FJUA 1GT8A 1BRLB 4O18A 1ZBVA 3RO8A 4JCLA 2DZAA 1IT0A 3STPA 4YCPA 3HV9A 3K8KA 3ZR4A 3SW6A 2D0FA 2PD5A 1UH2A 4RCXA 2VZOA 1QHPA 2R24A 2PLKA 3U7BA 1FDYA 4GX8A 2WM0A 3JRKA 5IBXA 3I7QA 2DUXA 3OQEA 2ALDA 2YCIX 2Q71A 1G01A 4J3VA 1BF6A 3CMGA 3CO4A 1PO9A 1K8CA 5I09A 3D46A 2A3HA 3EXSA 4NUWA 2RDXA 1A5BA 1RH9A 1XUUA 4ZODA 4K1GA 1UR1A 3CB8A 4B4FA 3E6EA 1GYLA 1K6WA 1ZFJA 3ALGA 4PEEA 3C2VA 4E38A 1CW2A 1DIDA 4E2DA 4LEFA 1F73A 3FNDA 3LI1A 2O55A 3EOLA 3G0SA 3BLKA 4RE2A 4FIRA 4ZMGA 1U33A 2BY0A 3G8RA 1NH6A 1EF3A 2GJLA 5H8UA 1BKHA 2BLEA 2NQJA 2ZICA 4DO5A 3WDHA 1S2UA 2J13A 2GJXA 4ERAA 2FB3A 4W89A 2BFGA 3T09A 3IIXA 4ZSUA 1DXIA 1C7SA 1NQKA 1HKMA 1E9ZB 1Y0EA 2I14A 4XWUA 1TUFA 4RE0A 5BWAA 2W67A 1ME8A 3R1ZA 1Z89A 4UTMA 3H2OA 3BQ5A 5KZEA 1MW2A 3V75A 1S2TA 1ZP3A 5AY7A 4HPJA 3WBEA 4ONVA 3VD4A 1FH9A 4HU0A 2I5QA 2WSYA 5CCZA 3OP2A 4QG6A 2RUSA 1S2CA 1AJ2A 2ZZ5A 1TYGA 3BLIA 3QQWA 4UXDA 1EP3A 5D8WA 4KS0A 1DKWA 1PDZA 2IPWA 2A7NA 1TFVA 2PDPA 4V15A 2CCRA 3LM7A 2CWXA 1FXPA 1DOSA 3E02A 4R5EA 2JKPA 1K4GA 2Z1KA 2EQDA 2QGHA 3MTWA 4ACZB 2HCVA 1ZCCA 4OVXA 1ZJIA 1JDEA 5JIWA 1HQTA 2F7FA 1E71M 2Q3RA 2DT2A 3JZUA 4Y9PA 3PB0A 2NT1A 4NAEB 2MANA 1B5TA 1W3JA 1Q7MA 1M53A 4CN6A 1LL6A 2YOCA 3JW7A 2CHRA 5I3IA 3JS3A 3TMQA 2G3JA 3AS0A 4ATWA 3MPGA 1V7AA 5D32A 4CQDA 3F4VA 4WEVX 3SM0A 4V28A 4MB1A 1Q4WA 3KOZA 4ECLA 1VPQA 3I4EA 3S46A 2A6LA 3EA2A 4G1KA 3OQ8A 2J27A 4N7QA 3RMJA 4X22A 1HO4A 4LT9A 4AMAA 1UQZA 3ZWTA 1VKFA 1OG0A 4Z2GA 1GW1A 2PPGA 2OWWA 3RCNA 1YQ2A 4EWJA 2Y7DA 4IMFA 2W79A 2PCEA 3TK7A 2WBKA 1EC7A 1X97A 1Q65A 3ANUA 2NQ9A 1L2QA 4AVOA 2O9RA 4OBTA 2XN0A 4JQ2A 1IT8A 1V6YA 4QTGA 3H26A 4QLKA 4XVEA 1VPXA 1UWSA 2NX9A 3DUGA 5D30A 4JNZA 3T05A 4BA0A 3PTKA 3HV8A 1W1PA 3V5OA 2D0GA 4FR1A 4GUIA 4K2SA 4MNJA 4AD2A 1RQHA 5K9XA 1R9XA 2ZRWA 3KHJA 3GFYA 3P60A 2O0TA 1QDSA 3VMNA 1LBFA 3LX9A 4GH3A 1FH8A 3A13A 4M82A 4YTRA 4Y2WA 4WSHA 5LKYA 2JEQA 4ATLA 3OYXA 4NYUA 3ABOA 2Y5JA 5JBFA 3LHVA 1TZ9A 2CZDA 2QIIA 1W91A 1XLLA 3AHTA 4YCOA 4V2XA 2Q8ZA 3WDRA 3TR9A 2A3EA 3CMFA 5D4YA 4LAKA 2O92A 3KOFA 9CGTA 1YHTA 1Z7AA 3FJ6A 5E09A 1O60A 3OLDA 3O07A 4H9XA 4H8HA 4MVAA 1Q6RA 3ZJKA 2EGZA 1JD9A 5K4XA 3BLLA 2CC0A 3V5FA 3E5PA 4F2TA 3M47A 1M04A 5PTDA 2FZ9A 3MT1A 4FA3A 3OO2A 1XIMA 3GHTA 2Y5EA 1V93A 3LPPA 1GOIA 4XG1A 3FA5A 5A94A 3ZS4A 3W2NA 4K8EA 2E6AA 1CECA 1NOFA 3HQPA 2POTA 3B0VC 5DANA 3CJPA 4QLLA 4LH8A 3IJIA 1G94A 3WJZA 3CZEA 4TV5A 1PV8A 1F3EA 4GZ7A 2YSWA 2DGAA 3WLHA 3PPGA 3OYZA 3KCJA 3H4WA 1UPMB 4H8VA 3CM4A 3QR3A 2WJEA 3S6OA 3ZM8A 5M5DA 1XFCA 1X1NA 5A6SA 1QATA 1QI4A 1W9VA 2CU0A 3C2OA 3O05A 2VEIA 5HATA 1H51A 4JHZA 2PTDA 5J5RA 1XC4A 1DTNA 3CNYA 4S23A 1Z41A 5C5YA 3I6EA 3TCEA 1YNQA 2PRLA 1GJUA 1XINA 3MO4A 3WQCA 3BH4A 1OFPA 1UWQA 4DWSA 4GNJA 4XO6A 1K9FA 1PAMA 3S2MA 3CT7A 1S5VA 4XZNX 5BWFA 1H62A 2G3IA 3CK5A 5KITA 3W0KA 2JEPA 4O1FA 4PCFA 5DLCA 3BAIA 4AHPA 1FHDA 4K8HA 5GQBA 1V51A 4ZXOA 3GFZA 1W5OA 1IWPA 3CEPA 3KBJA 5LYRA 3BW2A 2OELA 3IJ8A 5AHEA 4I8DA 3SCSA 4BY3A 3V0TA 4LWWA 4NX0A 2H3DA 1C93A 4I7UA 4XX6A 2XU2A 1A4LA 3RX2A 1H4PA 2R1KA 4C1KA 1V5XA 4RNHA 4IQDA 4OIFA 2QHAA 1XYAA 2CZEA 4HA3A 3M0IA 4GWEA 5T91A 4DF2A 4FSAA 4XKYB 3AHYA 3E12A 5AYIA 3MCMA 4HU4A 3MDWA 5IFPA 4XZLX 1VHCA 1GEHA 3PPHA 3F5LA 3WEOA 4QJ5B 2X7VA 1G1YA 1CXKA 1E0XA 2PTXA 2YCKX 2CLHA 1RP8A 3WSUA 4FMVA 3SRFA 5B7YA 2IPGA 3OGSA 4HU8A 3UCCA 1JZ3A 5DFAA 1GPFA 5IRPA 1RALA 3BMXA 2XISA 3MZNA 3W82A 3C2EA 4PTWA 3W3OA 1S38A 1VFHA 3QZ6A 4WSKA 3LCHA 1JXKA 2J24A 1OEPA 2X0HA 3UG4A 5BU9A 4GUFA 1EF2A 4Y9OA 2A85A 3UY7A 2P3EA 3XISA 3PBUA 3LPOA 4OGZA 3WQ5A 4C1NA 4IL2A 1ZAJA 4GH1A 1L6GA 1TJRA 3VM7A 1AQHA 3WLSA 3CL7A 2WK2A 4MUPA 1RXOB 2YXOA 4J28A 1N82A 3WF0A 3RAOA 4CCEA 1BYCA 4R88A 2NQHA 3TC3A 1EA9C 4E8DA 2NV2A 1UKPA 3MKVA 2A1YA 1UUMA 3A3WA 3GXTA 2VDHA 2V63A 3RU6A 5A8QA 4HYRA 2QUTA 3KL5A 1KFKA 4UNIA 2OCZA 1CLKA 1V6WA 1LJYA 7TIMA 3UESA 5A6KA 1XIDA 3IIOA 4RDYA 4ZQPA 3QRHA 2G41A 4PBFA 3N2XA 1EC9A 3GDBA 3CV1A 2HBVA 2P0IA 2IKHA 3VDHA 5LSMA 2G4JA 2XIQA 4BWLA 3S4TA 3LCXA 2C19A 4DIAA 1FX6A 2PAJA 1EPXA 4RNIA 4UTWC 3VGHA 4HNVA 5G5IA 4ADTA 3GG8A 4N2YA 5CBJA 1S2VA 4QJ4B 2HROA 1M68A 1SZFA 1TTJA 3AUOA 1SO5A 2VD8A 1F7BA 1KFCA 3M4HA 1ECQA 3AJ7A 1Y5VA 4J1OA 4D8AA 1Y5XA 2DORA 4FNUA 4WDUA 2BXYA 1O95A 1CXEA 4LC8A 4N4PA 2OU4A 4MADA 3BLOA 4JL1A 4Z1BA 4AWTA 3ZYZA 5FF0A 4DF1A 2ZZ7A 1GQIA 3C5QA 3MWAA 3WBYA 1R3YA 1HXJA 2QMKA 1WYIA 2DEPA 5HANA 1EDTA 3U7VA 3EB2A 3W53A 1KBKA 5L9FA 2PWVA 3W1PA 3KBVA 3U2OA 1PKYA 4GGBA 1O1ZA 1UP2A 2NQLA 3F4CA 4JD4A 3VI2A 3O6YX 2D2OA 4MIMA 2OKOA 1SZEA 3STCA 1MQRA 3KZPA 3G1FA 4H9VA 1YPIA 2FH8A 2V5KA 3WQ4A 4Q4OA 3K4WA 4MWAE 3N25A 5A69A 2WJZA 4GE8A 1K03A 1TCMA 3SRKA 1F6PA 1HTIA 2E67A 4JYEA 2E9LA 2Y7FA 4K7YA 1XBVA 1V3MA 3THDA 4Q4SA 2ACQA 4B2DD 5CPSA 4HB7A 1R2RA 3DN5A 4XV0A 2PWHA 4KCVA 2YA1A 4HGXA 3KCLA 2QYGA 1DYSA 3VDAA 1AD1A 1XLDA 2C14A 4I8YA 1SR0A 1GTEA 2WZHA 1US3A 1P7TB 3U4FA 1Q8AA 1R2SA 1W1VA 2PZNA 4AZCB 4DY1A 4HZMA 1FWIC 1BWVA 3W7HA 4FLRA 1TMLA 1O94A 4HMNA 1F74A 3NDYA 4YNGA 2AL1A 4E8GA 5ABGA 3WLRA 1VJSA 4GGHA 3VNDA 1CGWA 1VRXA 2QJJA 3H55A 3W86A 2QCEA 2PDQA 4ML9A 2D24A 3IARA 1G4EA 1NFPA 3WBAA 2BY1A 3QYSA 1TQXA 1KCKA 4I3GA 1GOKA 3NQGA 3WLNA 1OWQA 4B5SA 3QV9A 1XHGA 4AC7C 2GFTA 1ELSA 4IGSA 4AEOA 4CU6A 1XKYA 5DMLA 3LI0A 2YL9A 3FSTA 3OZMA 1VCGA 1AZ2A 3UXKA 1EOKA 1Q7ZA 4EK7A 3M16A 3WJSA 4XTIA 3C3UA 5AECA 2CZFA 2C3ZA 5C2CA 1FWWA 1W3KA 3KDNA 5I78A 2OOGA 4XO7A 1UROA 2FKPA 3B4YA 4XBJA 1HL8A 2FJKA 4AY8A 1X38A 4AVNA 1YE4A 2YA2A 2ZA3A 3NWRA 1X6UA 3WCZA 4LV9A 3UXAA 3BK0A 2PUZA 2A0NA 1OQFA 2WC3A 1W5PA 3FHQA 4ZENA 1OB0A 1VR6A 3VIGA 1MFUA 3EOUA 3MP5A 4HBKA 3NG3A 5MKGB 2WQDA 3WYZA 1OCBA 2RFGA 2CYGA 3MKKA 2XN2A 4UTKA 2CETA 4KETA 1ZQ5A 5CAKA 4MPQA 5FAGA 3QJAA 3PULA 5G1MA 3VMOA 2VFEA 2VR4A 4XAGA 2O9PA 2DSKA 3NVDA 3SJ3A 2CBUA 1SJCA 1AW2A 3TEVA 1GVSA 5HINA 5CSRA 1C90A 1CIUA 2VOTA 4M5PA 1GVOA 3CL8A 3QPZA 2XVNA 3SN0A 4ZQRA 3A4XA 5C9WA 4H3DA 1WOBA 3SJNA 3ZT6A 6REQA 1FP9A 1V6XA 3MU7A 4H6EA 1G4PA 2OSYA 4EPDC 1SJBA 4JTQA 1XYMA 3N6HA 1W3IA 3WDPP 4FNRA 3ZSTA 3E0LA 3W00A 1YXCA 2DPEA 3U9IA 3TN4A 3VXGA 1LBMA 4PUMA 5DQPA 1ZENA 1W5NA 3APTA 1XF0A 1OX4A 5H8MA 4J7RA 4LB3A 3G8EA 2DDXA 4DUXA 3GVVA 1I2NA 4FLOA 4H9UA 2FFCA 1H63A 5AZ1A 3BJFA 4FLQA 4XBKA 1L6FA 5FJTA 1AA1B 4CD6A 3KLKA 3MMDA 5E0KA 3LUTA 4E8CA 3NZPA 4QNEA 4XZHA 3M9YA 4M7SA 3VZYA 3GG1A 4ZO8A 3LV5A 3BMWA 4ZB0A 1IZKA 1OFDA 3WO8A 2PC8A 4IGNA 1SFJA 2G5WA 1YDNA 5HXMA 3G1YA 1OGGA 4GY1A 3KCOA 4C6BA 2OGYA 3PJWA 4L1WA 4WY0F 2VVSA 2C15A 4A6GA 3EWZA 3B9DA 3S5SA 2EPMX 1QPOA 1POKA 3OIHA 3S6DA 4ZB5A 1VS1A 2FFIA 3HJZA 4PB4A 4AG0A 3GVQA 2AMGA 1MDRA 1YXYA 3MP3A 2D22A 1YW1A 3L5AA 3TJ4A 1IEQA 3UEQA 2CLLA 3GYEA 5C6MA 2ZQ0A 4AZBA 3M0JA 3EPOA 2BDQA 4KWUA 5MKGA 3A22A 4D6EA 2V30A 4O14A 2XGIA 3H4GA 1Z69A 3CV2A 3AHXA 5HWJA 1V6VA 3TIMA 2ZX5A 1SR9A 3WIJA 3KWSA 3MDUA 1R3WA 2WVSA 1UG6A 3GBEA 2W6RA 3KOYA 2GYIA 3G0UA 1TJ2A 3HM7A 2VEMA 4GUJA 4FOKA 1XD0A 3IK4A 1KXTA 2OXNA 1DBTA 1VCVA 2YJQA 3R43A 4C1LA 4NZFA 3TNBA 1REQA 4B5UA 2VWSA 1EO7A 1J6OA 1PZ2A 5I3FA 2WZEA 1Z32X 2HE5A 2VZTA 3V7PA 2QF7A 3SCOA 3VX0A 3W26A 4RK8A 3FDGA 1BVWA 4JY9A 3EX3A 4QCEA 5DXXA 1A5MC 4G5DA 2V3GA 3FGCA 5C7HA 4LCQA 4BS0A 1U1JA 3W1LA 3HG4A 1QU4A 3GHUA 4XAFA 2WHKA 2V6AA 2ZE3A 3EX4A 2E9BA 1IZJA 1W1TA 3E9AA 3RK8A 3W85A 2FYMA 2FGBA 2PRMA 4ZA0A 2PCQA 3O7UA 4IF2A 5C7VA 1R6WA 1JI1A 4AXNA 5A8OA 1GOXA 1WP6A 3HFYA 3FSUA 1XIJA 3SUSA 4OOZA 5LZLA 2GVYA 5HJLA 4FLSA 4FOJA 3ARXA 4QEEA 3GDKA 3ECQA 3KUMA 4LBRA 2YPIA 3QVQA 3D5HA 4UTFA 2YCLB 4ZQCA 4AZ5A 3V1HA 1GVRA 2J4GA 3GNXA 3HPSA 3LY0A 1DXFA 1BWLA 5LIKX 2INZA 4MY1A 1R2TA 1RA0A 4BEUA 4KERA 3VX1A 2NSXA 1QO5A 3W72A 1KBJA 5CH9A 3QXBA 2Z0IA 2WVVB 4ICCX 2J6XA 2XSBA 3G1DA 3WNMA 2KX9A 5JQ9A 1TELA 1AODA 4PMVA 3NM1A 4O1DA 5TBOA 4P8WA 3AXMA 1UMYA 2DZPA 2QJNA 2R91A 1UD4A 2E09A 1YXDA 3W7IA 1MO0A 3I3DA 3NXLA 3G3MA 2OR2A 1BGAA 2I5IA 1QAPA 3DENA 1HW6A 3S1XA 3ZVHB 3T55A 4F0HA 5KEZA 3B04A 2HXUA 1ZJHA 3W81A 3OIXA 2PWUA 3PF3A 2E5BA 4GYKA 3UQNA 1CDGA 5EMJA 3QGAC 2DP3A 1DQWA 4PUDA 5DT5A 2V2DA 5A6BD 3C0JA 1MYRA 2ISWA 3ES8A 3UWZA 2ZDSA 3OZOA 1VHNA 5H1WA 3MHUA 3GDMA 3UR7A 4GG9A 2V2CA 1UKTA 4ICNA 3Q65A 2VURA 1GG1A 2XIIA 4LS0A 4QE1A 3CC1A 1XCXA 1V4YA 3WD1A 3WL0A 1E1FA 3LTPA 1FKWA 1IEXA 3WBWA 4O19A 3QPEA 1E6NA 1IGWA 1OZQA 3POCA 2DVTA 5KZMA 4JOMA 1LUCB 3W84A 5DX7A 5I02A 3S2JA 1JDFA 3UZXA 2IXUA 1R3TA 4RDVA 2QJGA 3AAMA 3QC3A 1O6IA 1TA3B 2BVDA 3OLIA 2Z25A 2IKGA 4MUZA 4NXKA 3M41A 4TX8A 1UOZA 1XLAA 3UGVA 1LTDA 3BZJA 3LCWA 5D33A 1Y8BA 2GJRA 2OPJA 1GOMA 2C0HA 4DXVA 1DE6A 3VIFA 4EPEC 1GGOA 4L61A 1B4EA 2QGYA 4NG3A 4KIEA 1DV7A 3R4IA 3A4WA 1KGWA 2BMBA 1LWHA 4LBUA 5IXEA 1NDWA 3RX3A 4H9MA 2DT3A 3NR0A 2WZMA 3LSBA 3TFCA 4AH7A 4E3VA 3GDTA 1VPYA 2CKRA 3P5YA 3EDJA 1TV4A 1OC5A 4W5ZA 1BGGA 4AD3A 1YPXA 2Y0FA 5FJJA 3TYUA 3RIKA 2PZ0A 1UR0A 1UR3M 3NM3A 2VCCA 2FPVA 4XAZA 1YX1A 1FUYA 2HVNA 3H2MA 4IFRA 4CD4A 4AD0A 3PZOA 2XGZA 4TR9A 3E2RA 4D6CA 4GQRA 3HGRA 3R89A 4HPHA 1VQTA 3HQ1A 4W5UA 1HFBA 1YNPA 4LUJA 3IJQA 4DJDD 3M43A 3JUGA 1X98A 1OC7A 1X1OA 3SUWA 4Z1AA 4WY0A 2P8BA 3UXIA 2GDQA 3HFTA 3H7VA 1TKKA 4NZJA 4PSRA 4C6QA 3GQYA 1NWUA 4GNKB 1MW0A 2FQIA 2XSAA 3L2LA 2VEKA 4JIIX 3FEMA 4GXPA 1AH0A 2VCBA 3A47A 3A9IA 3WQDA 3L4XA 4HA4A 4HHPA 1IHIA 1U83A 1XBYA 3BURA 4GACA 3E0VA 2QCLA 3IV8A 1VFSA 1W5MA 3LLXA 2EJAA 1VJZA 3LZ3A 3F4DA 1ME7A 2GL5A 2E6FA 4YLWA 1MQQA 3SCWA 1EDQA 4Q8QA 2OWCA 5FSEC 2DUAA 1IEWA 2WHJA 3W6LA 1XM3A 4XISA 2J74A 2ZXQA 1XLJA 3TJXA 2Z28A 2Y5SA 1N8IA 4C6LA 3TSDA 4RZ6A 3BLPX 4DUOA 2ZXAA 4GI8A 4HNUA 1QW8A 5IOBA 1XUZA 1OFBA 1JAKA 4Y96A 1I8JA 3SCNA 1S2AA 2OEJA 2WNWA 4GO8A 1UD6A 1GQLA 3IVTA 3B97A 2QIWA 4NNCA 3QTGA 1P6WA 2V2HA 2FMNA 3HG2A 1BAGA 3T0BA 2X1TA 3DC8A 1FFRA 1VGAA 1SW7A 2HEJA 3BVJA 4NJKA 2O7SA 2NLYA 3N34A 1B4KA 3S47A 1FWDC 3MV01 3OHMB 4QLJA 2ONEA 4B9YA 1K3UA 5BXPA 2FZMA 3NGJA 3GUGA 4RPPA 3VMPA 4H7CA 1HJQA 3M0LA 3B40A 2QAPA 4CCDA 3CT2A 2J75A 2Z6JA 3S9IA 1GOQA 3C4UA 1TVLA 3PWIA 1D3CA 3NAVA 1L8NA 5M3WA 2ASHA 1H1YA 3CB3A 3IJDA 1V3IA 4W86A 2WHMA 4QGCA 1JYXA 1FBAA 3AZRA 5F1UA 4ROQA 1ZPTA 4FIQA 4AIUA 5LA2A 4E4UA 3SCTA 4CGTA 2F6UA 4F8XA 1TQJA 3M5YA 3OOQA 3CUGA 3MA8A 1MRAA 2A6NA 1JYWA 1ONRA 3QMSA 1H3GA 2O4QA 1E5NA 4MAZA 5L6UA 1MEWA 2OWXA 2Y63A 3FW6A 3W1XA 1U1UA 3L4YA 1SGJA 2E68A 3FA3A 2NV9A 4KCUA 4O11A 4I9JA 3OTRA 3DG3A 1J4EA 3L2IA 3NDZA 1Q5MA 1IXPA 1W9UA 4W84A 1EFZA 2RAGA 4DUWA 3PNUA 5G1TA 2R1MA 5DMMA 2Z4GA 2G50A 1F5ZA 3GNNA 1EH9A 1FCBA 1ZSXA 2AMXA 4DYKA 4JTTA 1UJPA 2XIBA 5CG7A 3GTXA 3MS8A 4KEUA 4Y9MA 3VNLA 2RGLA 5AHIA 1AQMA 5I3JA 1FQ0A 1KFLA 1GUVA 2DIEA 1PTDA 2YDRA 2NXGA 4JPGA 1U5JA 1FXQA 2BVTA 3RM8A 3WH9A 2ZRZA 3R8RA 2VRQA 3NGFA 3MHGA 3QW3A 3LLDA 2A3CA 4DBWA 4OFCA 4XKMA 4MHBA 4C6NA 2E1DA 3RYSA 1VP5A 5K9CA 4FO4A 2EKGA 1KD0A 2NSOA 2BOEX 3MUIA 5ABEA 1KV8A 5BRQA 3SUVA 4A3UA 2VL4A 4F79A 1YYAA 3E2VA 4JFTA 3FYOA 5HPCA 5G2HA 3W22A 3GNPA 1ZALA 1R7OA 1VC4A 4PEKA 3JZEA 4HYVA 3BV4A 1W56A 4FNSA 1RLCL 3D3AA 1MDLA 5E0FA 2VR2A 3K1GA 2WW5A 4JBRA 2OJPA 5CC3A 1OHLA 2ZE0A 3M1ZA 4MJ4A 3TA6A 4YXGA 1UIOA 1JYVA 1R86A 2VEGA 3L12A 3ARUA 2X42A 2EG6A 3DYPA 3LQLA 4GZEA 3IAQA 2DSZA 1EQCA 2DW7A 1XX1A 4GQBA 5GPRA 1G67A 4XZMX 2LLEA 2UBPC 4QQ3A 3ZLFA 2X1RA 2ZA1A 3TTEA 1B1YA 3Q94A 4S39A 3WF3A 5FEPA 5ECVA 4M80A 4UMCA 2VJXA 3U5YA 3U2ZA 3WG6A 4M56A 1AVAA 3U48A 4C6JA 2WNZA 5GJPA 2XZ7A 1IT7A 3VD3A 4AZIA 3T0DA 4YHEA 3L5LA 4EE9A 2UY3A 3FAWA 1FWSA 1GJWA 1VCFA 1BXNA 4C60A 3BAKA 4E6MA 4IIDA 5AN7A 1UZDA 2OGJA 4BQ4A 1PE1A 3WZ0E 2GGEA 1EUNA 2GQ3A 1EHNA 4PRWA 3MB9A 4JGDA 3MBDA 3EOEA 4OOUA 5LA0A 3QQ1A 2C18A 4S1FA 1QOQA 1KBIA 1LQ0A 4AF0B 1HF6A 2BHUA 3TW6A 1KRCC 1BVNP 2I7GA 2V82A 3ZLHA 2PD9A 1WDQA 1TTIA 3F4NA 4UZUA 3WLKX 4O0ZA 2RHGA 3SCUA 1ALDA 3A5VA 3N2OA 4AYGA 1YADA 2R1PA 5A6JA 3M7SA 2VM8A 1F8IA 4GKTA 2V38A 5H8PA 2VX5A 1W2VA 2EPLX 2E8ZA 1B3VA 1QPRA 4WGHA 1V0LA 4FB7A 2PDYA 3FDKA 3IRDA 2VD9A 5CSUA 4KH2A 2FLIA 2ABAA 2C1HA 4HNTA 5LXXA 1D3HA 2WMGA 1V3LA 3ABZA 4KRUA 4KFNA 5D2XA 2OX1A 1PZ0A 3VFLA 3MVTA 2ZVRA 4M6UA 3A5FA 3R0DA 1V0KA 3PP7A 1PJ9A 1YBQA 2A5HA 2ISFA 3FXYA 1CGVA 4Q32A 3WDIA 4X2RA 4B4HA 4KQNA 2XH7A 2Q8XA 1E9YB 2Z1SA 4JIEA 1R3VA 4DX3A 5CGMA 3AZSA 1J10A 3TW7A 1GHRA 3SSZA 3W7MA 4GIAA 1OFOA 1JCLA 5KZ6A 1Q63A 1A50A 4IP7A 2XH2A 3GW3A 1EX5A 4ZBCA 3V35A 1GQKA 4O1AA 3NPUA 4M6PA 4DBSA 4IPNB 1FWEC 4B5XA 3D0CA 4S3JA 1MMFA 3GO2A 2ZX7A 1NWSA 5CG0A 3CUXA 5IDIA 2KAUC 1PWMA 5LIUX 4JR5A 1YBQB 1XR2A 1NTHA 2X8RA 3WUFA 2POZA 2IKIA 3GG0A 1BKSA 4L4OA 4NAEA 2CW6A 2BP1A 1NM9A 2ATMA 2FDSA 4B5TA 3B9NA 1AW5A 3DCPA 1B90A 4JQ4A 5U7SA 3UJEA 5AYXA 3SSJA 3E0IA 3LHZA 4IPLA 1TPC1 1T0OA 1W0MA 1EWEA 1HJWA 1GYNA 1RQBA 4WJEA 4DWDA 4NZ5A 3KRUA 5FEXA 1R3RA 4ML4A 1VFTA 3U2EA 2VX6A 1S46A 2OZ8A 1KGUA 4IMGA 3IANA 3XIMA 2PLCA 4PUNA 2ACSA 4O4WA 3ZQ9A 1AQ0A 2OEMA 1VJIA 2E28A 3EGJA 3UY8A 3M0VA 5LA1A 4NJIA 2BODX 1TIMA 3O6DA 3RLUA 3W1MA 7ODCA 5BOFA 5TF0A 3K13A 3W27A 3DHFA 3GTFA 3HPFA 5ABHA 3TP4A 2PI6A 4UTLA 3GXFA 4CNTA 1DJYA 4YN5A 3VKCA 3RR4A 1XDLA 1KCZA 2X0SA 2YDSA 4QITA 1ITQA 1MXSA 4L9ZA 2IPFA 2GGGA 5AHFA 4MJZA 4UOJA 1NIUA 3IGXA 2X1SA 2ODOA 2DZSA 1EZ2A 3GZAA 1N8FA 5DRIA 3UP8A 3VUPA 3AXHA 4QNWA 4QSFA 5E70A 3DHDA 3K8LA 2RGMA 1Z8AA 2WMKA 3VNMA 3BXWA 4S38A 1UPPA 3BW4A 4CUCA 5CC5A 5CJ5A 2VFGA 3VD7A 2TRSA 2D2JA 2DZWA 1KFWA 3BAWA 1GKRA 1PYMA 4UTTA 4E4PA 4IGMA 3W1RA 3TXVA 3LRMA 3A24A 1GZGA 1ZGDA 1SUXA 2WZTA 4EANA 3P7YA 1EBGA 1IEVA 3RN6A 2WPBA 1W2PA 4E2OA 4UCGA 3KL0A 5IFTA 1AK5A 4KCWA 3QYQA 1JZ2A 4MAVA 4A8IA 2VWTA 1OK6A 1H2JA 3TNOA 3WD2A 6TAAA 1R7AA 3P80A 4M8UA 3W24A 4HYWA 4LVFA 1BPLB 5CLTA 1TPWA 2PDKA 2PWGA 2VNCA 1A49A 3TAOA 4AYSA 4Z0JA 3CQJA 4IPPA 4QG9A 4IFOA 2A7PA 3NUKA 2CLOA 4F2BA 3UPMA 1OCQA 4KEVA 2HSAA 3BDKA 4EX4A 1JZ4A 4HA0A 4MOZA 1H7OA 3WDQA 2QR6A 3ARSA 3OVQA 1RV8A 1BQGA 4GY7A 3VCNA 4K6AA 1RPXA 5I5RA 3GS6A 4M6VA 2XIMA 2PTYA 3RF9A 1QI5A 5I3GA 2PDMA 4U28A 1A5SA 3T08A 1KWGA 3KXQA 3ZT7A 3W7DA 1FCUA 3EX6A 3N2TA 2A3AA 1AFSA 2FIQA 4DJDA 4LF1A 3IWPA 4BF7A 3W87A 3CUZA 3POHA 2GK1A 4IGHA 5AC7A 1DIOA 2NX3A 3U3HA 4YVXA 2J9YA 3Q4DA 2WBGA 5BU6A 3FN9A 4Q8OA 4PGLA 1EJRC 4HK5A 4F9JA 4Y90A 3MJMA 4IUGA 4LC6A 2J8TA 2DY3A 2WNQA 2G4FA 4PSPA 4JEJA 4JL2A 4ILSA 2VQUA 1SFTA 2GDUA 2VELA 4N6EA 1XS2A 3KTXA 2TPSA 1PKNA 2YKKA 4HVXA 2VC7A 3H70A 3MSYA 4DWSC 3WNOA 2JALA 1BXBA 3W7LA 4C5ZA 4CN1A 3TYCA 3WQPA 1WBJA 1WKFA 1TWDA 4W7WA 1JYNA 9XIAA 4DO4A 1DVJA 4JFVA 5EFDA 2DSUA 4NI8A 3H12A 3TLQA 2O7QA 3RNDA 5CKSA 3GE7A 3USZA 2C71A 3NL5A 4X60A 2X41A 1B9BA 3VIHA 4BI5A 3FLUA 3JVAA 4D6GA 1UUOA 4LOCA 3BGGA 1ADOA 4ZE5A 4M81A 5F7UA 1AH4A 1TREA 1H49A 4DM1A 3SR7A 2CZVA 1GPWA 1WXJA 3AS1A 2GUUA 3GIYA 4F40A 1P6CA 1R9YA 4IHCA 4GVHA 1HGWA 5A8GA 1SPQA 2R1LA 4OU1A 2ATSA 3UWVA 2WO5A 2J88A 1ZNNA 3I10A 3HGOA 4EACA 4DF0A 3STFA 1F4HA 4PUUA 1AD4A 1GKPA 4Z1DA 2Y2WA 3OA3A 3P61A 1I60A 1LM1A 3KRZA 4RR4A 4H1ZA 4S2BA 4HCDA 4NHVA 4L9YA 1DJNA 5M2FX 1TCDA 3V3WA 2I9UA 5XIAA 3G22A 2CBJA 3QN3A 3GW0A 1X7FA 4ATDA 3KX6A 3LCGA 1G69A 3WMSA 1H0GA 3REQA 3LEPA 5HMFA 2ANUA 1TJ1A 3FVMA 5CJMA 4A35A 4FXFA 1R87A 3UWYA 5DBUA 3I3EA 4S3BA 3VOFA 3M5XA 2YYUA 3CS2A 3CV6A 2Z1XA 3VIKA 1TG7A 3R10A 2HNEA 1RUSA 4WHBA 2VOMA 1W3TA 3N13A 1F07A 4D8LA 1JI2A 1CB7B 1B3YA 4L56A 4Q4MA 1RR2A 4UNLA 3S5YA 3ZJ6A 3DC0A 2VC5A 4JXCA 3GVRA 3ERPA 3S8HA 1PWLA 1PKMA 1S5WA 4IIGA 2FHFA 3VU2A 1QFEA 4WX2A 4K68A 5AC5A 3GDRA 4F0RA 2Q01A 3KL3A 3ITLA 1C29A 3KLLA 3LHWA 5M1TA 4KESA 4D6DA 3QHNA 1A53A 4U4MA 3MI3A 4ZL1A 2GK1B 3QHMA 4DXXA 4GJ1A 4MF4A 4XIAA 3DX5A 1K9TA 1FTXA 2J62A 3FA4A 4GOAA 4RE4A 2ZXBA 1E0VA 2Z2BA 5FL0A 3NA8A 1U5VA 5HOSA 5A95A 1WNOA 3AYVA 4O1CA 1SMDA 1OT1A 4NILA 1W8SA 1K8ZA 1FP8A 5HNNA 1ISWA 3QV8A 4P8UA 2V3DA 2NUXA 1AL8A 2YGYA 4HJWA 1G4SA 4AB4A 1UASA 3B0YA 1JR1A 1UBPC 2XM1A 3B8UA 1F4AA 4IIBA 4PMXA 1OINA 3EPMA 1J12A 2FVLA 1KGXA 4AISA 3TWAA 1J79A 4LTSA 2Y8VA 2DSWA 1Q13A 2HRWA 3KHDA 4UMAA 2YW4A 2WV8A 1EIXA 2BTMA 1WUEA 4U5KA 1IF2A 3EMZA 2B31A 1BSIA 2YCEA 3VKJA 1M03A 2RDWA 4F0MA 3IS4A 4UFMA 4ZOAA 4IPIA 2Z27A 4D6JA 4OWGA 1UWUA 4RX0A 5GNZA 1W3LA 3UZ5A 3VKDA 1VRDA 1M7PA 5EPDA 1UD3A 8RUCA 3R8GA 3PJXA 3BGAA 1CGYA 1JRBA 1EEXA 3QEZA 3GG7A 4Q4PA 5G4WA 3Q67A 3A23A 1UZHA 2AL2B 4DI8A 1NOUA 4PR4A 1NAL1 4R85A 3WELA 3QZEA 2OYKA 2EKCA 3LA4A 3GXMA 4DJEC 3UXLA 1XLEA 4GRSA 1HUVA 4WCJA 4P5UA 5D05A 1BG9A 2A4AA 3ARTA 3DYOA 2DFAA 5D2YA 3AROA 3S2CA 3K4DA 3N6QA 3QY8A 2E8YA 3DI0A 1MUWA 4POCA 3G6MA 3GR8A 3A4JA 1CBGA 3K4AA 1CGXA 1WV2A 3APGA 1ME9A 3L21A 2G3NA 4FXSA 4C6DA 2H8ZA 4J3SA 3NQVA 4CQCA 3N9RA 3UWEA 5A6AA 1ESWA 2XVGA 1XLBA 3O63A 4L9XA 2GWNA 3KFTA 4G6CA 4Z2IA 3LQGA 3URNA 1SW3A 3B4UA 2D1ZA 4QAWA 5KINA 2A2IA 4L80A 4XTDA 4Z2JA 3DGRA 3SAZA 1R46A 3FAXA 5I24A 5HK4A 1ISVA 3KOWA 3UF9A 1E9IA 4AUBA 4IICA 1Z42A 4O10A 4LUIA 4JHOA 1GW9A 5D02A 3AWNA 2PFHA 4JX5A 4DEFA 2J79A 3KDOA 3R0KA 1KFJA 2HJPA 3TR2A 3P62A 1JCNA 2PU1A 3BZGA 3URAA 2YA0A 1N8WA 2RJHA 2YB1A 1AQFA 4MWAD 1GVEA 3J7HA 1E3ZA 3ZWSA 5AYYA 4JTGA 3RLGA 3NL3A 1I2QA 3VILA 2OYMA 2ZC8A 3C0SA 3MBFA 3WLPA 4HU3A 4MJ2A 5AVNA 2V5CA 3W6YA 1Q4NX 1VFFA 1VEPA 4IMCA 3S9ZA 2V0TA 4ZE4A 4K3ZA 1XD1A 3QFEA 1QOXA 1NARA 1WKEA 3SQLA 2H90A 4W4QA 5RUBA 3I68A 4NJHA 1X8FA 2G3FA 3WNPA 1DPMA 3GU1A 3UG5A 1OD8A 1QNOA 1CWYA 2NVAA 4I9TA 1A5OC 2ZKMX 2XFRA 1EIBA 3RG6A 3TYDA 1JPKA 5TIMA 1FH7A 5HAOA 2P3ZA 1F3WA 3RMEA 2DJXA 4N0RA 1VLIA 1GQJA 1H5VA 3TW9A 4DB7A 2P0OA 2W63A 3P3BA 3QH2A 4GI9A 4PRRA 3BCDA 1NEYA 1TV8A 1LRQA 1J11A 3CWHA 4MWAC 3TYBA 3QTPA 1Y5WA 2DU2A 1H7WA 1E6PA 4WKAA 4BR1A 1MUCA 4OBSA 3RM9A 2NT0A 4IOTA 3W7NA 2CERA 1E56A 1ITCA 5DF0A 1XH2A 3PZQA 3RITA 3PUEA 3LPGA 1XLFA 3GTHA 2GJPA 1GVFA 2IPJA 4IFKA 1SZRA 4OUEA 2WC4A 1UD2A 1FWRA 1P5BA 2EF9A 3PPFA 4QX4A 4N4QA 1X1ZA 4ZQMA 3EKLA 5AOUA 2ABBA 5EMMA 2ZTKA 1I1XA 5FEZA 3NQ7A 3ES7A 2PGRA 1E40A 1YIXA 1IV8A 2YDAA 3S9YA 1KA9F 4DZIA 1HL9A 4CD8A 3FYYA 2RDTA 3UZZA 4WXYA 4UR9A 1L6YA 1P7TA 2E6DA 5H91A 2W3ZA 3N4FA 1KRMA 9RUBA 2H6RA 3P8IA 2QS8A 1R30A 5FJIA 4TU1A 4MB4A 2CHOA 2TSYA 2BGNE 5REQA 1KXQA 1XSKA 3M5ZA 4DJFD 3WNLA 1NF7A 3P93A 4FF5A 2C6QA 4JNYA 1E70M 3AIVA 4H9TA 1UKSA 2R1NA 3KRBA 3CHFA 5F2MA 1ISXA 3BG5A 3UCQA 4YWSA 1MUMA 3DBPA 3KVLA 2PDGA 4LVAA 1GYMA 2FJUB 4UZSA 4Z1CA 4O17A 4S2CA