3V36A

Aldose reductase complexed with glceraldehyde
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 105
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v36A00
5KETA 2PF8A 4MHBA 1Z8AA 4IJCA 4JTAA 4Q7BA 3WG6A 1T41A 3R8GA 2DUXA 2PDWA 2BGQA 3B3DA 3LENA 3UYIA 1MRQA 4XO7A 3LUTA 4PMJA 2ISFA 3N2TA 3EB3A 4ICCX 4JTCA 3V0SA 3R6IA 1OG6A 2PDQA 1LWIA 4QX4A 3R7MA 4I5XA 4Q3MA 1EXBA 3UWEA 4QR6A 1LQAA 3WCZA 4JIRA 3M0IA 4PRTA 4EXBA 3R8HA 2HEJA 2HDJA 4IGSA 4JQ1A 3LD5A 3MC5A 1JEZA 1S1PA 4JQ4A 1S2AA 1EKOA 2I17A 2FVLA 4XZMX 2J8TA 3COTA 1X98A 3R94A 3LN3A 1YNQA 4XZHA 3G1RA 2ACUA 2HV5A 3NTYA 3G5EA 2PDPA 2F38A 2PDLA 2HE8A 2FGBA 1QRQA 1RY8A 4WDTA 1PZ1A 3LZ3A 4XVEA 1X97A 3RX4A 5LIKX 1AFSA 1HQTA 3Q65A 4OTKA 4R9OA 5DANA 4H8NA 2R24A 3V0TA 3FJNA 2ACSA 2FZDA 2PDMA 4NKCA 3GHRA 2PDNA 1PWMA 1PWLA 1X96A 2PDUA 3F7JA 2I16A 2NVCA 3FX4A 3V0UA 2IPWA 5LIUX 3UZWA 1YE4A 2BP1A 1AH0A 4F40A 4YVVA 1QWKA 4LBRA 5JH1A 2PDIA 3N6QA 1ZUAX 5AZ1A 2IKIA 3O3RA 1Z89A 3QKZA 4DZ5A 4DBSA 1Q5MA 1C9WA 3LQGA 4HBKA 3CMFA 3WBYA 2PDCA 4WDXA 3V35A 1ZSXA 3UGRA 1J96A 4WEVX 4PRRA 1US0A 1MI3A 3UFYA 3LNMA 2PDFA 2PDGA 4ASTA 2IPJA 2BGSA 4XZIA 4FALA 5LIWX 4GQGA 4L1XA 3BURA 4XAPA 1A80A 3BCJA 5HNTA 1EF3A 4JQAA 3GHTA 2FZBA 2ACQA 1FRBA 4YVXA 1RALA 3H7UA 3R58A 1XGDA 3RX3A 2PEVA 5M2FX 4JIIX 2PZNA 4DBWA 4GCAA 2PDBA 1AH3A 4YU1A 1K8CA 5JH2A 3LQLA 1XF0A 2FZ8A 4JQ3A 1Z3NA 2IKHA 1VBJA 1MZRA 2PDHA 4XK2A 5LIYX 3GHSA 4WGHA 3DOPA 2C91A 3CASA 1UR3M 3UZXA 3Q67A 2IKGA 1HW6A 2IPGA 3CV6A 1Q13A 2NVDA 1ADSA 2AGTA 4G5DA 4JQ2A 1VP5A 1R38A 2DUZA 4QXIA 2IS7A 3ONBA 4GACA 4FZIA 3ERPA 1XJBA 4GIEA 2PDKA 5LIXX 4GABA 2PDYA 1S2CA 2INZA 4XVDA 3LEPA 3DN5A 2F2KA 1AH4A 3EAUA 3V36A 3M4HA 3GUGA 4AUBA 3WBXA 3BUVA 2IQ0A 4XZLX 4EXAA 2FZ9A 3KRBA 4IJRA 2VDGA 3CAVA 4JTQA 3D3FA 2DV0A 3ONCA 4PR4A 3WBWA 1PZ0A 3UP8A 1YNPA 4LAUA 3LZ5A 1ZQ5A 1AZ1A 2P5NA 2PD9A 4JTDA 3BV7A 4YS1A 4YVPA 3GHUA 1IEIA 2QXWA 4LAZA 2PDXA 3M64A 1T40A 1ZGDA 4GQ0A 1IHIA 4JTRA 1Z9AA 4HMNA 4ZFCA 2HVNA 1GVEA 5AZ0A 4DBUA 4LB3A 4H7CA 1SM9A 2PDJA 1AZ2A 3RX2A 2WZTA 3H4GA 2ACRA 2A79A 3T42A 3EB4A 4FAMA 3UG8A 1PYFA 3UZYA 1S1RA 2HVOA 3CAQA 2IKJA 5HNUA 4XO6A 5HA7A 1EL3A 4FA3A 4WDWA 3U2CA 4XZNX 3MB9A 3LBOA 5C7HA 1YE6A 4WDUA 4L1WA 2R9RA 4WRHA 3O0KA 4LB4A 2INEA 2HE5A 2PFHA 3H7RA 3C3UA 3VXGA 4LBSA 2IPFA 3R43A 3CV7A 1RY0A 2CLPA 4PUWA 4PUUA 2IQDA 4RPQA 3UZZA 3S3GA 4GA8A 2ALRA 2WZMA 3P2VA 4QBXA 2PD5A 4JIHA 1M9HA
chains in the Genus database with same CATH superfamily
3V18A 4Q7BA 1IT8A 1T41A 3KDNA 1I45A 2GJLA 1OX4B 4KEUA 5A2CA 1QBAA 3IJ6A 3SN0A 2PDWA 2PODA 2V5DA 3KXQA 1V03A 2UY3A 3UYIA 4NZCA 4D6JA 4XO7A 2MUCA 1KTCA 4FNUA 1GTHA 4H00A 1A0CA 1OFOA 3K4DA 4D6HA 2PLJA 3AMDA 1ME9A 1Q85A 4IPLA 5A69A 1OG6A 3CZGA 4KRZA 1U5JA 2O7QA 3WJXA 3F4DA 3KVJA 1F8IA 4E3TA 1WUFA 2X1TA 1XLMA 1XLGA 2CESA 2CBVA 4AY7A 5I77A 3M0IA 1DOSA 2C71A 1U22A 3QR3A 4WF7A 2VNCA 5HNNA 2A6NA 4REQB 2CHRA 4E4FA 2GGJA 1JL8A 5CZSA 1KFCA 2TYSA 5D02A 1JCJA 1IYXA 4XAZA 2EPKX 1W1TA 4WVXA 5FJUA 4H9TA 4BQ5A 4M82A 1W9XA 3W6YA 1X1OA 3PANA 1KFEA 1HUVA 4M81A 4UNLA 4YTRA 1LG2A 2ZADA 4LWWA 2WMIB 5EGRA 4AF0B 2NQZA 3QC0A 3K46A 5F1VA 1HJVA 1VEMA 1W9UA 5F2GA 1KV5A 2HTMA 3TYEA 1FXQA 3B97A 3WK2A 1I2PA 1GONA 3QVQA 2PE4A 3TU9A 1FKXA 3O06A 2ZCGA 4G1KA 2Y5EA 1LRNA 5D9MA 3LHWA 3DFHA 2VXNA 3U6WA 1CIUA 2NW0A 1O1HA 1CXKA 3FJNA 3L5MA 1JFXA 3FJ6A 3BH4A 4C5ZA 1GVQA 3DFNA 3QGAC 2XFYA 3KVMA 1EJRC 3BICA 1BHGA 2CLKA 4BR1A 2SFPA 1BGAA 4QDPA 3POCA 2JIWA 3TMQA 4OVXA 2VFEA 1GOKA 1FFRA 3DX5A 3GB6A 1UWUA 1QT1A 1GKRA 4EPKA 5LXEA 3TLQA 4TR9A 4AEEA 4KRTA 3MO4A 2VEKA 1ZCOA 4DJEA 1QR7A 1W6TA 3O3RA 3WLNA 4R34A 2JKAA 4DBSA 1JPKA 1SW0A 2CPUA 1KLYA 2YSWA 1F3XA 1SFJA 3SCOA 2JE8A 3MI3A 3MVTA 3NZPA 3RU6A 3SI9A 3MBDA 2WCGA 1ZPTA 3B8SA 2ADAA 3DG6A 1POKA 4L1XA 2P8BA 1EJSC 4XAPA 3GU9A 3OJGA 4X9YA 1JF6A 1R0MA 4JTJA 3VOIA 3GXFA 2BTMA 3G22A 4S23A 2RJGA 3TFXA 4GY1A 2R1KA 4ZO9A 3TJ4A 3VZXA 1NTHA 1XC6A 3R58A 1TX0A 2GVYA 7TAAA 5D32A 3G1AA 3WQOA 2ZC8A 3MZNA 4EXQA 1HJXA 4PN2A 4EOUA 3T9PA 3WH7A 5JH2A 1NAL1 3NM1A 2CBUA 1D3HA 1VBJA 3KOYA 3K8KA 1V3JA 4PA8A 4P2VA 4UOJA 4RE3A 4HD5A 3NA8A 1NFBA 3B05A 5FA5A 2A0NA 2R1NA 1H62A 5M5DA 4F9JA 1H41A 2C18A 3W2NA 5DCEA 2ZX9A 2A1YA 4TTUA 1ADSA 4C6EA 1JYVA 1VBGA 4Y6GA 1GQNA 1VP5A 1F6PA 4Y9NA 1ZP3A 3ITGA 1W91A 3GW0A 3VX1A 1EGVA 1PB0A 3OB8A 5CPSA 1JQXA 1XRFA 5GNXA 5C2CA 2CLMA 4RNHA 3QPZA 1D9EA 4D2JA 1DE5A 5JVLA 2CLOA 4TQTA 1PO9A 3KOZA 2PDYA 2VEGA 3N2MA 1U1UA 3QZAA 3VCRA 4H9VA 4OBSA 3LEPA 4LY4A 3R0DA 2GWNA 3KL5A 5I07A 1V0KA 1IXOA 1A4LA 2NZLA 4IFKB 4EXAA 5ABEA 3A3HA 1R47A 3MU7A 5ABGA 3L4WA 5F4WA 2UZ9A 4KCVA 3VCNA 1EF2A 1ZRQA 3GXNA 3Q94A 3BARA 4Y96A 1EDQA 5G5IA 3DDMA 1H1ZA 1AA1B 2CZVA 1OGSA 2D0HA 4BF7A 1NU5A 2A5HA 1B2YA 3GDTA 2ZUWA 4WUIA 3VNLA 1IHIA 3C3NA 3R4IA 3GSMA 2GGGA 2HBVA 3CUXA 4UTTC 1PDZA 2ZRZA 1R3YA 2H9AB 3CWHA 4D6GA 2E8YA 2WZTA 2QCDA 1SZGA 3O6AA 4ZQRA 2ACRA 4TV6A 3UR5A 1DORA 1QNVA 3VNIA 1KM0A 5AC4A 5LGXA 1RQHA 2WNZA 1LUCB 1S3TC 1REQB 3VGEA 2V3FA 1HJUA 5TNVA 4KMQA 2WVTA 2XVLA 3WEZA 1C8XA 5DXXA 1OCQA 5JQ9A 4FA3A 1F73A 2TODA 1IXNA 2E6YA 4KEMA 3NVDA 1QNRA 2WMFA 3WF1A 4RL3A 3VOJA 3SJNA 4HZMA 4RV3A 4ZQPA 4MGGA 2QS8A 2WMGA 3AJXA 1A5BA 4HA1A 2PI6A 4ZB2A 1ITXA 2W27A 2PWEA 4FPSA 4AMAA 2V5BA 4RZ5A 3UG4A 1OF6A 1OD8A 1VC4A 1E6XM 1UWRA 3GVWA 2B7QA 2XG9A 3ZLHA 4JFUA 5A8QA 2TSYA 4G1NA 1JCXA 2NVAA 3P2VA 1QI3A 2FPVA 4IG2A 5IBXC 3MCOA 3RLVA 4MHBA 4PTNA 3ABZA 2OMAA 1BAGA 4DNHA 1Q6RA 2LLEA 4K6AA 1WQ5A 3R8GA 5J5RA 2JFEX 3PPGA 4I8YA 4JCLA 2E77A 1E6QM 1CTNA 1W56A 3A47A 4HNTA 3PPFA 4A22A 4HKPA 4FMVA 4O16A 3WH8A 5HAOA 3EB3A 2FMNA 1JZ2A 2NV1A 4V15A 3AYVA 1A5AA 3GBDA 3HN3A 2ONEA 2FZNA 4QX4A 3GE7A 2WPGA 1XBXA 4GG9A 3EWBX 3KCJA 4QR6A 3W7KA 3BAIA 3GIPA 1H0IA 2VOTA 4PB4A 2YDAA 3RCNA 3SUUA 4W93A 4TIMA 3H53A 3TSMA 3S2CA 1XPGA 2OB3A 1GYLA 1TVPA 1DJGA 2X30A 2HPMA 4U33A 3QZEA 5EB8A 3EOOA 3LI1A 3ZLGA 2Z1VA 4L4MA 3W87A 2JEQA 1EQCA 4UFKA 4DBEA 3QTGA 3NQ2A 3GTIA 4XZHA 2QV5A 1DWHM 2ACUA 3G5EA 4FOJA 1W1B1 1UZ1A 2DZTA 4LRTA 2VFDA 3DFQA 1RJQA 3GR4A 1QAPA 4GNVA 1LBMA 2CU0A 1MFVA 2OPJA 1WAWA 3RJYA 4V1YA 5LA2A 1B31A 3NQ7A 4MKNA 4B5XA 6PTDA 1XLIA 2Z1KA 3DGBA 5A95A 3B8IA 5E0FA 2Y7GA 3MUAA 2RDXA 1ONEA 4OFCA 4FSAA 1QW8A 5I03A 3NQVA 3WQPA 3TSBA 4NKCA 3TYDA 1ONWA 4ZMGA 3BLKA 3EMCA 1EWEA 1IV8A 4U28A 4J3TA 4OBTA 2VRQA 2QIIA 4JYEA 2QDGA 4V1XA 2GUYA 1AD1A 3VIJA 1BF6A 1FBAA 1XYMA 3QGKC 4JFVA 3UZWA 3GVQA 2E6FA 3TVAA 1LOSA 3I6EA 4Y7EA 4Z2LA 4NAEA 3QHOA 2PDIA 3NOEA 3CV2A 2GSJA 4A8RA 2CIPA 3OZOA 1JUBA 2QCGA 1GKQA 3STFA 2YCEA 3QKEA 1G4TA 4F0HA 2G3FA 1MI3A 4GX8A 3SCQA 3FKRA 1L8NA 6REQA 3ANYA 1BG4A 4TVDA 1TWDA 1TX2A 1KM5A 2EG7A 2OODA 1TJ0A 1RQEA 4C7FA 5HNTA 2RDTA 1VRDA 3U2ZA 1KA9F 2GZXA 1A47A 1UD3A 2BXVA 3KP0A 1UD6A 3A21A 5FJJA 1B90A 3UWVA 3Q2DA 3W86A 3WEMA 3VFCA 4AU0A 2OO0A 2HJPA 3E0WA 3TLLA 3M07A 3GG8A 4CU8A 2NXHA 2X16A 2X05A 1US3A 2ZA1A 1GZGA 1V6WA 2QLYA 3NDYA 1AH3A 1CPUA 1M7OA 4GZ7A 2IKHA 1US2A 2WNQA 2P0IA 4LF2A 1F61A 2QEZA 5D2VA 1A5MC 5LA0A 3M0ZA 3N3MA 1B3XA 3W24A 4XK2A 5KZEA 3GFZA 1EA9C 3H6OA 4ADSA 1HGWA 4P7QA 2UV8G 4QSHA 4YTQA 3LTYA 3U2EA 4NYYA 3VE7A 3DC0A 4JL1A 3GG0A 3DFOA 3CT2A 3KBVA 4HU3A 4JZ5A 3V5CA 4UR8A 3AS1A 1X6UA 3MSYA 1YADA 4M29A 4H2HA 4FZIA 4DZIA 5HATA 1YXYA 2PDKA 3QR1A 4DF0A 3IJIA 4O18A 5HMDA 4DIAA 4OU1A 4GQBA 1Q63A 4AC1X 1W1YA 4C6MA 3ITXA 3MUY1 4P8WA 1KBBA 3TQ0A 1VCGA 1G7UA 2QKFA 2AKZA 4MNJA 5JBFA 3CAVA 4MTVA 4JTQA 3W7OA 2C79A 3ONCA 4YPJA 1DVJA 1TIWA 4JD4A 2BY3A 1M03A 3W2MA 3O2LA 5AC5A 4NIRA 4D1JA 1LLZA 2PP1A 4HK6A 1XRVA 2OQYA 3G1HA 1KGUA 3IJDA 3NQ6A 1CB7B 1BSIA 4ORMA 3QGVA 1BQGA 1H7RA 4LB3A 4C1LA 1SM9A 1TE1A 1C92A 3TTQA 2JIEA 2OX1A 3TKFA 4QTGA 1CX9A 1W54A 2PLMA 4J3VA 1B3OA 2FB2A 5AYXA 3HMJG 2OU4A 2GVLA 1ESWA 2J88A 1A49A 4RR4A 4LPCA 2WZEA 3CAQA 1GOMA 1FKWA 3OA5A 4HPNA 4H41A 4S2CA 2OG9A 2CKRA 4JHZA 1RD5A 4AG0A 1RV8A 4K8EA 2QYGA 1TG7A 3N12A 1ZY9A 3CPGA 3B9EA 5CSSA 5CGMA 4LF1A 1G9HA 4QLJA 3N9SA 4Y9OA 2JF6A 1GG1A 3FNDA 3VIOA 4L1WA 3AWNA 2YCJA 3VFLA 4PTMA 1EWDA 3L23A 3PSWA 1TZ9A 3WQCA 3MS8A 3C4UA 3FYOA 2W92A 4IGNA 3UZJA 1UZHA 5ECVA 2QR6A 5CSYA 3P5ZA 4JOMA 2GJPA 5E0CA 5CKSA 1OF8A 3UXIA 4U10A 1TO3A 4S3BA 2ZX6A 3W7MA 3KS6A 3V3WA 1Q7MA 3P81A 1FWAC 3U48A 4LRSA 1MDLA 1I1WA 4ACYA 3KBWA 4BI6A 3IEBA 3GIQA 3SUWA 4QRNA 1RBLA 3R6IA 5FACA 3BSHA 1V3KA 3VYLA 4O0ZA 2HRWA 3CLWA 5XINA 3UWEA 5DF0A 1TTQA 3UR7A 2V6AA 1XIHA 1D3GA 3RILA 4XX6A 3P7YA 5T8GA 2Y7EA 3QMSA 3AIVA 4LVDA 3QY6A 3B8TA 4FEZA 3OW1A 3RIKA 1O5KA 1DQWA 5BU9A 2YBVA 1DIEA 5B7ZA 2FFIA 4QG9A 1A4MA 4ERAA 4E2DA 1KFWA 1Q4NX 5DMYA 1VIZA 2WSKA 2CWXA 4ZQNA 3BVJA 1ICSA 3SRDA 1T8XA 3PUOA 1LROA 4CD4A 2DQWA 3NTYA 3LCHA 1KM4A 4GOAA 1N2VA 4YMZA 1LCOA 1LLWA 3OG2A 3W02A 1ECQA 4AZBA 1KB3A 4J4KA 2PGEA 3MV01 3WF2A 1FWNA 2JALA 2XIOA 4QJ3B 1H7PA 1FVPA 3GYCA 1HQTA 3SY8A 3CMGA 5DANA 3OIHA 1J0IA 5F1UA 4Q4RA 1JZ6A 2W4XA 1O5RA 1PAMA 4ES4A 2GWGA 4C5YA 3CUJA 1RXOB 3MDUA 1DTUA 4F2TA 5LYRA 1S5NA 5LNRA 3RNDA 3GNNA 3RRAA 2I16A 2QAFA 5I3HA 2BWGA 2BY0A 1Q7ZA 2V8ZA 1WDSA 3NSNA 2Y0FA 4AIBA 5DO8A 2W61A 5DBTA 3LCWA 1W8SA 3SRKA 4AZCA 1TQXA 5AHLA 1ZALA 1GVFA 3BAKA 4NNCA 1ODZA 4WCJA 7REQB 2HWGA 1HKVA 4NVTA 1LL7A 4GI9A 4BWLC 3IVTA 1F8MA 2ALDA 2WPBA 1Q8AA 2AQWA 1TMHA 1QK2A 3S5OA 4C6PA 4DJED 5D2XA 1BYBA 2NWSA 4WDXA 1PKLA 2Q3OA 3V35A 4IOTA 3M43A 4ZQMA 4QE4A 4GO9A 3N34A 2VX4A 3S1UA 2ABBA 3AUOA 4QEEA 4LT9A 3CUZA 1BPLB 4FALA 4D71A 4BFAA 4Q7NA 2AL2A 2D2HA 2EXOA 3WKZA 3MTWA 2WKJA 4KBXA 1GZ1A 1TV8A 3P8JA 2EJAA 5CPMA 1J18A 4C6OA 1EX5A 4IMDA 3E38A 3KRUA 4HTBA 3S2NA 2XM2A 4AY1A 4DUWA 5M2FX 4HNOA 4BQ2A 4JIPA 4MB1A 4J3ZA 3CGTA 3CZKA 1AQMA 4M5PA 1IR1A 4HHLA 1PE1A 4YU1A 1XF0A 2FZ8A 2J78A 4O0QA 2CLLA 1FWCC 4XD4A 1ZJBA 1W3HA 4HU4A 3C0QA 3DYMA 4EF9A 3BOXA 1T6MA 2YFOA 4GI8A 2IXUA 1XH1A 2MNRA 4TVCA 4MNKA 1K7XA 3CV6A 3UVIA 2J47A 1RAKA 3DCPA 3L65A 3HQ1A 4H6QA 3LPPA 1TV3A 1CGWA 3CQJA 2A7RA 3ZR6A 4N9EA 2G4JA 3ZJ6A 4XKYA 4UTJA 3KX6A 1DKWA 4JX5A 1KQZA 4GACA 4CU6A 1M01A 3PNZA 1YDNA 3UXKA 1SR9A 3ARWA 4RNIA 4H4IA 3NL2A 4LCRA 2H3DA 1OCNA 5K9CA 4QP0A 1TA3A 4KGLA 4D6IA 1TE6A 3DN5A 1AH4A 1BKSA 3WBXA 3O7UA 2IQ0A 3WDRA 1HJQA 3C8NA 4H6EA 3HB9A 2QCLA 2ZXBA 2RDWA 1GORA 3LLDA 1JAKA 1WXZA 2NX1A 4ZXLA 1MRAA 3TA9A 3PVFA 1QPRA 4WR3A 3VM7A 1ZJAA 1E3XA 2X1IA 1J0KA 2EGZA 4HB7A 3CYJA 4O1BA 5KINA 2HPIA 2Z1BA 3SZ8A 3MA8A 2Y1HA 1TJRA 4UFLA 5GJMA 4Z1CA 3W4RA 3IRDA 4KWWA 4IIHA 3L5LA 3H54A 4DLMA 2FTPA 3OVQA 4QG6A 1PX4A 1T8QA 3ENLA 2VDHA 3CQ0A 1BYDA 3BMWA 2YYTA 4PUDA 5I6SA 5HPOA 1XLFA 1V3IA 3WH5A 3B4YA 4CUCA 4FAMA 1FWIC 3N4AA 2WM1A 4FNSA 4J3WA 3C52A 4NL1A 4NRRA 1AJ2A 4BEQA 1EL3A 2GVJA 3OPSA 2DZVA 3U4AA 1JCLA 4DLFA 1WBJA 2FTWA 5DMLA 2TAAA 2VD9A 5I06A 4JTTA 3FFSA 4AISA 2XGIA 3NG3A 2P50A 3AZRA 4XAYA 1M7PA 3EWWA 4DJEC 1XDLA 3R2GA 5H2ZA 5HULA 1E72M 1W2PA 5E0KA 2J74A 5A8MA 3G6LA 3NYDA 3EKZA 4L65A 2X42A 3M7SA 3S4TA 2O4QA 1XBVA 2Y63A 3EPMA 4W5ZA 2VZVA 3A12A 4BF5A 1YBQA 1JD9A 4DAIA 5I02A 1W37A 1M9HA 4Q6XA 2ZIDA 3GWQA 1N55A 3AXKA 2EPNA 1KTBA 4IJCA 3SGZA 4GFIA 3AU6A 1BTCA 3VC6A 3WLKX 2BGQA 3BG3A 3OLIA 3A9BA 1MNSA 3ZO9A 4XBJA 3AIUA 1RK5A 1Z48A 2V5JA 3KBJA 1EJVC 1E0XA 2I57A 2WC3A 1XYBA 3BZJA 2NV9A 3KVLA 2GYIA 2ZC1A 1BLIA 4MY8A 2YA0A 1TUFA 2ZQ0A 1YIXA 3PJTA 1FTXA 1NWTA 5BWAA 1UR0A 4XIMA 1IZCA 3H70A 1LYXA 4JQ1A 1S1PA 2X7WA 1DIDA 4NX0A 1RP8A 3MKKA 4PL1A 4OIFA 1S2AA 5A8NA 1HIZA 4UUIA 1KBIA 4ACZB 6CGTA 1WB0A 3W1UA 3B0VC 5BOEA 3R94A 1A5UA 1TB3A 1KGXA 1T96A 1KM1A 5AVNA 1BXNA 3W88A 3TEVA 1ONXA 2F7FA 3E2RA 2FPTA 3TZNA 1OHLA 1DHPA 1RPKA 1V0MA 4F48A 3STCA 1KV8A 4U2ZA 1RH9A 3RCMA 3F5JA 5T26A 4DZHA 1ZU8A 2D2GA 4P7NA 4EIVA 2VX7A 3TXZA 3E9AA 4ZODA 2BV9A 3EX6A 3AC0A 4WXZA 4XBSA 3BXWA 3M0MA 4A35A 1JNDA 5AC6A 5I5RA 5FF4A 2D3NA 2ZKMX 3AALA 4OBRA 1XQKA 1XM3A 4CKQA 3PWIA 4FXSA 4AH7A 4AIEA 1QOQA 1XLAA 4Q4MA 1UD5A 1VEOA 1XUZA 1LOLA 3PZUA 1HGYA 1KD0A 2OSYA 4LYKA 1XLEA 3W1AA 1SFSA 4N9BA 1ZUAX 3IAPA 1E4LA 1Z89A 3EGJA 4WY0F 2HSAA 4XISA 1G01A 5G1TA 2J9XA 4E8DA 2PDCA 1SGJA 2WW5A 3N4EA 2GFTA 3SUSA 2G3NA 3M0LA 3WO8A 4ZOAA 3C2VA 3MI2A 3PS7A 4IZGA 1TCMA 1PX8A 5FEWA 3W76A 4Q8UA 2ZXDA 2FZBA 4JCMA 2QMJA 3CLMA 1NFGA 4NJHA 3W6LA 2DORA 2PA6A 3A6OA 3A13A 3FS2A 2I5GA 3IJLA 2VFHA 4GBUA 3EPOA 4IL0A 3B0YA 4JQ3A 4K37A 2YX0A 2VTFA 1MSSA 6TIMA 1FDJA 2PBOA 4Z2JA 3MV11 1MZRA 4JKMA 3CIVA 1KBLA 4ZZ9A 3DOPA 1E9IA 2P88A 1E0WA 3CASA 1C8VA 1XBYA 3ZS4A 2QJJA 4A4AA 3D5HA 1HW6A 1O5QA 4TV5A 2IPGA 5T91A 4D8AA 1XG4A 3ZR5A 3OO2A 2Z6JA 1YNYA 5TIMA 2XGBA 3SAZA 2GJXA 1FH8A 1XD0A 1KFBA 3ARTA 3E0VA 1FWHC 1P43A 5KSWA 4X2PA 3GAKA 3FSTA 2IW0A 4UQ9A 5GJNA 5CG7A 1M5WA 1XGZA 4IMCA 1XIMA 3DUGA 5A8PA 4KWOA 5GPRA 4XTDA 4MM1A 4JYFA 1F07A 3B9AA 2XVPA 1OK6A 2C16A 1S2UA 4HQVA 5K2ZA 1BWVA 3PBUA 3QN3A 4PR4A 3B8DA 1SJDA 3QQ1A 3CUGA 3EXRA 2VC9A 4PB3A 4QNWA 4ZOCA 4FIRA 1E1CA 1C93A 1G6CA 4YS1A 2EJ1A 2JBMA 1P0BA 2WQPA 5G1MA 4GYPA 3CHEA 4ORIA 5G1YA 4I8DA 1CNVA 3SUTA 3WY1A 1YPFA 2A3AA 3RLGA 1RA5A 2E6AA 3BMXA 4K7YA 4HGXA 3L21A 3PNUA 3RX2A 4J3XA 4C6KA 2HK0A 1AJZA 4MADA 1CGTA 1EC7A 1WOBA 1MFUA 4JHOA 1WNOA 2OXNA 3MSDA 5MKGA 3WQEA 1PYFA 4GUIA 1FP9A 4RDVA 4IIEA 1XISA 1XKYA 3W2LA 2EQDA 3LTSA 3KW3A 3WJYA 5HA7A 4QE1A 3N19B 3VMNA 4ZCWA 3HG3A 3OZMA 1LDCA 1DIOA 1V51A 4NRSA 1UR9A 3U57A 1V02E 4PMRA 2WLZA 3MB9A 1TV2A 4BQ3A 3AFBA 1YHTA 3NQBA 4D72A 3SQSA 3V4BA 4Y8EA 3UYCA 2VFIA 3GH5A 4YHEA 2RGLA 3O0KA 4HZ8A 1UBSA 4TX9A 3G8RA 4XAGA 1WV2A 2YBUA 4UFHA 3SCRA 3USBA 1IWAA 1RD6A 3BOLA 5SWUA 1DPMA 3WDQA 1D8CA 3QV7A 3GC5A 2YXGA 4UTMA 1HO4A 3LRKA 1GG0A 3P0XA 3VIKA 3DHFA 1QI5A 4HA0A 3PG9A 2GK1A 4LOCA 4FLQA 3UJSA 3CJPA 4JIHA 3NDOA 4W7UA 1W2VA 4S3GA 1TPEA 7ENLA 1OEPA 4LCSA 1R9YA 1MDRA 5EYWA 2CZ5A 3GTXA 3LENA 4X9SA 1MRQA 1BFNA 2YDRA 1OWQA 2DVUA 5EMJA 3GNDA 4MB3A 4ICCX 1XIEA 4JNZA 2CBIA 1HKWA 3O0FA 5FIPA 3C2EA 4U2YA 4WLCA 5HXMA 1H49A 5IHSA 4OT7A 1GVRA 3R13A 4I3GA 4A2SA 1KFKA 1LTDA 1GOIA 1GWJA 4A29A 5DX7A 1UROA 3GYEA 3NVTA 3JRKA 4CN1A 3GDMA 4EXBA 3KBMA 3QLLA 4DWSA 5CPTA 3WQVA 1GEQA 2A7PA 4IGSA 2ASHA 1QOXA 3UWWA 3WNPA 2ZRVA 3TMLA 4H01A 3BK0A 3CH9A 1DYSA 1SO4A 3SN1A 2FVLA 1MUWA 3VGHA 1VZWA 2CC0A 3OODA 3KFTA 4LVBA 3BANA 3TAKA 2BODX 3KE0A 1NARA 1E9LA 4AZ5A 5JU6A 1WDRA 3CL6A 4JAWA 4EP8C 3N25A 4BF9A 1K7EA 3TP4A 1ZBVA 2FGBA 2WJEA 3NXFA 4WHBA 1Q45A 3BLOA 1C8YA 3ZVHA 1EJUC 3EPNA 4MZ1A 3CZEA 1I8JA 1XLHA 2R14A 1H7XA 1V6UA 1ZJIA 3M0XA 3E1F1 3M5ZA 2ACSA 2C15A 4IMEA 1VBHA 3CTLA 3BCDA 4UNIA 4WX2A 3W1XA 3WSUA 3WF3A 1JDFA 4NQ1A 4I7VA 3EWDA 4MY1A 2BOGX 1NWRA 1P6BA 4D1IA 4ATLA 4Y9AA 4WSHA 1MXDA 3GX9A 5HJYA 1DJYA 2IPWA 3W82A 2YR1A 1OG0A 2G96A 1RLDA 2YL8A 3PM6A 3UETA 2WVVA 1TVNA 4K36A 4F0SA 1R5YA 3WLHA 1YKWA 3HURA 4I9AA 1EBHA 1EJWC 5E70A 2REQB 3RU8X 3FGCB 3GXDA 2YXOA 4QLLA 2Y61A 4D6DA 5BZAA 3YPIA 1C9WA 3P8IA 1KM2A 3UF9A 2PWHA 3CHDA 3WBYA 3FEMA 2PBGA 2IQTA 5AY7A 3THUA 5A6SA 3LK6A 3BJFA 4O8AA 1W1VA 1E1EA 2I1OA 5BW6A 2P0OA 1TPB1 1JCYA 1GQLA 5AOUA 3GUWA 2QCMA 5HR7A 4WY0B 3POHA 2YCKX 1UPPA 2PRLA 4PTWA 3RF9A 4LUJA 4OKDA 1GVSA 3S5YA 4EX4A 4EPBC 3WK1A 4GH3A 3AXMA 3WLRA 2DZXA 1UP3A 4X22A 4CEUC 3PJXA 4KFNA 4GLEA 4IWWA 3VIGA 3V75A 3A4XA 3RR4A 1FHLA 1OFRA 1TVLA 1U1HA 3GHSA 4PTDA 3WLMA 4PCFA 1X8FA 2DZBA 2NT0A 1UR3M 2XIMA 5K4XA 3FAXA 1Q13A 1QW7A 4HK5A 1XIFA 3H26A 1EO7A 2AGTA 4AZ6A 2W5FA 4U3CA 4GPNA 2AOSA 1K4GA 1ZJHA 1A5OC 2IS7A 1QCWA 4KFPA 3ARZA 1P7TB 1M1BA 2INFA 3QH2A 2Q02A 1DXFA 3H8AA 2INZA 4M6QA 1C91A 4YNGA 1GVYA 3GTFA 1UIOA 1EIXA 4O10A 3DFSA 4O54A 1YDVA 5FKYA 4XZLX 1RA0A 3BLLA 3ID7A 3O1NA 4NAFA 1OJXA 2BY1A 2QZRA 2G4FA 2J79A 3W7IA 3TQKA 3USZA 3W7RA 1UH2A 4EWND 3GHUA 4AD5A 1JZ7A 2OZ3A 2FVKA 5CSRA 2X2GA 1ZGDA 4MZ8A 4K7VA 4S3CA 1HKMA 5AYBA 4ZFCA 5AHFA 2OLHA 4LUSA 4O1EA 4DBUA 3WENA 4FI4A 4MKVA 4Y9MA 2CHOA 1OT1A 4FX8A 1KR0A 2BBFA 3ZJKA 1AJ0A 1W5PA 2WO5A 5B7YA 1SSDA 2QMKA 3C8FA 4W7VA 2J25A 3RPTA 2I56A 4MLRA 3ABOA 3NPUA 1UR2A 1B0IA 4XO6A 4H9YA 4XWUA 1R86A 4PMNA 1C7TA 1LQ2A 2VCCA 3SO7A 2FHCA 1WZAA 1OX4A 3T08A 3NQMA 5H1WA 4XZNX 4KEVA 1PV8A 5CXPA 3TFCA 3GDRA 5DT5A 4Y2WA 2YL6A 3EA3A 2BVWA 2INEA 4XTIA 1OD0A 3SCSA 3GDBA 1B9ZA 4PFMA 4RDYA 1TCDA 2VEFA 3LS9A 1WDDA 3QHNA 4NY2A 3TN3A 4CVWA 5E6ZA 2WQDA 3AISA 3SY5A 3NPVA 1XLJA 2ALRA 1Y5WA 1EYEA 4IUOA 3TC3A 2B81A 1ZAHA 1X7IA 3GR8A 4ZXOA 2PD5A 5GJPA 2ZWYA 3DKJA 3GRIA 4REQA 5KETA 3RRXA 1W3JA 4PGLA 3MUXA 3DFYA 3SADA 3P82A 1XG3A 2NQ5A 2W0UA 4S38A 5K9XA 4PMJA 3I4KA 2WMIA 2PLCA 4CD5A 3BGGA 3ELFA 1DWAM 4AF0A 1N8IA 3CIXA 3L4VA 1K9EA 2F6UA 3A24A 3SUVA 1V6XA 1HP4A 1B4EA 1FCVA 4XUYA 5IHRA 3THDA 1BVNP 4JIRA 2MANA 3UCCA 3MDWA 2R94A 1JG9A 1O5XA 2R1PA 2PC8A 3KZPA 3QJAA 5G4WA 3FDKA 4LCQA 3UJRA 5IBXA 1V8EA 1Z6KA 3DC8A 4R7JA 4Z2IA 5FAJA 4Q8NA 1XP3A 4B5UA 2A85A 5FF7A 2W9MA 3VNDA 3HPZA 1U5VA 4MF4A 5AECA 5I3FA 3HPFA 4PUMA 4G6CA 1JPDX 3DHDA 4H6KA 3L0GA 3A4JA 3MHFA 1CECA 1R7AA 1OADA 3IJQA 3PTKA 2XSXA 2AL1A 4WSJA 2E3ZA 2G97A 3C61A 4HMCA 4KH2A 2HNEA 2YGYA 2V5KA 1R7OA 4MFDA 4DO7A 2QCHA 4S3DA 3SY1A 3GXTA 4ZOBA 2VCBA 2WVSA 3EOUA 2RDUA 2BXZA 5CJNA 1ME7A 4MAVA 1U33A 3TTEA 2P76A 4R3UA 1AQFA 4B91A 3IIXA 4O13A 1KM3A 4MUZA 1AMYA 2PP0A 4KIRA 4IIFA 1I2OA 5I0DA 2JKPA 4KRUA 1PWMA 3BW2A 1K9DA 3LOTA 1JDDA 2CLHA 3LPFA 1VEPA 3GO2A 4B5NA 1IGSA 4MOZA 3VNKA 2WHLA 1GVIA 8RUCA 2V3GA 1W3LA 2V2HA 1KXVA 3EOEA 1NDWA 3W38A 1PXGA 2POTA 4Z1DA 1L6SA 1I1XA 3VKBA 1DHKA 4CNSA 1ML1A 4HBKA 4GBDA 4Q8TA 1Q6OA 5CJ5A 1UWAA 4Q8WA 3IGXA 1YLVA 1O6IA 1Q6DA 4EWJA 2YB1A 5FD0A 2IPJA 1QNSA 5A2BA 5LXXA 5H8PA 1GTEA 3T0BA 1Y65A 4IM4A 2D0FA 4KCTA 1GOQA 2WC4A 3TCEA 1EF3A 1UR1A 3ZSSA 2Q6ZA 3R0UA 3UBPC 4YVXA 3GNRA 1OY0A 1FXPA 1IF2A 3VNYA 3ITVA 3MANA 4O28A 6TAAA 4WKFA 5C9XA 1C9DA 3ZFHA 1W1PA 2Y8VA 1K8CA 1P4CA 3AO0A 1DIKA 2OTDA 4HMEA 3GS6A 3MPGA 2XU2A 3F2BA 5EFFA 4GJJA 1YYAA 3K5XA 3CL8A 2HCVA 3TROA 4IFKA 1VJZA 4QEHA 3GY1A 3H12A 5JIPA 5ABHA 2P3EA 1H50A 3WL1A 3WX7A 1VFUA 2NT1A 1I2NA 3DKLA 4ZR8A 2VM8A 3M1ZA 4Q4OA 3WK3A 2DH3A 5DFAA 4D8ZA 4FOKA 3ONBA 1M53A 1YXCA 3QC3A 1H11A 4JHMA 1L2UA 3P61A 3PULA 4LAKA 1LRTA 1JRCA 2A7NA 4PCSA 2QJIA 2QJGA 3H2FA 1XD1A 3VVGA 2WJZA 2BX7A 2H9AA 3MKCA 2FJUB 3ARUA 3T78A 5A6KA 4X3ZA 3V36A 4G2DA 2Z1XA 4LV4A 4DO4A 3QM3A 2E5DA 1IEXA 4X61A 4OJYA 5AHMA 3WK0A 2ISSA 5KZ6A 1TZ7A 2VUYA 3LRLA 5LNWA 5EBUA 1LUCA 4LXFA 1REQA 1PZ0A 4RDWA 2XSBA 3DYPA 1JCMP 2XUCA 5CJMA 3A64A 4Q33A 3AU2A 3E0IA 3VDHA 2VQUA 4ONVA 4IHCA 1CW2A 2P1FA 3ABXA 2BDQA 2OJPA 4LAZA 4UQDA 1BYAA 2O7SA 4N02A 1A5NC 4GQ0A 4JTIA 2VEPA 5CH9A 4HMNA 3AROA 3LRMA 1XPYA 3TR9A 5ABFB 4HPJA 4CU7A 3A9IA 3BAJA 3VIFA 2PDJA 2DIEA 1AZ2A 1QNQA 2FLIA 1DJZA 3TXVA 1KWGA 5DRIA 3BC9A 1P0KA 1OGGA 2E5BA 3MJYA 4MLJA 3T0TA 4E2BA 4FXJA 1MO0A 4Z0SA 1ZENA 3QFWA 4H7VA 5K4ZA 5D09A 3VGGA 1JQVA 3VNJA 1Q65A 3T7VA 4WDWA 2WZHA 3VKKA 1THFD 3W27A 3CQHA 4NJKA 3H24A 3UVAA 3G0SA 3KWSA 1UH4A 4A8IA 1Q6QA 4QGCA 3DIPA 4KQNA 2VCAA 4TXEA 1LWJA 2ODOA 3W6MA 4IIBA 4DJFA 5BCAA 3LDVA 1FWJC 4ZSUA 3H7RA 1D8WA 2FQIA 2WSQA 2Z2UA 3NZGA 2Y7FA 3VKCA 3FXGA 2ZTJA 1HP5A 4OQVA 2IQDA 2HQAA 1UR8A 4G56A 1XWYA 1WZMA 7ODCA 3QMRA 3BWWA 4MB4A 4QCEA 4BK9A 2OSWA 4O17A 4UNKA 3HTWA 3B9NA 3L7RA 3EWYA 1XCXA 1WKEA 3W81A 2VZSA 1DV7A 3NCOA 4O1FA 4HU0A 3FVMA 1HKKA 2DT3A 5KTLA 1CEOA 4FXFA 4W5UA 4EPDC 3QY8A 3M0VA 3UCQA 4ZFMA 3HF3A 3N2TA 2Z25A 3U0HA 3VD9A 1R3TA 4JTCA 2OYLA 2DH2A 4CNNA 5L6UA 2WJFA 3WF4A 3QF0A 3RM4A 2ZUTA 4MJ2A 1ZS2A 1J8VA 1EXBA 4AIUA 3VIMA 2EHHA 1RQBA 3P3BA 1E9ZB 3TZFA 3MSGA 3W74A 4Q8PA 3CAKA 2WOQA 4QJ1A 3L2MA 4MWAB 4PRTA 1NWSA 1NF0A 4W89A 1XBZA 3G1XA 5K9DA 2QCNA 2Z7KA 4JEJA 1GK8A 4GJ1A 3IGHX 5J8LA 4KWSA 1G4PA 3S42A 1KC7A 5LZLA 1HJSA 1N8WA 4HHPA 4JQ4A 4U31A 1VJIA 3M7WA 4NT0A 1MWOA 1NOWA 1OZQA 3PUDA 5LHFA 1UPMB 4URIA 3P0WA 4D6CA 3G1RA 2XFFA 2RFGA 4PTXA 3OG3A 3N1AA 5MHBA 1FWDC 3LSBA 3VO0A 3WQ4A 1U5HA 4BKNA 5TF0A 1T0OA 4LVAA 3WH6A 4MJMA 3BAXA 2HBXA 1M68A 1RY8A 4E4PA 1I6NA 3KLKA 1X97A 1VKFA 2C3ZA 2J66A 1RBOB 4W9TA 2DSWA 2QJHA 1H63A 3W26A 3VGBA 3W7EA 1SUXA 3ECQA 1NY1A 4LJ3A 5D03A 3ITYA 3SM0A 3UW6A 1IGWA 1E6ZA 3SECA 4Q4KA 4C65A 1JGMA 2Y2WA 2CLEA 3KWXA 5TQLA 4H6RA 4MWAD 1GOXA 3GU2A 1XRSA 3NO1A 2PWVA 2BASA 4MDPA 3VMOA 4E2OA 2V63A 4Z08A 4TMBA 1DL3A 3V7PA 3U4FA 4FB7A 1PKMA 2PTZA 1XUUA 5D38A 1J93A 3URNA 4E4UA 4Q8OA 3WNOA 1OX6A 3D0CA 3QOMA 3Q4DA 2QUTA 3AHZA 3T07A 4N4QA 1S46A 3TNBA 5A2AA 4DZ5A 3DG3A 1ZLPA 1AL7A 2VQTA 3TJLA 1J96A 1VFLA 2D24A 3PHAA 1ICPA 4F0MA 1SO3A 3I3DA 4ZQOA 5K7JA 1T5AA 2QAPA 3TOPA 3AXXA 3B0PA 2WNWA 1H7NA 2IUZA 3CHFA 3PZGA 1LF1A 3BCJA 4Z1BA 1VAHA 1G67A 1QMLA 2R6OA 1HFBA 4M1RA 2BHZA 2ZOXA 1WAUA 5FOOA 5A6AA 1UJPA 3VD3A 4B3LA 4CQ9A 3RX3A 2NV2A 4NZ5A 1R8LA 2H8ZA 3PUEA 2YZRA 2EEXA 4J5NA 4B2DA 4GVHA 3PF3A 4DBWA 4ENLA 3VUSA 3PZQA 4AY8A 2FJKA 4GCAA 4M6PA 4JKLA 3UWQA 3LGEA 4UFMA 2V3EA 4O19A 4KWUA 4LX4A 3M6DA 4D9PA 4UTKA 2ZE3A 4GVIA 4YL2A 1IWPA 4J2MA 4ROQA 1L2QA 3LXAA 1FWEC 1E0TA 3ARSA 2BY2A 4YYCA 3QW3A 3CZLA 4DJDA 1B9BA 2VP8A 3AJ7A 5EMKA 3VMPA 4N9DA 3AIQA 2WAGA 2DP3A 2CKSA 1JRBA 1XLCA 1JYXA 2NQ9A 3VGFA 3OVGA 3EMQA 2A4AA 4G5DA 4V27A 3KCLA 3P80A 2AAAA 4A3HA 2V38A 4LAOA 3SCPA 3ITTA 1P0NA 4GISA 2TMDA 3UJFA 1DWJM 2DGAA 2PTXA 8A3HA 4LUTB 4WXYA 3EOLA 2RH9A 4EVZA 3U5YA 2PSNA 1UH3A 3BE7A 1K6AA 1Q6FA 3TOYA 2GGIA 2WKGA 4XD5A 1FOBA 4LC8A 3HGSA 1POJA 4XUGA 3L12A 2W66A 2VI0A 4UFIA 3A4AA 4UQBA 4ICMA 1UKSA 4J9JA 2WSRA 3ITLA 3LGDA 4LVFA 1PL9A 4CD8A 3WUEA 3AS2A 3R1ZA 2E25A 3TH6A 2GDUA 2YDQA 3T6CA 3PBYA 3V5FA 4HN4A 3ARYA 5C8BB 5CZKA 2VZOA 2HMCA 3H4GA 4AHQA 1VR6A 4MJZA 1QK0A 2PTWA 2CXEA 5FJTA 1NOFA 1MQRA 3PZNA 2YW3A 1Q6EA 3S1GA 4LGXA 1JPIA 1QJWA 3VE9A 3UZYA 1Z44A 1ELSA 3AIBA 3ZIZA 4AD4A 4MWAC 5D05A 3UT0A 3BSGA 4ZBCA 3RLHA 3HQNA 5BXSA 3BW4A 1R46A 4UWMA 1XDMA 4L4PA 3GG7A 3T05A 3OBAA 3TW9A 2Q01A 1JVNA 4R9XA 1FUYA 1E4NA 2AL2B 4LBUA 3VOFA 3W1RA 3V1HA 4HCDA 3C0SA 4YTUA 2X7VA 5U7SA 3WMCA 5JUVA 2QQ6A 3U8GA 2PURA 1I2QA 2R9RA 2Y88A 1IQ8A 4GZEA 4JN7A 2O55A 3W01A 1M41A 4PUUA 3QV6A 1F6KA 1FDYA 3CTTA 1UYQA 2IMRA 4DYKA 3QY7A 2FIQA 5AC7A 5TAOA 3MSRA 2WZMA 4NJGA 5CC7A 4PBFA 4P8UA 3H23A 4OWGA 1J0JA 4QBXA 3F4VA 4MSSA 4ERGA 1CCWB 5BU6A 1IEWA 2PF8A 3SGUA 4Q4QA 1TUXA 4J3SA 1TYGA 3QTPA 2X2YA 1JD7A 2DUXA 3H7VA 4CLMA 5CLTA 4DRSA 1NDZA 4AX7A 4MPQA 3UG5A 2VR2A 3I3EA 2O9OA 4Q4SA 1A5LC 3HFYA 4UMBA 4AWUA 2E6DA 3G1SA 3WDIA 1CLVA 2DSZA 4H3DA 3F2DA 2PDQA 3SCUA 1MNZA 5DELA 2XWDA 2VL4A 1V77A 2QJMA 2UWFA 3C2RA 2XVNA 3G1YA 1KW1A 1RCQA 1E6RA 1LT8A 4YLWA 3FXYA 3R8HA 2P53A 4NASA 5C7VA 3OBEA 5ECUA 4L6DA 2VMFA 3GG1A 1TTPA 4DXXA 1GUVA 3B9DA 1M3UA 3NIYA 5CC6A 1YQ2A 3ARXA 3WQFA 2I17A 5M1TA 4B5TA 3VCCA 4O14A 3PUGA 4GVGA 4YTSA 2UY2A 4V28A 4BI7A 2HXTA 1WX0A 1FWRA 3AMLA 1KRAC 3S5NA 4US6A 3S8HA 4KIEA 2VD8A 4JR5A 3RMEA 1N82A 3TW7A 4HSNA 3IV8A 5A6LA 3EXTA 5I3KA 2YPIA 3OQEA 3OGVA 5AHIA 5H8MA 1QNPA 2XVGA 7REQA 5FJPA 4QQ3A 1L9WA 2OKOA 1QRQA 1WXJA 1WOAA 2G0WA 5FSEC 4RXFA 4O53A 2J7EA 3EA2A 4B5WA 1EH9A 3XIMA 3CEPA 1F3WA 4N42A 6XIMA 2R24A 2PF0A 1PCKA 4WOZA 1S39A 3LHVA 4JNYA 1FP8A 1XH0A 2PDMA 1K6WA 4UCGA 4HZ6A 1P0DA 3P84A 5FI8A 4AW7A 3TUUA 4JXCA 2J7GA 3ARPA 3GKFA 2Z7GA 4GCXA 3E2SA 2CERA 1Z32X 4CD6A 3BOFA 4FNPA 1G94A 6ALDA 4ZVJA 7A3HA 3VILA 4EE9A 1TV7A 1AH0A 2QUMA 1EOMA 4GI4A 4IP5A 4LBRA 4N4PA 1YX1A 2PB1A 1OM0A 4IXHA 1TWWA 2POZA 1GQIA 3EWZA 2ZVIA 3EWXA 1W17A 4TO8A 3PZVA 4W85A 5BNKA 2VZUA 3CMFA 3ME3A 4O57A 1KCXA 3G77A 3W7HA 1PX3A 4MPKA 3TTOA 4C6NA 5F2MA 3DHPA 1VHCA 4CD7A 3R5EA 3AHTA 4GQGA 4PCNA 2F8QA 2GPTA 5DBUA 1OZMA 1Q3NA 1W3TA 4H9MA 3STPA 2ACQA 2FKPA 1H61A 1V3HA 3WIJA 5CQ1A 3P5YA 3ALFA 1BWLA 2QDDA 3TYUA 2PEVA 4U4MA 5I2UA 2DY3A 1Y7VA 3ZVIA 5HBFA 2C13A 4JTHA 3CUFA 3O6DA 4UIOA 2PDBA 5C54A 3LQLA 3CUHA 1Z3NA 4M51A 4NJIA 1P48A 2FTYA 4QROA 3SIZA 1E5NA 2PDHA 3O16A 1X1NA 3S9IA 4KEZA 1TIMA 4AWTA 1W3IA 2HXUA 3CC1A 1DEDA 3ZT6A 3F2CA 1UUMA 2VYOA 2OELA 2IKGA 3WLQA 2YLAA 1GW9A 4JTGA 3W1QA 4RCXA 1RHCA 4M7SA 3OBKA 3EDEA 2C1IA 3LX9A 3ES8A 4E2VA 1XLBA 1R9XA 5HMEA 1X8CA 1RJRA 3KRZA 5AHEA 3VOCA 1RJPA 3S6OA 5BMWA 4FS9A 4O1DA 3BJSA 3FOKA 3M4HA 1Q7QA 3P74A 5DN1A 1H1NA 5EL1A 3FCPA 3SIMA 1FCQA 3EYPA 4ZQCA 3CB3A 3SSZA 2ZXAA 4F66A 2GUUA 4LAUA 3VDCA 4JY8A 3LCFA 4R53A 3T55A 1PIIA 4HOZA 2WK2A 2PP3A 2NSXA 1WZLA 3BQ5A 3RXZA 1QI0A 3DESA 3JUGA 2PDXA 4HSHA 3WLPA 4DXKA 1F74A 5FJRA 3T2PA 2DSVA 5C9UA 4GXMA 1QPOA 3PTMA 4GXPA 4AZIA 3OYXA 2D23A 2CZEA 1TJPA 1E56A 4CCEA 1IZKA 5IDIA 3M5XA 1V3MA 3BG5A 4JIEA 3ZLFA 5CPQA 1B3ZA 1UUQA 2DVXA 2ZA2A 1GGOA 3LCIA 3O05A 2DIJA 4W4QA 3FIGA 4JICA 5EU9A 4L5ZA 4S3KA 4U5KA 4B16A 3WYZA 3WD3A 5HNUA 1GHSA 5BMXA 3DAQA 1F6YA 1Z69A 4KS0A 4M6UA 1XLKA 4AZGA 3F5LA 1HX0A 5D9PA 1H5VA 3AICA 5DT7A 3BDKA 4GNKB 1QNOA 4O1AA 3QQ0A 4XZBA 4OOUA 1QTWA 3LBOA 3VOGA 5C7HA 1QW9A 2Q8XA 4H04A 2WZIA 1VCVA 4LB4A 2JKEA 4QJ4B 3MWCA 5BOFA 3EXSA 1KTNA 4DJFD 2YFNA 2OGJA 1AK5A 2G41A 3TV8A 3GNPA 4O15A 2XIQA 5HUOA 2PPGA 1H0GA 1TSIA 2XN2A 2Y62A 3R25A 4YTTA 4N2YA 4YN5A 3UXDA 1G4EA 3DZ1A 3F4WA 1J12A 2FVMA 1AG1O 4U3AA 2J24A 3HU7A 2DZUA 2Z1SA 5DQPA 3W07A 1JXKA 4ACZA 3LUTA 2X0HA 4JNMA 2NLYA 4HJFA 3ATZA 4IFOA 2HVMA 3CO4A 4UZUA 4PUKA 1YRRA 4CNUA 1FWGC 4KPLA 3TW6A 1XFCA 1H7WA 3R7MA 4F0RA 1NH6A 3QEZA 1ECEA 1R2RA 2QVNA 3PB2A 3AQUA 1Z7AA 4C91A 1NQ6A 3ARRA 3HGJA 3IS4A 1H2JA 3SGGA 3U2OA 3FA5A 3VUPA 5K3VA 1XYCA 1UIPA 4DBDA 2XH7A 4J28A 3VC5A 1UD2A 3DENA 3QQWA 2W62A 1SMAA 3AXIA 4LYQA 4NZFA 1WYIA 5L9FA 1E0UA 5DRCA 1ME8A 5DEZA 1CWYA 4S3JA 5HWJA 2WC7A 3W22A 4EF8A 2QPSA 1RVGA 1HZYA 3KBSA 5FEXA 4YYFA 2J6XA 2ZFAA 1YTEA 3GKAA 4WK9A 1MYRA 3W23A 4FLOA 4JTKA 2ZX8A 4WDTA 3TE9A 1K9FA 3KM8A 1OC6A 2OVLA 5IFTA 1AFSA 2G3MA 4US5A 2ZUNA 5LHEA 1ZBWA 1LP6A 1R9ZA 4AVOA 3G24A 1E71M 2EO7A 4O4WA 4DVOA 1JULA 4NJJA 3FLUA 2HS6A 2I7GA 1WXYA 1F05A 1OVDA 3WMLA 5GQBA 4IIDA 4RDZA 5FJIA 1CGYA 3OVPA 1VRXA 3AHVA 1E6NA 3A3XA 1BRLB 2YOCA 4PBGA 3PJUA 4HZ7A 3II1A 1TELA 5CPLA 4XSMA 3WD4A 1Q6GA 1AQHA 3APGA 3OYZA 4IJBA 3M44A 4NZ1A 3REQB 2ZXQA 4DZAA 3BLFA 1J11A 2XZ9A 4NG3A 3RR1A 4RE0A 2W63A 3QKZA 3WUGA 4K68A 3GH7A 4LS0A 3JZEA 4B3ZA 4NZJA 1ZSXA 1MXGA 4FR6A 5C9ZA 2CZDA 4AD3A 4MVAA 1PDYA 2GDVA 3LNMA 2QCCA 3H2AA 2WXDM 5BWFA 1ZB5A 1KFLA 3WJZA 3HA1A 3UA3A 3ZJ8A 1NM9A 3BG9A 4HPXA 3ATYA 1XI3A 3I65A 4ILSA 4ADTA 3W2UA 3GHTA 2QF7A 3KUMA 4M6VA 2CNCA 1TRIA 2RAGA 4DJFC 4NSBA 1ODUA 3MO7A 3U9IA 3LXBA 1J0ZA 2X0SA 4B2DD 1ALDA 2OYMA 4JX6A 1SO5A 4QDWA 2DJLA 4F9DA 1JI2A 2D2OA 4RW3A 4NZ3A 3JW7A 3IANA 5LIYX 2ZZ5A 1V6YA 3AWOA 2HK1A 3JS3A 3M0HA 3FJLA 4PRWA 3W28A 4DJDD 2PGRA 2DVTA 3VD7A 4MYXA 2D0GA 3CO8A 3WD1A 4EANA 3ZM8A 5HMSA 2RUSA 1XIBA 4HPGA 1EC9A 4FO4A 3W3OA 2HROA 1IT0A 2XDFA 3QV8A 1VB9A 2WHMA 3PR2A 5EPDA 2ANUA 3ERPA 5H8UA 1OFPA 3TTSA 2V30A 1L0PA 4UMCA 1J0YA 3MCMA 1TJ1A 5LIXX 3KTXA 5F2IA 4S2BA 2VGBA 1WP6A 3KAOA 4RJEA 1B30A 2OFJA 4RK8A 2F2KA 3EAUA 4Y9PA 4YXGA 2HZGA 3CIWA 4JPGA 1CXHA 2EPMX 2WYSA 1KXTA 3KRBA 4ZB5A 3EBVA 1WKDA 3VZYA 3WBWA 2YJQA 3LM7A 3N04A 4PZVA 2NX3A 6ENLA 1X6NA 4XG1A 4QJ5B 3THQA 3OP2A 1EZWA 2F2HA 1QI4A 4UOQA 3R0KA 3PY2A 2O4MA 4IPIA 1K7FA 2E1DA 3H2OA 4JTEA 5F7UA 1Y0EA 1NELA 1TTIA 4ROPA 2VENA 4JTRA 3N6HA 1EP1A 1GVEA 2I5QA 1GPWA 5LSMA 1EHAA 1SSGA 4GYJA 4AWEA 3KVKA 2PMQA 1E1FA 5D37A 2PWDA 2UY5A 2XFRA 4DUVA 2BOEX 3EB4A 3J7HA 3ARVA 2E7FA 2BVTA 3UJEA 3WD0A 4F79A 5HOSA 4IIGA 1I60A 4M56A 1EFZA 5AKQA 4UR9A 4C6FA 2A6LA 4C1NB 3IUDA 2WHKA 4IF2A 1F4AA 3ZQ9A 3GBEA 4G8TA 3O6CA 3WF0A 4YCOA 1B3VA 2E9BA 4IXXA 3MQTA 4C6CA 3VU2A 4Q7IA 2GLKA 4R7WA 2UBPC 4XB3A 2A3BA 1W8GA 3GXMA 3NDZA 1RR2A 1PTDA 3PFRA 2A3HA 3EDKA 1AW2A 4IFRA 4POCA 2VGFA 2IPFA 3KTSA 1OABA 1YDYA 4AEOA 4QFUA 1UC4A 3UZZA 3G3DA 3MMUA 1F76A 4JL2A 3MMTA 3NZ1A 4R33A 1DJWA 1KBKA 3P62A 4DXVA 1P1XA 4HP5A 3E74A 3GDKA 2A2IA 4HHHA 2CITA 1OFQA 3GXIA 1MQQA 3WFLA 4TTGA 5FF0A 2NQJA 1QASA 2NXIA 3ZYZA 1ZL1A 4QSFA 4Q32A 4M3PA 3W37A 2A3CA 3E5PA 1ONRA 3GTNA 3KHJA 3SQLA 3MUZ1 3N15A 3OIXA 5DMNA 1O12A 1CGVA 3V0SA 1P1MA 4AYSA 4GGHA 4GUFA 4LQ1A 2DSUA 2OT1A 1EJ7L 2ATSA 3EWUA 3AZTA 2VFFA 1UKTA 1Q2SA 4LYPA 1XHGA 4MY9A 5CZ0A 4DJDC 3JZUA 5FL0A 4MIMA 1O95A 4HK7A 3GTHA 3U3HA 3IARA 5FEPA 3HG4A 1R2SA 2FPYA 3V5OA 4WSKA 2YB4A 2WMHA 2Z1WA 3MC5A 3AIRA 3T0AA 2PTYA 1KGWA 3ABQA 3V16A 5IXEA 1XLDA 5KEZA 3CXOA 1XFBA 4WZHA 5AC8A 3ORWA 2PUZA 4WKAA 2J8FA 2CFFA 1W31A 1JCNA 4IPNB 2XYLA 4LEFA 3N18A 3ZWSA 4GH1A 4CN6A 2DZWA 5I3DA 3EEZA 1YXDA 2KAUC 4ZENA 1Q4WA 5CPOA 1NF7A 3TYZA 2REQA 3FGCA 1KR1A 2GDQA 2FHFA 1LL4A 3TYBA 5AYIA 3K30A 5C2XA 1K1DA 1C8QA 1PHQA 4K1GA 1GJUA 3T8LA 1R2TA 3RJXA 5AYZA 1YPXA 1BTMA 3K1DA 3WH9A 3NL6A 1EO5A 3GHRA 4EAYA 3UWUA 3A5FA 3APYA 2Z26A 4DELA 2NUXA 1O66A 1D3CA 2YL9A 3SSJA 3WQ5A 3VPLA 1H51A 1W3NA 1ZNNA 3CK5A 4WY0A 2I5IA 2BP1A 3DEQA 5D2YA 2J6VA 1U1JA 3RFAA 4MKSA 1L6YA 4DF1A 1ZCCA 3WL0A 3M9YA 4IQLA 2ZWZA 4LU0A 1Q8JA 3INPA 1WDQA 3VINA 1J79A 5PTDA 2CEQA 3I4EA 1OINA 4IPJA 4OZOA 4RE2A 5A1AA 3WLIA 4XZIA 4CQAA 1ISXA 2DW7A 3DECA 3N73A 1PKNA 2QUUA 4GGBA 1BXCA 1EPVA 4C1KA 3DHUA 2DQXA 3DFTA 4ERIA 2PU0A 4QNEA 3BO9A 1S2VA 2AQVA 4R27A 4DPQA 2PGWA 1A53A 1NDVA 3F4CA 2NSOA 2RJHA 1P7TA 4AD2A 2W67A 1PUDA 2IXVA 5G2HA 2WBGA 4HNVA 4IQEA 2J7CA 3K8MA 3HJZA 4RW5A 2BVDA 4NF7A 4NXKA 5A6BA 1SPQA 1VYRA 5C9RA 2C1HA 2VVSA 1ZAIA 2PWFA 4FX7A 4GZJA 2XH4A 1FA2A 3U5UA 3UZXA 3C86A 2Z6IA 3Q67A 2Y7DA 3LG3A 4PMYA 1FHVA 3IK2A 2PWUA 3N2OA 5KZDA 4EACA 1LORA 5BXRA 1BXBA 4AIOA 4QXIA 5XIAA 3PP7A 5DY3A 4OUEA 1R87A 1GYNA 1EP2A 1XLLA 1XQLA 1XJBA 4KFOA 4S3FA 1L6FA 2GVEA 1V6TA 3FYPA 4NYUA 4G7EB 1S2CA 4FXRA 2GL5A 1UKQA 1NFPA 4NUWA 1TREA 5CLWA 4AUBA 3BUVA 1J0HA 2XN0A 4MG4A 4RZ4A 3ZSTA 4UR7A 3ZJ7A 4JGDA 3OU8A 5DLCA 3PPHA 1Q2RA 3VM5A 3H22A 5MF5A 3WLSA 3IUIA 3MCNA 3WLJA 3KP1A 4QQUA 2PD9A 5D33A 1QWGA 4PMOA 4H7ZA 1XSJA 1XIIA 4PMDA 2E5CA 4L6HA 3GVRA 4AMCA 3B40A 4NNAA 4A05A 4GX9A 3DFPA 2HVNA 1F7BA 4OE7A 1XV8A 3MVIA 2VEIA 5HMFA 4PCPA 2Z27A 3IIVA 1S5MA 3FV9A 1N7KA 3PB0A 2QCEA 2CETA 2VURA 1XRTA 2ZX5A 4HU8A 1PBGA 5HWMA 3SW6A 4DN1A 1S2WA 6XIAA 1JPHA 1FWSA 2J75A 4AC7C 3CUIA 2E4TA 4KT2A 1W1ZA 1XS2A 2W91A 2FYMA 4IPPA 3LCGA 3WNKA 1NIUA 1SZNA 2VC6A 2X8RA 3OA3A 3RUBL 4GMEA 1PKYA 1VPYA 4LALA 2C0HA 2QUVA 2GOKA 2V3DA 1J9YA 3FKKA 4XAFA 4JX4A 2ZRXA 4UXDA 2D22A 4HMDA 3M0JA 5E9XA 4Z42C 1V5XA 4JTFA 2ZUSA 1W9BM 1EBGA 1PS9A 2QIWA 4RPPA 3VAVA 1MXSA 2Q3RA 3HG2A 1F4HA 4C6JA 4LFYA 3WDJA 1WKFA 3R43A 1RY0A 2ISDA 1UD8A 5HK4A 2C7FA 3MBFA 4RPQA 4ML9A 4H9UA 4N9CA 1DP0A 9CGTA 5A6MA 1VGAA 2WANA 4JEQA 4UTWA 3AI0A 4DI9A 4J40A 1LJYA 1GQJA 3K8LA 3R89A 3T1GA 1R85A 3P6LA 2XIIA 3WG6A 3QXBA 3F1QA 1HN1A 1OQFA 5TD4A 2GQAA 2YL5A 3L4UA 3PWGA 4H8HA 5H91A 3ITCA 1F3EA 4UTUA 4AX6A 3RLUA 4H9ZA 3JU2A 1SZRA 4ZO7A 1VFFA 2G5WA 1BSLA 4IQJA 2ICSA 2D69A 3FVDA 4ZO8A 2YCLB 4MNMA 3HQPA 1TV4A 2BGNE 2E28A 1LQAA 2NUYA 4DHGA 1H1YA 2J9ZA 3FYYA 3SEPA 1S38A 3VNMA 2V5LA 4H19A 4GD0A 3VI2A 2HEJA 1BKHA 5AB3A 4INFA 3DGRA 5LNUA 1JJKA 3P93A 3W2KA 4PE8A 3RCYA 3TK7A 1EB3A 1Q6CA 4H8UA 3O07A 4HN8A 3ZWTA 1YNQA 2WLYA 3M16A 3JR2A 3IK4A 4AYGA 3UPBA 1EHNA 2Y24A 3HV9A 1GVOA 3R79A 2PDLA 1XICA 3PAJA 4MMWA 1GJPA 2KX9A 2VKZG 3TR2A 2PCEA 5CPNA 4EAMA 1XCFA 1RK6A 3L5AA 4OTKA 1MUMA 3K13A 4US5D 5C55A 3RPDA 3IUHA 3LXCA 4OHQA 1DTNA 1WDPA 1H09A 2O9PA 5HR6A 4L9XA 3E6EA 1HL8A 2YIHA 1X96A 3F7JA 2Q8LA 5C9WA 4FP1A 5REQB 9XIMA 1H5YA 2BS9A 1JUKA 1KXQA 2EF9A 4IMAA 3W25A 4DM2A 3MP4A 1EJTC 4F4RA 3SCNA 1BQCA 5FCZA 4BQ4A 3TC6A 5CC3A 3GVGA 1P6WA 2JF7A 1XCWA 3E0LA 1QO5A 4MWAE 3UWZA 4N6EA 3NGJA 3T0CA 1DXEA 1DJHA 2FH8A 3U7VA 3DG7A 3W7QA 2Z29A 3W75A 4L64A 3I6TA 4IT1A 2BGSA 4QITA 1XGEA 2OEJA 5LIWX 1UB3A 1HO1A 3AS0A 1ZTVA 3LGGA 1KNWA 1VYSX 1HJWA 3DU0A 3TIMA 4ATDA 3LHTA 1T7LA 3B4UA 3UEQA 2XN1A 3NJ3A 4ADUA 4MFEA 3STEA 3T2QA 1QO2A 1BG9A 3AAMA 2PRHA 4FK9A 5A3HA 5DCBA 1FCBA 2E0PA 3EKGA 1P6CA 3SDOA 2R1MA 4PB5A 2YA1A 3PFMA 3C2YA 2RHGA 1DWIM 3GH4A 3I7QA 1ADDA 3PBVA 2GSHA 2OR2A 3NQCA 2GUBA 4O0KA 3H2NA 8XIAA 2AMGA 2QPXA 3WUFA 4UTHA 1PSCA 9XIAA 1W0MA 4H9XA 2XFWA 2V5CA 3DBNA 1JDCA 1EEPA 1IWBA 4LV9A 2R82A 1BD0A 1E6PA 3THAA 1R38A 2Y89A 3PPCA 1KFJA 4D6EA 2DU2A 5I3IA 2FDMA 4C7DA 3Q45A 3TA6A 3W0KA 3OVRA 4O8RA 3B03A 3IJ8A 4DB7A 2G3JA 4I5UA 3K4AA 3UZ5A 3U7BA 4JIQA 3R11A 2A3LA 2VHLA 3EEGA 3ARQA 5ABFA 2R91A 4XVDA 3B9OA 3WBEA 4Z1AA 1IXPA 3W7JA 1R6WA 2EAWA 4K39A 2FZ9A 5C6MA 2YA2A 2WNNA 5CSUA 5D04C 2YZ5A 5HPCA 4Y8FA 4U5IA 3SCVA 1XYLA 2JQXA 4B15A 4W7WA 4KWVA 2OLSA 1UA7A 4B4HA 2GJNA 2EPOA 2B7NA 3WNNA 3VKAA 4YJ5A 4Q6JA 5EKYA 1T40A 2Y85A 2VC5A 4F3HA 2X1UA 1UMLA 5BROA 4C6QA 3EOSA 5HQMA 4GK8A 3OZYA 2ATMA 4ZGYA 2ZRYA 3CZ8A 1CXIA 1KWKA 1OIMA 1EYWA 1R3QA 2X1RA 1UQYA 2OEKA 4NI3A 1E5JA 5BRQA 4AHOA 2VRJA 3WFAA 4FX6M 3G6MA 1VIWA 5I78A 1JI1A 5HINA 4UOZA 2PWGA 2PZ0A 4QLKA 1Y8BA 1XSKA 1HF6A 3UY8A 4LTSA 2Z2BA 3SJ3A 1B5TA 4E38A 1MMFA 3K4WA 3UNDA 1FCUA 1W5MA 3FJ4A 3N2CA 4MAZA 4WDUA 5JMUA 3IIPA 1LBFA 2Y8UA 2HE5A 4C90A 1YDOA 2Z28A 4GKTA 3Q37A 2X1SA 2B4GA 1V0LA 5A8OA 4S1FA 3PN8A 3HIJA 4HT3A 4GYKA 4CQ8A 1TPH1 4MWAA 1EEXA 3OQ8A 1EPXA 3W7GA 4I5RA 4LS1A 1WE5A 2Z4GA 3E2VA 1QVBA 4R5EA 4PULA 4L9YA 4FHAA 4ZTYA 1TV5A 4EPEC 3EX2A 3WBAA 3RO6A 5KZMA 5CG0A 1CBGA 1UZ4A 3PSVA 3UD6A 4K2SA 1SVDA 3VTRA 3UWYA 3VOHA 2X41A 2VR5A 1BEUA 2P10A 3L2LA 1LWIA 3TYCA 1VFMA 4Q3MA 1SFTA 5EA9A 4M7TA 3BL3A 3O6YX 3KS5A 1W1IE 3HV8A 5GNZA 3PBGA 4YWSA 1PPIA 1CXLA 3IPWA 5ENLA 1ZBCA 4GUJA 3BSMA 3S5ZA 5LKYA 4AD0A 4CQDA 2W6RA 2G8ZA 1PIGA 3QYQA 1EKOA 4XZMX 2QNEA 1TR9A 1CENA 1X98A 1SFLA 3UCDA 8CGTA 3WMSA 3LBCA 4ML4A 1CI1A 3T44A 3LU2A 2J7DA 1XDJA 3TWAA 3WEOA 4I9MA 1QPNA 5BXTA 2F38A 3GDLA 4I7WA 4ZL1A 4W86A 3NNTA 4AQLA 1W32A 3LZ3A 4S39A 3GM8A 1U30A 2DFAA 1UWIA 3BLIA 2W79A 2BXYA 3IRSA 3NWRA 3Q65A 5I7GA 3VABA 1NOUA 5HWNA 4ALDA 1SJCA 1DWGM 2ZZ3A 3QV9A 3GK0A 1NQKA 2OX4A 4PSRA 3G3MA 2YCIX 2PS2A 1PWLA 1UKPA 3GNXA 5KMYA 4I9TA 4L56A 3UPWA 1SMDA 3GU1A 1U2YA 5LIUX 1K03A 1E15A 4TX8A 2C8NA 3HJEA 4DF2A 2PAJA 3W1NA 4PH6A 4PBEA 1TZZA 1Y5XA 1QHPA 1XSIA 3HG5A 4LYRA 3CL7A 3I7SA 1R3WA 1ICQA 2AKMA 2V69A 2IKIA 3BV4A 1JZ3A 4NZ4A 1Q5MA 1I2RA 1LM1A 3HM7A 3E3HA 3FW6A 2XWEA 5GNYA 4F2BA 3QMTA 1PTAA 3UGRA 1ZFJA 2Y4SA 3F03K 4PRRA 3LLFA 1US0A 4KESA 2VX6A 3M0YA 2QGYA 4JFWA 4M80A 3SB0A 2VC7A 3N17A 3GR7A 1RSCA 3E0FA 3QBUA 4K1WA 1CB2A 3BAWA 1MQPA 3F4NA 5AFDA 3W2JA 2ZYFA 2C6QA 4L4LA 4XD3A 4JTLA 5LA1A 4M1BA 1GOOA 2D2JA 4TX6A 3E96A 1E4MM 4AAJA 1FWWA 3BAYA 5DCDA 4YHGA 4LUTA 1S5WA 1L6GA 3W7CA 2YKKA 3NXLA 3HPXA 1XINA 3T4WA 1J2BA 3URAA 5I3JA 1MEHA 5M3WA 3THCA 1ZP4A 3NSMA 5A6BD 3P14A 3G1FA 4M8UA 5FF3A 1WPCA 4UC5A 4X2RA 2B0MA 3RN6A 4ECLA 3DERA 1OYBA 2E40A 4V33A 2NVDA 1P5BA 1DXIA 4JQ2A 4X60A 3O63A 2VOMA 3A4WA 4GVFA 1EZ2A 4JN6A 5A5WA 3W70A 2WB5A 3VIPA 1LLOA 2GQ8A 1V0NA 2AGKA 1LL6A 3WLLA 3NUKA 1G1YA 3M5YA 5FJOA 3TQPA 1E55A 4GO8A 1BVWA 4PMVA 1SW3A 3H55A 5EMYA 2O9TA 3NZRA 4XSLA 4IJRA 1QHOA 1C90A 4LNYA 1JDEA 1IIGA 3D3FA 4HHMA 2Z2AA 1O7AA 5EBAA 2J9YA 2NUWA 1FWFC 3TQVA 4MB5A 4M0XA 4F8XA 3BV7A 2BMBA 1IEIA 4C6IA 1YTDA 4H2CA 1MEWA 3C56A 3TYAA 1J6OA 4JBRA 2E9LA 1PHWA 3MYOA 4X63A 3A22A 5JIWA 1W3KA 5FL1A 2NLIA 3DXIA 3HGRA 3VDGA 2DZSA 1BF2A 1QHZA 4H7CA 1AMKA 1X39A 4MNLA 1F2JA 3L4YA 5D9OA 5E1QA 3AHYA 4I90A 1FH9A 4A3YA 1A3XA 3T09A 4ZB0A 1EP3A 1RLCL 3C0JA 1S1RA 2HVOA 1WBHA 1EJXC 3WJSA 1TPUA 4HYWA 5IFPA 1NDYA 2FFCA 4PEKA 3UQNA 1JGIA 4QHRA 5CBBA 4MDOA 2ZZ4A 3VZZA 1JUEA 4WJ8A 2F9RA 3MT1A 1IXQA 3KOWA 3IGUA 2I14A 3HPSA 1XL9A 3G18A 1GW1A 1FHDA 2GQ3A 7PTDA 1TFVA 3PZOA 3PBWA 1HL9A 1TWZA 3MKVA 1F9CA 4CCCA 4CGTA 3LM3A 1WKYA 3GAYA 3ICJA 1AODA 2XIJA 4B92A 3M47A 3GD6A 2QCDB 3C3UA 3WMBA 5FF2A 3CV7A 3ES7A 2Z0IA 1C29A 4HA4A 3AHXA 5BRPA 4B9YA 2ZRWA 3S3GA 4B3KA 2C14A 3VKDA 1HKJA 1MW1A 1O4UA 4CNOA 3LCLA 2KZHA 3TN4A 5CGQA 5HANA 1QXLA 3GC4A 3M41A 4IH3A 4AD1A 1RCXB 3S2LA 1ENUA 3PBMA 4OECA 2OZ0A 1RCOB 3I10A 1D2KA 3EB2A 1LWHA 3RITA 4TOQA 1KO0A 1FWBC 5D2WA 5AVHA 5C70A 3O8AA 4QISA 3QLDA 1LRQA 4IQDA 5HUPA 1N8FA 1UA3A 3PC0A 1CXEA 2DT1A 1X38A 1OT2A 4J3UA 2F61A 4IG2B 2E8ZA 3G8EA 4M24A 2A21A 4H8VA 3LPOA 5XIMA 2C19A 4LVGA 2J7FA 4CQCA 1UCWA 4S3EA 4GY0A 3LD5A 4ZO6A 3APTA 1UOKA 4L4OA 3S83A 3T4CA 2NX9A 1V7YA 2BOFX 2OOGA 3QPYA 2UY4A 2O92A 3QPEA 3MYPA 1QBBA 4HOWA 1U83A 4K38A 3WD2A 3ZXWA 3TTYA 3CT7A 3OHMB 2WHJA 1VLIA 4TUFA 1CDGA 4JTUA 5F4SA 1Z41A 4FF7A 3AYRA 1M6JA 4IGMA 4R9OA 5CBJA 2PC4A 1BVZA 1EGZA 3V0TA 1DQXA 1K8ZA 1CT5A 4BEUA 4DO6A 3IGSA 3LB0A 2PDNA 4FLRA 4HNCA 1WCGA 1TJ2A 3CHVA 1OK4A 1A50A 4A2RA 3LSCA 3URQA 1XR2A 4MYAA 1LT7A 1UQZA 3E2QA 1W5NA 4YVVA 5IDZA 1A0EA 2DT0A 2H8XA 2BZNA 4GINA 1I4NA 1CGUA 4AFYA 1QWKA 2HS8A 1MZHA 3LHUA 1PYMA 5T9BG 4D8LA 4R88A 4KW2A 3L67A 3LQGA 4A8LA 4LANA 4O1CA 4JKKA 1FQ0A 3MP5A 4WEVX 1X6LA 3M6YA 2EKCA 3A3WA 5LGZA 3L4TA 2VGGA 5D8WA 3TONA 3WELA 4C7GA 4AEFA 4PCTA 4BZYA 3BW3A 2ZUUA 1RALA 3H7UA 1A5SA 4V2XA 2FGZA 2PTDA 4NAEB 2QVHA 4FLSA 2WM0A 2D20A 5E5CA 2QF8A 2ZZ6A 4RV8A 1D7KA 2G50A 3LCXA 3W29A 2V2CA 4PL2A 4BY3A 3NQDA 4GE8A 3BPWA 5EMUA 4UTWC 3IVUA 3W83A 5E9AA 1GEHA 9RUBA 6REQB 4Q8QA 1E51A 3W1LA 3V1PA 5FAGA 1KLZA 3M5VA 3I68A 1K8YA 1S2TA 2Q8ZA 5F2LA 4LSBA 2ESCA 4RKAA 4RLIA 2OO6A 4GHRA 3EA1A 2Y70A 3OLGA 1DWFM 1KCLA 2EG6A 4ZE4A 1Z42A 2PRMA 1UBPC 3N2BA 4Z2HA 1EX1A 3LHZA 5A6TC 4P8XA 4E5TA 4IP4A 5U4NA 3NR0A 1E40A 1UMYA 3W00A 1ISYA 1MVYA 1ISZA 2VJXA 3AYTA 3NL3A 3NQAA 3WNLA 4WIWA 4KERA 1PZ3A 3H2EA 1E70M 3CU2A 2OSXA 3H4WA 2CZFA 2V67A 3D3AA 3R12A 5HJLA 5G4EA 1V6VA 1HT6A 1B54A 1I9CB 2ZVRA 4JDYA 4JY9A 5IM51 3B04A 4JTDA 1O1ZA 3SFWA 2PGFA 1AVAA 5A8GA 4DWDA 4NXSA 4PUJA 4RXGA 4IISA 4F2UA 2V82A 1C7SA 1Z9AA 3CV1A 3KL3A 2O9RA 3S1VA 3WDPP 1RVKA 3FDGA 4N7QA 3MI6A 1RZMA 1EUNA 3GFYA 3EKLA 2XINA 2F6KA 1JNEA 1K70A 4AVFA 1AW5A 4O52A 2RGMA 3K1GA 3B0XA 3CWNA 4AXKA 1BWKA 1MW2A 2IKJA 3GVVA 3GXPA 1E73M 1ZBKA 4HA3A 1GCYA 3DH7A 1W9VA 3TCSA 1OB0A 3CNYA 2L5HA 1NP2A 4GIRA 3BQ6A 1UG6A 4E8GA 4WRHA 2GSEA 2OWWA 3PK7A 3UG3A 1JR1A 4P7LA 4UTLA 3W85A 2V0TA 2NWRA 2BHUA 2CLPA 4I7UA 2QULA 3NPWA 1H4PA 4P7OA 4GA8A 1R3VA 2RKXA 3NO5A 4JN8A 5HQEA 2QHAA 5I09A 1OCBA 3SURA 3PTDA 1TQJA 2ON3A 1X7FA 3W7LA 3C5QA 1Q66A 2X09A 1JFHA 4O50A 3L9CA 4JTAA 1QPKA 4PUNA 4LUYA 1EIBA 3A5VA 1O94A 4GC4A 4RX0A 3F5KA 1EUAA 1OFDA 1NEYA 1QDSA 4CNPA 4PMZA 5C5YA 3LPGA 3KBNA 1H7OA 2YYUA 1TMQA 4FR1A 1KCKA 3TAOA 1S5TA 4E3VA 4FNTA 1KBJA 2V9DA 2GOUA 4HYVA 1HG3A 3LV5A 3W53A 4HJWA 1W5QA 4ATWA 3IAQA 4BJHA 1OFEA 3AZSA 1I75A 4QG8A 1M7JA 2OWCA 2JGQA 3EZ4A 3CBWA 2FH6A 3UNTA 1CXFA 3OLDA 1YW1A 3KTCA 1C3FA 3N14A 4HIBA 4AWSA 4LW7A 1XKJA 4Z0JA 2Q71A 3QW4B 1JEZA 3RHGA 1KKRA 2Z00A 1SR0A 1OCJA 3H2CA 1EDGA 3Q58A 3VA8A 3VIHA 4O12A 2J8TA 3CHCA 6A3HA 5IRPA 1IR2A 1BRLA 1AW1A 1JCTA 2VDIA 5BXPA 5H6HA 3EWCA 3CAWA 3MHUA 4A3QA 4Z1YA 2BB0A 1PEZA 1SU5A 3P60A 7CGTA 1GNXA 3W7DA 3DYOA 2ZZ1A 1FWTA 3REQA 2J77A 3W1TA 3IIZA 3CS2A 1VYPX 1VENA 1JXJA 4G7FA 4L7ZA 3RX4A 5LIKX 3S6TA 3N3TA 1MW0A 3MUCA 5DXYA 1AD4A 1LQ0A 2AAMA 4GYFA 3UR2A 4DUXA 5CC5A 5HQLA 1CLKA 1V3LA 4H8NA 3B8VA 3W72A 4ZEPA 4QS5A 2DIKA 3GFXA 3VK5A 3G0UA 1OSEA 2FZDA 3HQOA 3LMYA 3CPRA 4JTSA 2J13A 3AUJA 3O15A 3S1WA 1SW7A 4XKMA 1O68A 3L66A 1GJWA 3LHYA 4DNMA 3UGVA 3S0CA 1UKOA 1W1A1 3OHIA 4FOUA 4HPHA 4C6BA 1NSJA 1VD6A 3HO8A 4CQBA 3UJ2A 1HVXA 3MW7A 4UFJA 4PMUA 1DE6A 4BS0A 1SQ7A 4PODA 1ISVA 1QFEA 4QS6A 1IEVA 3BZGA 4OV9A 2OWXA 3HMCA 3S9YA 2GJRA 2G95A 3SQMA 2FZMA 1PVNA 5CBIA 3W9ZA 3NOYA 3LMZA 5E6YA 1A0DA 4HTYA 1XX1A 1XYFA 4ZTXA 2NQHA 4Q8VA 2CLIA 2J7BA 3UXAA 3RG6A 2WBKA 5RUBA 2DJXA 5LNVA 1LOQA 2WSPA 4GQRA 2ISVA 4BI5A 1TPVA 1JYWA 2Q09A 3PZIA 1FH7A 3L0NA 5C0QA 1KRCC 3VD5A 4DO5A 1TR1A 1FRBA 3N9RA 4AZCB 4B5SA 3NQFA 1GQKA 2EBNA 2OCZA 3HPAA 1JZ5A 1XGDA 4XBKA 4JIIX 4NILA 2OEMA 3ABSA 3B8UA 2AMXA 1G0CA 4DYJA 2OOFA 5G4HC 3UERA 3AIWA 2BVYA 1J2WA 4QM1A 4A21A 3KCOA 3I7RA 1K77A 3NYZA 2E9MA 2J7HA 1MUCA 2ZA3A 3IVSA 3AOFA 1VF8A 1W9DM 2ZZ2A 4KCWA 4R85A 4Y90A 4QAIA 4QE5A 2DW6A 5JBEA 2XTKA 2J62A 4AHPA 2XH2A 4MUPA 4GZIA 1SO6A 3FAWA 4L1GA 2VELA 4H1ZA 3N6JA 3RPMA 1QATA 1ITUA 4XD6A 1VH7A 4W87A 4HOXA 3SN4A 4JYDA 2V68A 2A3EA 4CN4A 3W84A 1FHUA 1Y5VA 4PC8A 4I6VA 3URBA 4Z17A 1YTKA 3NQGA 4O11A 2ZUMA 2J8GA 3NM3A 4JDBA 2BG5A 4UCFA 4P7RA 4LS2A 2Z24A 2I9EA 4TMCA 3UESA 2WVUA 1KM6A 3N4FA 1ISWA 1K3UA 4GKLA 1V79A 4WGXA 3SBFA 3WQ6A 1G4SA 2J27A 3KDOA 4KF1A 3T81A 1ZQ5A 4LC6A 3NURA 5CAHA 4C1NA 1AUSL 3CEUA 4XKYB 1MEIA 1KQYA 1H60A 4YVPA 4JFTA 3L4XA 4XZWA 3C0LA 4QIUA 3E5BA 3N9KA 3RDKA 3AYSA 3N11A 3UY7A 3L0KA 4XIAA 3GQYA 5D4YA 1AL8A 1V02A 1TA3B 2CCRA 1B1YA 1W9PA 4PMQA 3W1MA 4GIAA 2B31A 4HNUA 4A3RA 1CGXA 2GGEA 3ZT7A 3UG8A 4B90A 2QJNA 1A3WA 4E0CA 1EDTA 1OFBA 3AIEA 4QCFA 4IL2A 3WDHA 2ZZ7A 5CEWA 4ZA0A 2WV8A 1LBLA 1R3RA 4YIWA 1UZDA 2OZTA 1SJAA 1L8PA 3R10A 1X1ZA 4GIYA 4PFHA 1O60A 3RAOA 2ABAA 3MMDA 1F5ZA 1OC7A 3OEXA 1UASA 2WMKA 3EX1A 3H2MA 4I9JA 4PEEA 1JYNA 2VUNA 3OGRA 5J04A 2VWTA 4C6LA 1YE6A 2WKLA 4MZYA 4DI8A 2PU1A 2H3BA 4L80A 1JDAA 1UJQA 3TN6A 3T40A 4K8GA 3CQIA 3ZT5A 3I3BA 3WQDA 1FY6A 3IIOA 3PZ9A 1EGMA 4UTFA 4OUIA 2GQ9A 1ZHAA 1QUMA 3SFKA 3AMKA 2TRSA 3D6NA 3ZMRA 1QU4A 3FY1A 3NO3A 3S6DA 3MP3A 1IEQA 1Z8AA 2XPKA 1RP9A 3WQGA 1HL2A 2YDSA 4CNTA 1CYGA 2P8CA 5EFDA 4B5VA 1NVMA 5J5DA 4JS3A 1TWIA 2ISFA 2E1WA 2PLKA 1XC4A 4BCEA 3LA