3V36A

Aldose reductase complexed with glceraldehyde
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 105
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v36A00
4PRRA 1IEIA 2AGTA 5C7HA 1Z89A 3R8GA 1X97A 4XZMX 2BGSA 2DV0A 3COTA 4WDUA 4XVDA 4GCAA 4GQ0A 4JTCA 1VBJA 2I16A 1A80A 4AUBA 4DZ5A 1JEZA 3LD5A 1YNPA 4DBSA 2R9RA 1Q13A 1Z8AA 4XO6A 1IHIA 3DN5A 1OG6A 2IPJA 4YVXA 2HV5A 3LUTA 3C3UA 3N6QA 1S1PA 1S1RA 4WDWA 2ISFA 3DOPA 3O3RA 3T42A 3LENA 2IKIA 1AZ1A 1PZ1A 2PDYA 4H7CA 4XO7A 2PDCA 1YNQA 4LAZA 5LIUX 4JTRA 2ALRA 3B3DA 4FZIA 2C91A 3LZ5A 3G1RA 3LN3A 3LQGA 4PR4A 3UZYA 4GQGA 2F38A 2ACRA 4JIHA 3EB3A 2DUZA 3M64A 4IGSA 1GVEA 1EKOA 3CAQA 4IJCA 2PDLA 2HDJA 3ONCA 4LBSA 3UGRA 2IKHA 3GHUA 3Q65A 2A79A 2PDKA 4R9OA 4WEVX 2PD5A 2PF8A 4JQ2A 3GHTA 1YE6A 3LZ3A 3RX2A 4XZLX 1ADSA 2PDJA 2P5NA 1XJBA 3R58A 3R7MA 2PDWA 2PDMA 2HE8A 4GACA 2IPWA 1PZ0A 2PDPA 4G5DA 4WDTA 2ACUA 2PFHA 1T40A 4JTQA 3R8HA 3GHSA 3EAUA 2IS7A 2QXWA 4XZHA 3NTYA 2BP1A 2BGQA 2PDIA 1PWLA 2PDUA 5HNTA 3H7RA 3CV6A 3U2CA 3LBOA 2INEA 1Z3NA 4WRHA 4DBUA 3N2TA 2FZ8A 3WG6A 1EL3A 2IQDA 2WZMA 3F7JA 1J96A 5HA7A 3WBYA 3LNMA 2FZ9A 4JIRA 3BUVA 2ACQA 2IKJA 4F40A 3CV7A 3V0TA 3D3FA 4I5XA 3ERPA 4JQ3A 1EF3A 4XAPA 4JTAA 2FGBA 4HBKA 4JQ1A 4FAMA 4PMJA 1HW6A 3WBWA 4PUWA 2FZDA 4LAUA 5DANA 2PDGA 2PDHA 2PDBA 3S3GA 4IJRA 3CASA 5LIXX 3UZXA 5JH2A 2NVDA 1RY0A 5LIYX 1T41A 4JQ4A 3WCZA 3Q67A 3CAVA 3BCJA 4Q7BA 2WZTA 3H4GA 3UZWA 1ZUAX 2PD9A 4PRTA 1Z9AA 3M4HA 4L1XA 3V36A 2PZNA 4GABA 4ZFCA 1YE4A 1RALA 3GHRA 4L1WA 3RX3A 5LIWX 5LIKX 2CLPA 3UWEA 4XZIA 2I17A 4LB4A 2PDFA 4XK2A 4HMNA 4JTDA 3VXGA 4GA8A 1AH3A 2IPGA 4PUUA 3BV7A 1K8CA 1MI3A 1C9WA 2PDNA 4YU1A 3LQLA 1X98A 4MHBA 3LEPA 2HVOA 1PYFA 2ACSA 2PDQA 4ASTA 3V35A 4JIIX 4QX4A 2J8TA 1UR3M 2FVLA 3R6IA 3V0SA 1PWMA 4OTKA 1R38A 1EXBA 4JQAA 1VP5A 4YS1A 3RX4A 4QXIA 4GIEA 3UP8A 2IPFA 3G5EA 3KRBA 1AZ2A 4XVEA 1M9HA 1RY8A 1X96A 3MB9A 1ZGDA 1AH0A 3BURA 4RPQA 4XZNX 3P2VA 1ZQ5A 5AZ0A 2F2KA 1Q5MA 4Q3MA 4WGHA 3MC5A 1ZSXA 3R94A 4DBWA 2VDGA 4FALA 2PDXA 1QWKA 3M0IA 4FA3A 2NVCA 5HNUA 1MRQA 2HE5A 4WDXA 5KETA 1MZRA 3GUGA 2R24A 2FZBA 5AZ1A 4LB3A 1QRQA 4QR6A 1XGDA 3UZZA 3CMFA 1HQTA 4LBRA 3ONBA 1XF0A 1AFSA 4NKCA 3O0KA 1AH4A 4YVVA 1LQAA 1US0A 3FX4A 4ICCX 1SM9A 1FRBA 2HEJA 3FJNA 3QKZA 3UG8A 2INZA 3H7UA 2PEVA 4QBXA 3R43A 1S2AA 3EB4A 3UYIA 3UFYA 4YVPA 1LWIA 2IKGA 3WBXA 4EXAA 4EXBA 3V0UA 2HVNA 2DUXA 5M2FX 5JH1A 4H8NA 2IQ0A 1S2CA
chains in the Genus database with same CATH superfamily
3HPZA 4CVWA 4RDVA 3CEUA 3PBWA 4MZ1A 3G8EA 4NYYA 3JZEA 3GRIA 3T07A 1Q4WA 3MA8A 3D3AA 4WDUA 3IJ7A 1NP0A 1UD5A 3S5OA 1IWBA 1VCGA 3EOUA 5AHMA 4H83A 4CCZA 1YBQB 2XZ9A 1VKFA 4HNNA 2VTFA 4IMCA 3H7VA 1HJVA 2BXYA 4GIAA 2Y70A 1NDZA 3C0JA 2DT1A 3N04A 3G1DA 2DIEA 3LUTA 3AXXA 4XAZA 4YWIA 4TUFA 1NTHA 2C15A 1BPLB 1FTXA 3P7YA 3HA1A 5KZDA 3DDMA 3W88A 1F6YA 4GISA 1NFGA 3QC3A 3WNKA 4AZHA 5M03A 3KDNA 4NJJA 1KRCC 3W7JA 4L4LA 2ZUMA 3DFOA 1ZS2A 4FNTA 5FSEC 1LOQA 4XAFA 3P3BA 1A0CA 1M04A 3LPFA 1C8YA 4QJ1A 4HMDA 2EO7A 3F1QA 2P53A 4NU7A 4W5ZA 5LNWA 3OVQA 3URAA 1QVBA 2QS8A 2J7CA 1AD1A 2GGJA 2YDRA 1FWHC 3WLJA 1JFXA 1B54A 4H2CA 2IKHA 1DXFA 1JZ2A 3N6HA 4XWUA 2ZOXA 3JVAA 4UC5A 1UMYA 4PUKA 2Q71A 5C8BB 2FHBA 2BBFA 5LXXA 5FL1A 4JQ2A 2P3ZA 1IXOA 5D2YA 2NXGA 4XZLX 1ADSA 2VX7A 5FF0A 4H41A 1NJJA 4WJXA 1YPIA 2W61A 3R58A 3UR2A 4HU8A 2H3DA 3I6RA 1C29A 5JBEA 1D2KA 3ABSA 2J27A 1BLIA 3E0IA 4IGHA 1BWKA 5KTLA 2OPJA 4DPPA 1TPVA 1KTNA 3SUSA 4O1AA 2DT2A 3I7RA 2FPTA 1KRBC 3GHSA 3DHFA 2ON3A 1Q65A 4ADSA 4A05A 4AHPA 3DFNA 1YDNA 4A8LA 4H9ZA 1LG2A 5GNZA 3BG3A 3HU7A 3T0AA 5KINA 4GVFA 1KNWA 3F4VA 3ZMRA 4RK8A 2VOTA 3QV6A 4MSSA 5EU9A 1R9ZA 1UMLA 2FIQA 1E4IA 1WDWA 4WXZA 3WLNA 5A2CA 2BODX 1XQKA 4O1BA 2V67A 1FWRA 1XCFA 4L9XA 1QASA 2G96A 2ZTKA 3BG9A 4IPIA 3QSTA 4MJMA 4JQ1A 4FR6A 1FWSA 1ZNNA 2CBIA 2QCDB 3LB0A 1TTIA 4H19A 4JFTA 1FCBA 4NF7A 3OBEA 4XD4A 2QCDA 4D1JA 1XIGA 4TIMA 5J04A 1W3LA 4A3RA 1PSCA 3SBFA 5CSSA 2C1IA 2ZX6A 3SI9A 3ITXA 5F2MA 3UBPC 1KGWA 3PG9A 4AIOA 4ZOCA 4PCSA 2OSWA 3DFTA 3APTA 1J8VA 2ANUA 1I75A 4MWAC 3RPDA 2JIEA 2ZQ0A 4IZGA 3LX9A 3V36A 3BW2A 3TA6A 3STEA 1IQ8A 3MYOA 1SO4A 5BWAA 2OYKA 3KL0A 3VGBA 2QHAA 1F3XA 1ZRQA 5LIWX 1KD0A 5AHLA 1NP2A 2DZVA 4Z2KA 3T0DA 2WVSA 3UWEA 1RAKA 4K38A 4NZ5A 1RXOB 1SZFA 2Y8UA 1RVKA 4Q8PA 2G3JA 4AD4A 4AXNA 2X40A 4S3AA 1Q6FA 3IVSA 3TJ4A 3W02A 2PDNA 3REQB 3MS8A 3LQLA 3O1NA 1L6WA 3H8AA 2ZWYA 2GWNA 3ARQA 2WW5A 3N17A 2OLAA 2DZTA 2WXDM 5CAHA 1HKKA 1PBGA 1J11A 1QPOA 3TTQA 3HGRA 4Q22A 3IV8A 3ITOA 3TQ0A 5F1UA 2HS8A 3MUZ1 3VOCA 1AJ0A 3A21A 2WM0A 4Q6JA 3I68A 2UY3A 1JR1A 1WDDA 4GD0A 3U7VA 1TJ0A 1OCJA 4I3GA 3SADA 3MP5A 3BURA 4HK5A 4EANA 1ZQ5A 5AZ0A 2XN1A 2A85A 3ZR5A 2GVLA 1P7TA 3IARA 3W1TA 2VC9A 1ZSXA 4PC8A 1JRBA 3N1AA 5CZSA 4BWLC 1QWKA 2MUCA 4C6EA 1YLVA 5XINA 3UR7A 3B4YA 1NFBA 5A6MA 3W73A 5HULA 4NHVA 1H51A 1G69A 5CGQA 4PBGA 4US5D 4CGTA 4K39A 4Z08A 1OCNA 4UMCA 4DLFA 2TSYA 4AWEA 4AEFA 1PIFA 1KFBA 5BMXA 2CZ5A 4KF1A 4LBRA 1XF0A 1E70M 4NKCA 3O0KA 1AH4A 2PWUA 1K6WA 1TB3A 1EGVA 1C3FA 1WZMA 5EB8A 1HKVA 3PY2A 4JKMA 4RDWA 1IR1A 2ZUTA 5A6TC 2C16A 3NM3A 4S3FA 1RQHA 4QBXA 2X1SA 3A22A 4PTNA 3VKBA 4J5NA 3BE7A 3QGAC 1TZ7A 3M41A 2PSNA 3LRLA 4LNCA 3S6DA 3B4UA 5LNVA 5EFDA 1IT0A 1H2JA 2J13A 1XIEA 4IIBA 1JZ6A 2BVTA 3BWWA 2F6XA 1QI5A 1IEIA 3WENA 1EF2A 1BYCA 2ZDSA 5A6AA 3R8GA 2FZNA 5G2IA 4N4QA 1V0MA 2JGYA 1REQA 1GQLA 3GU2A 4AUBA 1EJSC 2OSXA 1LUCB 1VFSA 3ZLFA 4QTGA 3WJXA 1TQXA 1P6BA 2PTWA 3LK6A 1N82A 1OG6A 3GXNA 3WD0A 3T8QA 2CWXA 4DF1A 2CBVA 1US2A 2F84A 3THUA 3NYDA 1W37A 4ZVJA 1XRSA 2Y2WA 3C8FA 1Q7ZA 2IKIA 2OB3A 2HPIA 3LERA 4XO7A 4B90A 2QJNA 2FDMA 4K8HA 1OX4B 1EB3A 4E38A 4TMBA 3CBWA 4ZGYA 1LZOA 1R30A 2YLAA 3B3DA 4H01A 2WMIA 5KZEA 5JMUA 1OT1A 3T2QA 3AROA 2V5JA 1H61A 4UOQA 2DW6A 1TX2A 3PBMA 4PSRA 1R9XA 2CKSA 4KCUA 3P6LA 4YTUA 5A5WA 3B0UX 3T4CA 1M7XA 4GVHA 4JL2A 3F2DA 2A3HA 4LRTA 1Q8JA 1XBYA 2WBKA 5TD4A 5CQ1A 4N9EA 4BI6A 4DF0A 4MZYA 4O15A 4DYEA 2WKGA 1Z44A 1Q7QA 3GDBA 3OU8A 4WY0F 1WOBA 2OVLA 5I6SA 5J5DA 5D9PA 2WVVA 3TAKA 4EP8C 3W74A 7ODCA 5BXTA 3LSBA 3EB2A 1IGWA 1ZBCA 2E4TA 3CUFA 1JCTA 1CBGA 3SRKA 2ZXQA 1RQEA 1JD9A 3QF0A 4RW5A 4LTSA 3VD3A 4UOJA 3PUGA 4H9MA 4L4MA 3N2CA 3EOEA 4WVXA 4NJIA 4HVXA 4O50A 2XIIA 2O7QA 4HYVA 1W3IA 1R2RA 1HL2A 1UWAA 1PWLA 2ZRUA 2PWFA 3TW7A 2J7FA 2INEA 1WXJA 3TC6A 4G1KA 2Z6JA 3DFPA 3PFMA 2GOUA 3WBYA 1AW1A 3W37A 1RQBA 5CJ5A 1HZYA 1AUSL 4JIRA 1K9EA 3TCSA 3TOYA 5FJUA 3WLSA 1PXGA 2QGHA 4WXYA 1TRIA 1XLLA 3L4ZA 1DBTA 4JTUA 4URIA 5CPNA 1UPMB 4IF2A 5ABFB 4A8RA 4E4FA 1E9IA 4PUWA 2FZDA 1LTDA 4AISA 1SYTA 4EAMA 5ABFA 2NVAA 1UWRA 4P7NA 1AMYA 4HSHA 2XVKA 3VM5A 3WEMA 1R3SA 1SR0A 4JFWA 3PZUA 3USBA 3L0GA 4BA0A 1RY0A 3RDKA 2GGGA 3NZRA 3WQVA 4BFAA 3EKGA 4LUSB 4ORMA 3Q67A 3QMSA 4E8CA 2HBXA 4J3XA 2OZTA 3MP3A 1GVFA 4LU0A 1XIJA 2BY0A 3M4HA 3AYTA 3WQEA 1UROA 2DSWA 3HJZA 4GABA 4ZFCA 1PKNA 2NXIA 4Z1AA 1T8XA 3RN6A 2EQDA 2CZFA 5I00A 4H8UA 1E43A 1ME7A 2W63A 3NOYA 2HISA 1IF2A 4DI8A 3FJ6A 4W7WA 3U4FA 4Z2IA 1EWDA 2HTMA 3AUOA 3R25A 5EMJA 4S2BA 5TQLA 3S47A 3PSVA 1LP6A 4U2YA 5EY5A 3FS2A 2E6FA 1RP9A 1TPUA 2XH7A 1LL7A 1EJWC 4GMEA 2E5BA 1AQMA 2XIJA 4ICMA 1KWKA 3TW6A 5FESA 1IZKA 1ITUA 1WDRA 2OXNA 4B5TA 1WCGA 1R38A 2W66A 2ZBTA 1WZAA 3H23A 4PTXA 4U3AA 3W1NA 3LXBA 2QDDA 3N13A 4QXIA 4LJ3A 5FEWA 3UERA 1B90A 4MUZA 2Y8KA 4PTWA 3G3DA 1CXLA 3KRBA 1XUUA 2DIJA 4AZ7A 3PULA 2D73A 3PBGA 1RY8A 5C0QA 4ZO6A 3SURA 4Q4SA 2J7EA 2F2KA 3AIEA 2O4QA 2WJDA 1KFCA 1KGUA 2NZLA 4WGHA 3IK4A 1VS1A 1JI2A 4QCFA 5HJLA 1EO5A 2W92A 5E9XA 1OB0A 2YB4A 3AJ7A 1SMDA 4A8IA 3FEQA 4FA3A 2KAUC 4OWGA 5C9WA 5CG7A 2I5QA 3AZTA 3PJTA 4NZ3A 3N14A 2OLSA 3ARVA 1OHLA 3SFKA 1Y0EA 3VD4A 1M5WA 4FMVA 1XBXA 4S3GA 3OLDA 3FJLA 1PJ9A 3SR7A 3O8AA 2PUZA 2QQ6A 3PJXA 3PS7A 3NQBA 4NNAA 2A5HA 1L9WA 4JFSA 1ZZMA 3H7UA 3VC6A 1DP0A 1ECEA 4IFKA 1UIPA 2DSKA 1ISZA 1KCZA 2G97A 3UFYA 3MKVA 2A0NA 4M7TA 2GQ8A 4EXBA 3UG3A 1GQIA 2ZXBA 2I9EA 3GYCA 1XYLA 3ABZA 4GUIA 4L9ZA 3KWSA 4K3ZA 1QNRA 1OFOA 1VB9A 3TTYA 3TTOA 2E09A 1GVOA 1O68A 1EP1A 2ZRWA 1VLWA 4MADA 4PCNA 4AX6A 2G50A 1ALDA 1VBRA 2VM8A 3HJEA 3MDUA 4ECLA 2A7NA 3KE0A 3HFYA 4HHLA 1EYWA 2BB0A 3OIXA 4XVDA 4HOZA 3BZJA 5C6MA 5LXEA 1NVMA 2AL2A 3QTGA 4BQ5A 5IFTA 4LC8A 3BSGA 4GGBA 5RUBA 3SFWA 1H7NA 2PURA 1YNPA 3QV8A 3OIHA 1O5RA 1IHIA 4OGZA 2J24A 2IPJA 1RLCL 2VYOA 1HL8A 3R0KA 5ABHA 4IQJA 3LU2A 4FXJA 7TIMA 3M44A 3O3RA 2V5KA 1WAUA 3EWUA 3FYOA 2HNEA 1PZ1A 4L6HA 5HINA 5I79A 3OZOA 3KOYA 1YNQA 3IK2A 5T91A 3PWIA 2RJHA 3C8NA 2J88A 2CLLA 4EPEC 2V82A 3LZ5A 2FGZA 3ZFHA 4CNTA 1N8FA 5K9DA 1PIIA 2DZUA 1QCWA 2TYSA 3E2SA 3PB0A 2JK2A 2ACRA 4HZ7A 3OG2A 1QO5A 1P0DA 2H8XA 4X0NA 4PULA 4UFKA 5MKGB 1C7TA 1ZJBA 3VNLA 3M64A 2WB5A 4ACZB 3CPRA 1POKA 4S39A 5MKGA 3CV1A 4BR1A 3E0LA 1S5WA 3JRKA 2VGBA 5F2IA 1MDRA 3TA9A 2F2HA 2PTXA 2FKPA 3V16A 1M68A 5EMLA 3THDA 1TR1A 4HPHA 2Y5JA 1SO3A 1ZP3A 1BTMA 4W4QA 3CIXA 1Y7VA 1JXJA 3W7QA 3BJSA 4GPNA 9XIMA 1FWFC 1ZU8A 4PA8A 2NV9A 3LCFA 4JL1A 4A29A 3HOJA 4J28A 3RGTA 4RE0A 1KFLA 3AIQA 1B3XA 3M7SA 4EXQA 1NY1A 4JHZA 5LYRA 3CZEA 2FB2A 1GJPA 1WAWA 1LM1A 2I1OA 3T2PA 3PAOA 2E8ZA 3U2CA 3HQPA 1Z3NA 1XIMA 2VX5A 2V30A 1VIWA 3TVAA 4P7RA 3MHFA 5C5YA 1EOKA 1A0EA 1A50A 1EQCA 3VNMA 1H63A 1YX1A 5I07A 2OG9A 2ACQA 1AK5A 1KKOA 4XZ9A 2JKPA 1VC4A 4LT9A 1C8XA 5EMKA 3G8RA 3QQWA 3L5LA 4ROQA 4DJED 1XX1A 4HA3A 4HBKA 1VYRA 4B3KA 4YPJA 5CSRA 4LAUA 4JY9A 1VENA 4U2ZA 1EZ2A 5DLCA 2PDHA 4FPSA 3EMQA 1TJ1A 1TWZA 3M0XA 4AG0A 5LIXX 5BXPA 2H9AA 3T2OA 4R5EA 1WPCA 6ALDA 2R14A 3P74A 3U7BA 3FGCB 1QI2A 1LF1A 4IP7A 3B05A 1IWPA 1XGZA 4V28A 4ENLA 1NDWA 3T0TA 4QJ3B 1C7SA 1RD5A 4QP0A 4MB3A 2PD9A 4C6CA 4Y9OA 4K2SA 3KBSA 4W87A 1LUCA 1YE4A 3PHAA 1GG0A 1UB3A 5E6YA 5H2ZA 3F4DA 1IEVA 1CX9A 5E5CA 4OZOA 5LHFA 5A6BA 4PCFA 1H1NA 5E0KA 5DX7A 2VOMA 3RU6A 2QUMA 4O57A 3T44A 4GQBA 4AEEA 4DQWA 4L4PA 4IFOA 2Y1HA 4K36A 1UUOA 3PBVA 2QV5A 3PTKA 1XP3A 3W7EA 4E2DA 3LV5A 4H3DA 3EKZA 1QBBA 3N2OA 3TWAA 3ELFA 2XIMA 2E1WA 1XCXA 1W17A 3NZQA 1WDQA 1NOFA 1UR9A 3KX6A 2VUNA 3UJSA 3RLHA 4B9ZA 2E77A 1VFLA 1XLEA 2Y7EA 3E6EA 5FF4A 3UWWA 1J4EA 4J27A 2ZXAA 2W3ZA 1JJKA 4AH7A 4A21A 2OO0A 3ME3A 1A3XA 1EBHA 1IR2A 1PCWA 3FFSA 3HMCA 3OHMB 3BLKA 2Z1BA 3N25A 5JU6A 1XG4A 4HA1A 4GX8A 2IPFA 1PX4A 2W91A 3C5QA 4UNLA 1J0YA 3II1A 2VJXA 1U5HA 3EPNA 2VDHA 4HU4A 3ZR4A 1U5JA 2YL8A 3SAZA 1E40A 2NQHA 4DO4A 1JL8A 1PAMA 1F7BA 1S5TA 5FCZA 3M6YA 2DFAA 1EHNA 3ZSTA 1P43A 3BPWA 4Q8MA 5F2LA 5HNUA 2NLIA 3DUGA 1UA7A 2PBGA 4DXXA 2RAGA 3B8WA 4FOUA 2X1TA 3HMJG 5I3HA 2JQXA 1EZWA 3G1XA 3SQMA 1RCOB 3W7IA 4LYPA 4DZAA 1VRDA 1PCKA 1SZRA 4Q7NA 4Z1BA 4B2DA 2HXTA 5A8NA 1VFTA 3PSWA 2HEJA 4UCGA 1K8YA 4O16A 3K46A 3ZWTA 1KTCA 1WBHA 4FNRA 1I8JA 3OVGA 3S46A 1UR0A 5ECVA 1KM3A 3NQCA 5JBFA 4NASA 1YDYA 4U5KA 4FS9A 2WYSA 3IGUA 3LPOA 3VIJA 1GPWA 5FEZA 4LBUA 4FB7A 1TTPA 4I90A 6XIAA 1JI1A 1F73A 3C0LA 2B7PA 3TDFA 1GVIA 1CXIA 3RJYA 4B3ZA 2DZSA 2BVYA 3TW9A 4B15A 1QNVA 4DJEA 3GNPA 4GCAA 4NI3A 2Y85A 4GQ0A 3VIHA 3T40A 1A80A 4MYXA 5CPLA 4LEFA 4LUSA 3PFRA 4UQCA 1A5KC 1R3RA 1W54A 2RGLA 2VR2A 2J7BA 4EOUA 1Q13A 4Z0JA 5BU9A 3AQUA 4KMQA 1P0EA 2QMJA 5D38A 1E55A 2J47A 2CBUA 5D2XA 2YCLA 4LAMA 5E1QA 3THQA 1DOSA 4EACA 1CGVA 1I0BA 4QNWA 4XBJA 4LH8A 3POCA 1KV8A 3R12A 1QOPA 2PDYA 3W72A 3WF1A 5A94A 4LAZA 4ZOEA 3ZIZA 2VX4A 1KQYA 1R3YA 5DFAA 4C6BA 1KO0A 4ZO9A 4NSBA 2PWEA 5C71A 1LYXA 2PP0A 3LQGA 3TN4A 3DYMA 4PMXA 3BGJA 3KP1A 1BAGA 3NCOA 3QEZA 2VUYA 3IACA 1C93A 1AQ0A 1V3IA 2BOGX 2WBGA 2BXZA 3N9KA 2C8NA 2F8QA 4UQDA 2YFNA 4TTUA 4HNUA 1PE1A 2RDTA 2HK1A 3S9ZA 3QQ0A 1TV2A 1QPNA 3ONCA 4S3KA 3S0CA 3HG2A 3W1AA 3W7LA 5HOSA 3H2AA 1E6PA 2ZX5A 4RZ4A 4H9UA 4LVAA 1UR2A 3B8TA 3CS2A 3Q94A 3P8IA 3M16A 5AFDA 3IJIA 4NZCA 3BMWA 4IMGA 1P7TB 1U1HA 1UUQA 4ONVA 4F2UA 4MNKA 5C7VA 1AJ2A 4V2XA 1R7OA 1YNYA 2GYIA 3B0XA 2QT3A 3WQOA 2AOSA 1EDTA 2JIWA 2CC0A 3TYZA 1DJNA 4WY0B 3W7NA 3VFCA 1FWCC 2ACUA 4QS5A 4ALDA 1F8IA 2VEKA 1NWSA 3MI6A 4ZTXA 1D3HA 2VDIA 3LMZA 4IICA 2J75A 2OGYA 2PDIA 5HWMA 3CTTA 1V3HA 3NL5A 1VEPA 4C6LA 1QI3A 1J2WA 2ISVA 4Y9PA 1J96A 4OKDA 2BSLA 1NF7A 2XVNA 3QZ6A 4IXXA 4CNOA 4F2TA 2O9RA 5DCEA 2YA1A 3BUVA 3RLGA 2YDQA 3IVUA 3MO4A 1WP6A 3L9CA 2HQAA 3CQIA 3HQOA 3UXLA 1KRAC 4JQ3A 1CNVA 3WY1A 2YXXA 5DBTA 1B3ZA 1BG9A 1K02A 3BV4A 1OIFA 4HNCA 2DU2A 3TR2A 4NQ1A 6PTDA 4DUOA 2X7VA 4ZQMA 3OLEA 4CD4A 1GYNA 1OBAA 1RPXA 3O06A 4M51A 3S3GA 3HB9A 2VL4A 3UPBA 1U30A 2W79A 3SSJA 3UQNA 3N2BA 5HNRA 3AXKA 5C2CA 1QI0A 1JCXA 4QJ4B 4LYKA 4CU7A 4JIPA 4PCPA 4HOWA 3GXMA 5I24A 1H5YA 2RFGA 2XFFA 2BX7A 1J10A 2PZNA 3WUBA 2Y5SA 4CD5A 4LSBA 1IGSA 3IJLA 4W9TA 3RX3A 1NQKA 4JZ5A 2ZKMX 3CQHA 3DERA 3WNNA 3VU2A 4RDZA 3MHUA 4AWTA 3CLWA 2QF7A 1E4MM 1JGIA 3UETA 4DM2A 4E5TA 3WL1A 1QT1A 3TAOA 2IXUA 2PTDA 2WMIB 4V27A 4JTDA 1JD7A 1OJXA 4S3JA 3FK4A 3UG4A 1TWDA 3E2VA 4CNNA 3KS5A 4GA8A 4EWND 4JDBA 1EO7A 2WNNA 1OM0A 1E1CA 4Z1DA 1FDJA 3EXRA 2BMBA 3CB8A 5I3DA 1AW5A 4OBRA 1PYFA 4IFRA 4H4IA 5CSYA 4GJIA 2HSAA 4NUWA 5GJMA 3WMSA 1E51A 5G5IA 3WEZA 5BU6A 3DC0A 3KVKA 2BOEX 2Y7GA 1KTBA 1W3HA 5BWFA 5D2WA 2OX1A 1NWUA 5HAOA 3H55A 3QH2A 2ZUVA 3ZLGA 3G0SA 3ENLA 2Q09A 3FXGA 4JNMA 4ZQRA 1RH9A 3ITLA 1TZ9A 4MB5A 5TF0A 4JN6A 3AIVA 3UVAA 3OZMA 3VPLA 2VEFA 2QCNA 3NURA 4IIDA 3BCDA 3E0WA 6REQB 4Y9NA 3DFQA 1Q5MA 2E0PA 5D33A 2NSOA 1KRMA 4HPJA 4O19A 1ME8A 2VEGA 4MYAA 2YA2A 1P1XA 1P5BA 3GH5A 1GVYA 3H21A 1BG4A 3W82A 5KZMA 2R82A 1TYGA 3BAXA 3T55A 1JCJA 5ECUA 3PNZA 2I57A 2HE5A 4HMCA 3AUJA 1C91A 4FX8A 1XRFA 1D3GA 2GUYA 1OGBA 4S3EA 4YHEA 1A53A 2P76A 1KXHA 2VFDA 1R3VA 1AJZA 1KXQA 3FX4A 3W7MA 3N18A 4BY3A 1UCWA 4LGXA 1H62A 2O9PA 2WLYA 1K6AA 4HHPA 1Y5VA 1WKEA 1XL9A 3C0SA 2G8ZA 3M0MA 1EGZA 1Q4NX 1VPQA 2D2HA 1I1WA 3BMVA 4YVPA 4FNSA 3V5FA 2BVWA 3WO8A 4M81A 2HVMA 2QEZA 3DG3A 3EX2A 4UBPC 1GOWA 5JH1A 1XW8A 4Q6XA 2V8ZA 1Z48A 1KFWA 4WOZA 1HT6A 4GNVA 3W9ZA 1TPB1 3WZ0E 3NQDA 3VFLA 1ZENA 5A69A 1HJXA 4M8UA 2H9AB 2ZRYA 1YBQA 4W89A 2PB1A 4GLEA 2YB1A 4B5SA 4LOCA 6A3HA 1ISXA 3T0BA 1W9BM 3H22A 3DGBA 4Y9AA 2J8FA 3EA2A 1UZ4A 3QLLA 2FFIA 2I14A 3B04A 2XJ7A 1NARA 3RK8A 3NUKA 4YVXA 4UFHA 4GE8A 4LW7A 4Q32A 3C3UA 2YZRA 5LGZA 3LHYA 3N6QA 1C92A 4IXHA 4TX8A 2J9YA 4GKTA 3K5XA 1B4EA 4B3LA 1BYBA 1XSIA 4AD5A 2PDCA 5LIUX 3S1GA 3GX9A 4MDPA 3OOQA 3O15A 4Q8OA 3OBKA 3DFYA 1LORA 1E73M 9RUBA 3CH0A 1FXPA 2Z2AA 4W86A 3A13A 1TR9A 3UZYA 4PBEA 4CN6A 3VDHA 3H70A 5K9CA 3KZSA 3M43A 3SCOA 4AYGA 1GTHA 3UESA 1TJPA 3O6AA 1GVEA 2RUSA 3VI2A 3P81A 2VXNA 1LQ2A 2D2OA 4FK9A 1UYQA 2GVEA 1OF6A 2VZTA 2VX6A 3MSRA 2XSXA 5REQA 5FI8A 3SSZA 4YTSA 1ICSA 4YTTA 5KZ6A 1QOXA 4MY9A 4AVFA 4A35A 3M6DA 3OBAA 4JICA 2PDMA 1FWEC 4LVBA 1LRQA 2JEQA 1JDCA 5CZJA 3WX7A 2BLEA 1E3XA 2POZA 1KR0A 1CENA 3MU7A 3QGVA 3IJ6A 1O1HA 2QVHA 3TEVA 2BP1A 1A5NC 3S9YA 2XGZA 4UB9A 5FJOA 1TV3A 2XTKA 4HD5A 1JF6A 4RNHA 2G3NA 3VD7A 2UY2A 3PP7A 3OLIA 1U5VA 2PRMA 5B7YA 1OFQA 5K7JA 4GC4A 2WCAA 2WPGA 2OO6A 2DGAA 3CV7A 3M0ZA 4WOQA 1NH6A 1XFBA 1TMQA 3T1GA 3O2LA 5DEZA 1XC6A 4QE4A 3R8RA 1ZLPA 1F3TA 3SN1A 4IUOA 1R9YA 4V1XA 1O6IA 3LV6A 4ZOBA 3WF4A 4I5UA 5F4WA 1DIOA 2Z26A 2JKAA 2VQTA 1WE5A 4ZSTA 3MDWA 2VI0A 1EIBA 3GAKA 3QOMA 3TNOA 2WC3A 2D69A 3BJTA 1XGEA 4LCQA 2AL2B 1KXTA 1XS2A 4KIEA 3AFBA 2VCAA 3GU9A 1CPUA 2Z7KA 3GO2A 4IQLA 1HVQA 4WIWA 4HZ8A 2X16A 4EK7A 1EP2A 2P0OA 3NQGA 1QW9A 3DGRA 3I4KA 1TREA 4GY0A 5FKYA 4XZBA 1X8CA 1ML1A 1HIZA 1F2JA 3SCRA 2VRKA 5E09A 2VFHA 2NT1A 1NAL1 4K6AA 2GPTA 3W85A 1X6NA 4KWWA 3VXGA 2XIQA 4DBDA 3L65A 2Q3RA 3M7WA 5C9RA 2H6RA 1NSJA 4MKSA 3G6LA 1C9WA 3O9NA 3KTXA 3O16A 4U28A 3NZGA 1A4LA 1OCQA 2PRHA 3CHCA 4NI8A 3LEPA 3KLKA 2J79A 1CECA 4RW3A 2Q02A 1F4AA 5FF7A 4ATDA 4D6IA 2XZ7A 2JEPA 5D9NA 2QCLA 3CZJA 3M0HA 4H7VA 4R7WA 2YCJA 1PDZA 4BQ3A 2QKFA 1SUXA 3RLUA 1ISYA 4J4KA 3S6TA 4DIAA 3V0SA 1PWMA 1U83A 4WKHA 4WSKA 3KP0A 4L80A 3HFTA 1CYGA 4PUDA 3EX3A 1VJSA 1ELSA 2CERA 4TV5A 4QGCA 1EH9A 3ANYA 3DI1A 1V7YA 5A1AA 4Z0SA 4WJ8A 4MB1A 3FSTA 4QEEA 4GUJA 4O8AA 3S5SA 4D6JA 1UKSA 1S3HA 2CITA 3GVGA 1RK5A 3TSDA 3W7GA 3WD1A 4XG1A 2ZX9A 3HG4A 2V3FA 3IUDA 4Z2JA 5BOEA 1GT8A 5FEXA 2VELA 4DJDD 1H7PA 5D2VA 2E9LA 3EDDA 4CQDA 4M7SA 5CPTA 1MRQA 4S3BA 4ORIA 1JQVA 5DCBA 2EG8A 3VO0A 1YMYA 1XKJA 5A95A 4R9XA 3LSCA 4ZEPA 4U3CA 5DBUA 4QSHA 5C9XA 1MXGA 1XKYA 1A0DA 1XLCA 3TZNA 1V79A 2QJGA 3A6OA 4BI7A 1XSKA 3TYUA 2GDVA 3NSNA 3NPWA 1T6MA 3JS3A 5AHFA 3QKZA 1OFDA 1PV8A 1KM0A 4GH3A 1AG1O 4IX0A 3GXDA 2KZHA 3QV9A 1B2YA 3NO5A 4M82A 5CGMA 3BH4A 3B06A 5CLWA 4FLRA 1KBJA 1R3QA 2XYLA 1QW7A 3GLCA 1W1YA 2D23A 4O28A 4HYRA 3AYRA 1G4PA 2VZUA 2NX3A 1W5MA 1BFNA 3DBPA 1MXDA 1UD4A 5K4ZA 4PMDA 2TMDA 2QCGA 4KESA 4I6VA 1H11A 5BRQA 4QDMA 4GWEA 3S42A 4JEQA 3FGCA 5J5RA 2UY5A 4TQTA 3L2LA 5H8MA 2Z27A 4NX0A 3SCVA 3LD5A 3AYVA 3EMZA 1QPKA 3HPSA 4NIRA 4KIRA 3K4AA 5DY3A 3AS1A 4L1GA 4BF9A 2WOQA 1FH7A 3ARTA 4NAFA 4UTLA 3U8GA 3KHJA 3TSBA 2BHZA 1PIGA 2W67A 1FOBA 5ABEA 1RV8A 4HK7A 4NAFB 2BFGA 1EIXA 1UKOA 1J93A 5CC6A 2QUTA 1G4EA 1BYAA 4NNCA 2WZEA 5IFPA 1UR4A 4C7FA 4Z42C 3STCA 1NM9A 1NELA 1WKYA 1GHRA 5FJJA 1TSIA 4MMWA 1E1CB 5DRCA 3KBNA 4CD7A 4GGHA 3ZJKA 1DIEA 3QM3A 2C13A 4H00A 4CN4A 4X63A 3CWHA 4IJCA 1DHKA 4QLKA 3L5AA 1JPKA 6ENLA 4G7FA 2XVLA 1HF6A 2EHHA 1B9BA 1ICQA 4TO8A 3WJZA 4UTTA 2PD5A 2HCVA 2CETA 1QHZA 1YE6A 2CXGA 4QDWA 1BWLA 4LF2A 2AMGA 1FA2A 1HL9A 4UFMA 1HJUA 3GFXA 3R7MA 2GGHA 3LCIA 4DHGA 5GQBA 2Y63A 3JU2A 4QITA 4Q8NA 3T8LA 7PTDA 1TWSA 3WQDA 3NQ2A 5HWNA 4QG6A 3PZGA 4EWJA 1IT8A 1ZBVA 2ZC1A 1WA3A 2YOCA 2FJKA 3CPUA 4ZXOA 3MUCA 1WUEA 4KEZA 2DSUA 3BOXA 1QW8A 2YDAA 1XLDA 3GZ3A 3VX0A 2DZPA 2OJPA 1CGWA 3CHVA 3NL3A 2V5CA 2Z0IA 1QR7A 3F7JA 4S3CA 1FBAA 3W7KA 4UIOA 5HA7A 2WV8A 3LNMA 3BK0A 3RJXA 3VM7A 3B8IA 3IEBA 2J62A 2Y89A 4DYJA 1SJCA 4AX7A 4HSOA 3D3FA 1O1ZA 3GIYA 3GDTA 4NJKA 5K3VA 3TLLA 2QCEA 2H3BA 4NL1A 2XN2A 1FWAC 1CXFA 3NDZA 4H04A 3VNIA 1RJQA 1RUSA 1BQGA 1TO3A 4C6JA 1W5OA 3CL6A 1Q63A 1S5MA 4HPXA 5G2HA 4XUGA 4R53A 5IBXA 2DW7A 1KBKA 3ZOAA 3LA4A 3PJUA 3CC1A 1B3VA 3B8UA 2VD9A 4JNYA 3HV9A 1I45A 1W9XA 4FXRA 4IPLA 2A7RA 1QNPA 3MBFA 7TAAA 1E71M 5IOBA 4M6VA 3AMDA 2ZZ2A 1UBPC 2GL5A 2NQ9A 4Z1YA 4UXDA 4H6EA 3KRUA 1RVGA 4DAIA 1ZCOA 6XIMA 2YCLB 1UQZA 4BJHA 1V6UA 3DXIA 1HX0A 1DJZA 5LHEA 3RM9A 3NJ3A 3Q37A 3MCOA 3K8LA 2Z28A 3SDOA 2VMFA 1G6CA 4KEVA 3SCQA 3BSMA 3RM8A 4HQVA 2YCIX 1OABA 2V81A 1JCMP 3VX1A 3WUFA 2IPGA 3W7CA 1NU5A 4PH6A 4MGGA 1MI3A 2A2IA 4YU1A 3VOFA 1E0UA 1HKWA 4MHBA 3QYSA 5FEPA 5BRBA 2O55A 4US5A 4ICNA 3GC4A 2YIHA 3SCWA 2FVKA 1GEHA 1ONRA 5EPDA 3R79A 3TXVA 1RJRA 2J7HA 1XG3A 1GOOA 3FAXA 1CGUA 1SW3A 2OWXA 3MQTA 2AQVA 2WJFA 1QK0A 1VJIA 4EPBC 4CQCA 3LTSA 4M29A 4QM1A 3CQKA 1BRLA 2B0MA 3IJQA 2FDSA 2I9UA 4F48A 3EPOA 4Q8QA 1BRLB 5REQB 2UY4A 2YCKX 4WY0A 3I7SA 4O12A 1UJPA 4UNIA 3BANA 3HGSA 3VILA 3HIJA 3H2MA 2ZA3A 1OSEA 4Q4PA 1W9VA 4S3DA 4X0VA 3RO8A 2NWRA 3B03A 5H91A 1CLXA 2CNCA 2EPHA 4GYPA 4XD6A 4AZ6A 3LCWA 4DBWA 3OA3A 3LPGA 1IZCA 3K8MA 2PLMA 3RCNA 3CEPA 1MEIA 1MW3A 2VR4A 4A2RA 5DELA 2EGZA 2R24A 3UR8A 4LAKA 1J0KA 4LB3A 2OODA 4UZSA 3UZZA 4HIBA 7A3HA 2X0HA 4YTQA 4C6MA 4ACYA 3MUIA 2V2DA 3SM0A 1LQAA 3F4CA 3NVDA 4CCDA 4J3UA 4ADTA 4FF7A 2YBUA 3PTQA 2INZA 3G0UA 2JF6A 3DU0A 5I3IA 2Y8VA 3WH9A 4Y2WA 5AC7A 1NFPA 4IL0A 1Q6LA 3UVIA 3E2RA 4N9CA 4LVFA 3AXHA 3ZVHA 3EX4A 1K7XA 3N29A 3CYVA 1JFHA 2A7PA 4JS3A 4JTKA 4PMNA 1M7OA 5I0DA 3AHTA 3H2FA 4Q4OA 5CZ0A 3P62A 4GQQA 1RR2A 3SCPA 4YJ5A 1KM2A 3K2GA 1KXVA 3FV9A 2FMNA 4B92A 3T6CA 1PUDA 4MJZA 5AKQA 1TPFA 2O56A 2X1RA 5LNSA 1CGTA 2CESA 5HATA 2CLEA 3DI0A 3ZLHA 1CXHA 3QR3A 3ARRA 2GQAA 4B5XA 1RD6A 4J9JA 3THAA 4DZ5A 2FB3A 3GE7A 3VKCA 3BW4A 3RCMA 3ARXA 3RXZA 2GUUA 3CJPA 5HXMA 1XBVA 4MNLA 3BG5A 5E0CA 3QKEA 1EEXA 1ZBWA 4RE3A 1S1PA 4P8XA 4AD1A 4ZENA 3UG5A 4S23A 1QHOA 4WCJA 4XB3A 3UWYA 2O4MA 3ECQA 4H7CA 4AIBA 1E9ZB 1OQFA 4AHQA 4NRSA 3EWZA 1DEDA 3TX9A 4N9DA 3AU2A 3G1RA 3L68A 1W8SA 2PTYA 1EC7A 4KETA 3W7PA 2YL5A 2G41A 2DPEA 2HNHA 4JIHA 3ITCA 3PWAA 3EB3A 5EA9A 4DNHA 4JTGA 4ACZA 3MWAA 3ZJ6A 1QI4A 1HJQA 2Z1WA 2WHLA 1GVSA 4OU1A 2WC4A 1R46A 1OFEA 2Y61A 3MMTA 2PU0A 3TQKA 1SMAA 2UWFA 3UR5A 3MJMA 1FUYA 1UW9A 2EBNA 3SUVA 5C2GA 2A3EA 4PMOA 1NIUA 2EF9A 1XIBA 3WLKX 2RKXA 3VIIA 2BNJA 2FQIA 4I9TA 4ZB0A 3ALGA 3N3TA 2WSRA 3U0HA 2YFOA 4AW7A 2ISSA 1UH2A 3UCCA 1XJBA 3SB0A 2PDWA 3SIZA 4M24A 2GUBA 1E3ZA 2WZHA 3BDKA 1PZ0A 3EXSA 4LUTB 1OGGA 2PDPA 3PVFA 2JE8A 3DHPA 4KFOA 1Y8BA 3C56A 1D7KA 4JTQA 4M6QA 4LUTA 3I3BA 3W53A 2FHCA 3TJLA 3VIKA 3GR4A 4TX6A 1ICPA 2WMKA 2GGIA 4QFUA 2PDUA 2OOGA 4EPKA 5HQLA 3QFEA 2DDXA 5HJYA 2XN0A 4IH3A 4WRHA 1X6UA 3UJRA 3IIZA 4IMDA 3E5PA 4OFCA 2FLIA 2FHFA 4H9VA 1L2UA 4B5VA 5CJMA 4X9SA 2V63A 4F40A 1GEQA 4GO9A 5AHNA 3TIMA 4HTBA 4A4AA 5TBOA 4D72A 4YCOA 1SFLA 5HPCA 3PM6A 1CWYA 2A4AA 3L2IA 3CV2A 3HG5A 1V93A 9CGTA 4GINA 3O6YX 4G6CA 1ITCA 8XIAA 2QDGA 3MPGA 3NGJA 4IPPA 4NG3A 2XUCA 3K8KA 2PDBA 2A3LA 1HKMA 2DVTA 2R1LA 3UZXA 3B0VC 5JH2A 1F4HA 3KVJA 3UNTA 4RUBA 2YKKA 4Q4MA 3TR9A 3H54A 4TXEA 3LS9A 4TVDA 3STGA 3OW1A 1DQWA 4C1NA 1AQFA 4TV6A 4XQ6A 1FHLA 2Z6IA 3KTSA 1WZKA 5BXRA 2X41A 4CEUC 1TPC1 3NL6A 3DESA 3AISA 3PPCA 1YPFA 7ENLA 4UQ9A 4H6RA 3W84A 4PTMA 1TRDA 2QPSA 2CHRA 1QBAA 1VLIA 2DQWA 2VC7A 5CZTA 1UKQA 3DIPA 3TJIA 4GZEA 5DT5A 3W87A 4R34A 4Z2HA 4C60A 2XH2A 2Q8ZA 4BI5A 2VCBA 4Q4RA 4O1EA 3L12A 1W9PA 2HVOA 4S2CA 4JIIX 3H2OA 4IUGA 1MQQA 2NXHA 1A5OC 5DY2A 3H2EA 3S6OA 3FJ4A 4QIUA 3AMLA 2VEMA 1XV8A 2TPSA 4ZR8A 3GG8A 4LUYA 1XLGA 4E3TA 4QE5A 2PWHA 1UBSA 4PMVA 3G18A 3UP8A 1FWJC 3C2RA 3NDOA 4GO8A 4YXGA 1M9HA 4Z2LA 1X96A 2WAGA 3LYEA 3NPUA 4W5UA 1JCNA 4XUYA 4LYRA 3W2JA 2QUUA 3W2LA 3W2NA 2V68A 4AB4A 1TV5A 3P2VA 3NG3A 3KCJA 3S5YA 4EVZA 3B9AA 3UJ2A 4QSFA 4NAEA 3HQNA 1E0XA 4TOQA 3KCOA 3BAIA 4DM1A 1OC6A 1GORA 1GPFA 3L21A 4K7YA 3Q2DA 5FF2A 1FH9A 4WKFA 3MT1A 2JF7A 2OCZA 3E0VA 3WQGA 1SGJA 2WMFA 3KEHA 3EX6A 4HYWA 2C19A 2OX4A 2QCHA 1OVDA 1UP2A 3MMDA 4BK9A 2NLYA 1QRQA 5D02A 3RMEA 3O6DA 3VNYA 2E25A 2FFCA 4O52A 1JZ7A 1J6PA 1VEMA 1DVJA 4D8ZA 3GNDA 4BF5A 3IIXA 4C7DA 4Q8VA 3B9DA 1A4MA 3TSMA 2XISA 2PLKA 3WQWA 3FSUA 1G94A 1QHPA 2W6RA 4I7WA 3OPSA 4NVTA 1U2YA 2Y7DA 4V1YA 1E6XM 3PZMA 4D8LA 2P8CA 2BOFX 2OFJA 3DG6A 3INPA 4O54A 4NZFA 5A2BA 2QPXA 1MRAA 1FWGC 4UTHA 3OTRA 2DT3A 1OX6A 3M0VA 1J18A 2XM2A 1ISWA 4EF9A 4QISA 4W8BA 4M1RA 1Z89A 1UWSA 3MP4A 3OZYA 4HTYA 1S5VA 3KBMA 2YA0A 3CTLA 3EWYA 2WK2A 3VYLA 4GNJA 1OWQA 4C1LA 2X2GA 4C6KA 1XYFA 5HBFA 1RA5A 1UQYA 3GXFA 1MW1A 4IOTA 1SSGA 5BOFA 1DJXA 2AKMA 3E74A 1MSSA 5IBXC 3IS4A 1A3HA 3DOPA 7REQA 2E40A 1PHQA 4D6GA 4WF7A 5LNRA 2QUNA 3EOSA 4K37A 2L5HA 3GG0A 2ALRA 4MOZA 3HPAA 7REQB 4IMFA 1XDJA 1GUVA 1XRTA 2C91A 1VH7A 4PR4A 5JBDA 1TIMA 4XZWA 1SQ7A 1YDVA 5A6KA 1R7AA 4GQGA 1B5TA 3QRHA 2RDXA 4M1BA 1SR9A 2WMJA 3ZWSA 3EWXA 4IM4A 1JPDX 3Q4DA 5M17A 1MWOA 2CXEA 3NQVA 1TTJA 4LF1A 1H09A 3E38A 1GHSA 3VGFA 1DWGM 5I3JA 1WKFA 4AAJA 1E0WA 5B80A 3UGRA 4HOXA 4X3ZA 3WQPA 1KLYA 3OVRA 4I9MA 3AXIA 4HN8A 4W8LA 4UTIA 2P50A 4C6FA 5I3GA 4XX6A 1K8ZA 2V0TA 3NQ7A 1KM5A 5CKSA 3S2JA 1KV5A 4MUPA 1RK6A 1AW2A 4ILSA 1W0MA 3LCLA 1YXCA 3CGTA 1LWHA 1B31A 1VRXA 2WZIA 1GTEA 3N2MA 3IWPA 3L23A 4LC6A 1TVNA 4LUJA 3R8HA 4WJEA 3V1PA 1JPHA 3VABA 5LGXA 1K03A 1BF6A 4U4MA 4DWDA 4PB5A 4IG2B 2CHOA 2J7GA 5U4NA 4JAWA 3FN9A 3CV6A 2HROA 4MJ2A 5I23A 1PHWA 4PRWA 3N2TA 4MKVA 2CLMA 4F9JA 1EDQA 1B3OA 3O05A 3CYJA 3GUWA 1BVZA 5BZAA 3K4DA 5JQ9A 4DY1A 1IWAA 3L5MA 1M1BA 3TV8A 2DH3A 3R0DA 1B9ZA 1ODZA 4TU1A 3GC5A 4LUIA 3IGXA 2Z2BA 3AMKA 1FVPA 3K4WA 1XISA 3GVRA 4O4WA 2FGLA 1EHAA 4H2HA 2XSAA 1O5KA 4XSLA 2WSPA 1DV7A 3QPZA 2C0HA 5HMDA 2RH9A 3CASA 3UWUA 3IVTA 1MO0A 4ML4A 4GG9A 3VDGA 3ZSSA 1V08A 4BHYA 1SFJA 3AHVA 2J4GA 1UH4A 4DUVA 3FVMA 3U4AA 1F9CA 3CAVA 3BCJA 1D8WA 2EPMX 3UZWA 1TKKA 3IIOA 4INFA 4NRRA 2G3MA 2VO5A 1YEYA 3GR8A 3NQFA 4P2VA 4L1WA 4ZO7A 2G0WA 1LLOA 3W24A 4RNJA 1GZ1A 1TV7A 4PTDA 5KMYA 3K1DA 2CLPA 4WKAA 2PDFA 4IL2A 5LA2A 4M3PA 4GI8A 2ONEA 3C2FA 2X8RA 4PUUA 4EF8A 1J5SA 4WD0A 4JYDA 1Q3NA 4B4FA 1DWHM 3S2CA 4UR7A 4RR4A 1GKRA 3RPTA 3WNPA 3QLDA 3FLUA 2WSQA 3OYXA 2OYMA 3GIPA 3WQ8A 2J8TA 3DBNA 1UZDA 4NXKA 4C6DA 2OZ8A 2Z7GA 4GY1A 4H8VA 1KFEA 2ZUUA 3QN3A 4D9PA 3AI0A 1E4NA 4TVCA 3W27A 5C2XA 5IHSA 3KRSA 1K8XA 4DLMA 1UP0A 1KKRA 5CPOA 1ODUA 3BC9A 3AIBA 3WH7A 3QGKC 1AZ2A 1ZGDA 1DWIM 4R3UA 3VKJA 4XZNX 4L9YA 5SWUA 3ARSA 5C54A 1ITQA 4F4RA 3NNTA 3PJWA 4Q8WA 1NQ6A 3LG3A 3UA4A 4OBTA 4DI9A 3JUGA 5GJNA 1UR1A 5K9XA 1MZRA 4O11A 3UF9A 5T26A 5LNUA 1UWQA 3IRDA 5CC5A 1PS9A 2PGRA 1W1TA 4ZQPA 5D4YA 2CKRA 1L6YA 4LQ1A 4PMUA 1VFOA 4YVVA 3B9NA 2CLHA 2NUYA 3IIVA 1V3KA 1ITXA 4UCFA 3D46A 3I7QA 2EEXA 1EJXC 1KCXA 3EB4A 5EKYA 3W23A 1DORA 1XSJA 2J9ZA 1K70A 4DEFA 3W81A 3W00A 5G4EA 1C9DA 3CQJA 3MHGA 4MJ4A 1R0MA 3AIWA 5GJPA 1ZJHA 4I9AA 5T9CE 3OEXA 1O12A 2PCEA 5G1MA 1M41A 1XDMA 4JTJA 2EXOA 3BOLA 2I5IA 3OLGA 1BXNA 4PRRA 3ZT5A 5HUOA 3FOKA 1W1IE 3WLHA 4Q8UA 4JN7A 4J3VA 1A5MC 4JTCA 4CVUA 2I16A 1YQ2A 1WUFA 4J40A 1WXZA 4G8TA 2QV4A 1Q66A 3RRXA 1IXPA 2EPNA 4CQ9A 2E5CA 4JBRA 5A8PA 2X42A 4E8GA 2VURA 4A6GA 2HV5A 3LTPA 2DVXA 1XLMA 2PGEA 5CXPA 3N15A 3DKLA 3O6CA 3N11A 3AS2A 3PPHA 4HNTA 4QQ3A 1UWIA 1W6TA 1J0ZA 4ATLA 1PVNA 3QW4B 2J7DA 1MUCA 4I7UA 3ALFA 2A3AA 3BAKA 1YRRA 3UYCA 2R91A 2ZZ7A 4LANA 1TPH1 1NEYA 4LCRA 3HV8A 3RO6A 3S8HA 2B7NA 1D3CA 5GNYA 3EEZA 3W1PA 1UJQA 5IDIA 5FIPA 2DUZA 2V5LA 3N4EA 4RXFA 3E5BA 3A4JA 1X1NA 1JDFA 1H60A 3LBCA 4N9BA 3EOLA 4PUMA 3HN3A 3SCSA 1Q45A 4MAVA 3C0QA 3ITTA 1MUMA 4PTVA 4FEZA 3WDIA 5D32A 4R9OA 3N9SA 2GVGA 2PF8A 3GFYA 2BS9A 2A3CA 1U22A 5BROA 2EG7A 3C3NA 4C65A 2P5NA 1KLZA 1Q6DA 1BQCA 2HRWA 2CHNA 3SGGA 5AHIA 2ZZ4A 3FA3A 3GH4A 4L7ZA 3W2KA 3W86A 3UZJA 1NOUA 1J12A 3E96A 3KWXA 1PTDA 3FHAA 4DJEC 1KB3A 5DXYA 4ERGA 2DORA 1RBOB 3ZQ9A 4F0SA 1A5UA 1ECQA 4QHRA 4C6PA 4HN4A 3RHGA 4B5NA 4FSAA 4HB7A 4CEXC 2IQDA 2V3GA 2C7FA 3ATZA 5F2GA 3NIYA 3BICA 3GY1A 3MV11 1JYXA 4GQRA 1XYAA 3GC2A 3GR7A 2YPIA 4PBFA 3FXYA 3D47A 5D8WA 4I5XA 2GJNA 5HDRA 5AVNA 3ZVHB 5GVJA 8TIMA 2FZMA 3MUY1 3WEOA 3GNRA 4XAPA 1IEQA 4JTAA 3TH6A 1F5ZA 1FWNA 1IIHA 3UT0A 4AY1A 2PAJA 3SGZA 3UNDA 4LRSA 4JY8A 5BXSA 1K9TA 5CCZA 4JEJA 1KBIA 3FIGA 2ZUSA 4JYEA 1ZHAA 3ISIX 5AY7A 4FLSA 1XYBA 4POCA 5I02A 2ZDRA 1F3WA 3WKZA 1TA3B 2VFEA 5G1YA 3N3MA 4QDPA 3W38A 4JQ4A 5XIAA 2F61A 3IIPA 2Z1VA 3S1VA 1TA3A 1F07A 4PB4A 4Z17A 2GSEA 4UTUA 1ZUAX 1ME9A 1TZZA 3W7HA 1DIKA 3PBYA 3EBVA 3Q45A 2ABAA 3WELA 8RUCA 3ES7A 1VQTA 4B5UA 1MMFA 1ZJIA 3G2GA 1IXQA 3KBWA 5LIKX 1S2TA 2Z1SA 2GSJA 1JAEA 1DYSA 1CB7B 4JTTA 4ZB2A 4KRTA 2X0YA 3MZ2A 2WVTA 3W28A 1EA0A 3GB6A 2ZX8A 4AMCA 2E67A 1X38A 3F5KA 1T0OA 3LXCA 1XIIA 4JX5A 3WUEA 4CU6A 5I09A 2VZVA 3G24A 3G1AA 4QX4A 1MW0A 3AZRA 5EGRA 2XGIA 2XSBA 2NX1A 4L6DA 1J79A 4Q4KA 3QV7A 1TWIA 1ZALA 3EEGA 3C2OA 3L66A 3R5EA 3W1MA 3GS6A 3S5ZA 4PUJA 2EJ1A 1OD0A 3WN6A 1AL7A 3G5EA 4FX7A 1DKWA 3G1HA 3C4UA 1R8LA 1H50A 3ZT7A 4DXVA 3KVMA 3WFZA 1G67A 3SRHA 4A22A 1I2QA 1E6NA 1V02A 5EFFA 1KC7A 1S3TC 2QAFA 2V69A 5TNVA 4V33A 4HKPA 3LLDA 3M0IA 1MUWA 1K7FA 1LQ0A 2W62A 1ZP4A 1E1EA 3WD4A 4UNKA 2GJLA 1E6QM 1GK8A 3M5XA 2FZBA 3W6MA 4KH2A 3WJYA 4B4HA 2A21A 4HPGA 1JCLA 4UQBA 4QR6A 1CI1A 8A3HA 1Q6OA 3P5ZA 2FTPA 1QUMA 1JIBA 3GSMA 4KKXA 3CHDA 3OYZA 3F2BA 4A8NA 3RYSA 1OFBA 4AFYA 2KX9A 3NAVA 5EL1A 1XBZA 2B81A 3AO0A 4KCWA 2J6VA 3LPPA 4ZSUA 3UYIA 1OFAA 3JR2A 3GG7A 2IKGA 2V2CA 4AZGA 4MY1A 3QHOA 5AVHA 1DIDA 5CGTA 2YZ5A 4OQVA 3V0UA 1GOQA 2Z29A 3QY6A 4GYPC 3WF0A 3LRMA 3ZJ8A 3XIMA 3KBJA 4DWSC 3M46A 3VGDA 3M5YA 1OCBA 5IM51 4O1FA 2VZSA 4RZBA 1BEUA 3LCHA 4GUHA 1XLKA 3PN8A 4GOAA 4J2MA 2ZRXA 2OZ0A 5C7HA 3RG6A 4Q8TA 4C1NB 4PUEA 1J6OA 4D6DA 1THFD 4IJBA 4ZXLA 4H7ZA 3T09A 4UR9A 4JX4A 3APGA 2BZNA 3Q58A 2GOKA 4HSNA 4BQ4A 4KERA 1YXDA 3PB2A 3TU9A 2R6OA 4MLJA 2O0TA 2OWCA 5BW6A 1FWTA 1TVPA 2ISFA 1CDGA 4WZHA 1MQPA 4GRSA 3AXMA 1LOLA 4D6FA 4NY2A 4CQ8A 4FZIA 4L56A 3VGHA 4J3ZA 3BLEA 2JFEX 4KWUA 1G7VA 1QDSA 2Z2UA 4L5ZA 1IYXA 4AY7A 3WD3A 3CQ0A 2DIKA 2QMKA 1HXJA 3LGDA 3GAYA 2QYGA 4E4PA 4ML9A 4JIEA 3WJWA 2INFA 3CT7A 1UA3A 2E3ZA 3WH8A 3UJEA 3LDVA 3LI0A 1I60A 1ZL1A 4V15A 3STPA 1M65A 4HHMA 3FY1A 5CC3A 1TX0A 2PLCA 4QG9A 5D09A 3RX2A 2CEQA 5AB3A 4Q33A 1H3GA 3TROA 4U10A 1IZJA 2OELA 1Z32X 1P0KA 1W2PA 4A3YA 3MMWA 3VGEA 3B9OA 1YXYA 5CZKA 3U9IA 3I3EA 1ZAHA 3VKDA 1OFPA 1ENUA 1RPKA 1JRCA 4KGJA 3CWOX 2VHLA 5BCAA 4QLLA 2CBJA 2JBMA 4DELA 3MKCA 4JTSA 2B4GA 4ERAA 4L61A 4E2OA 1EL3A 4E3VA 1VGAA 3U48A 2BV9A 1OZQA 3BLIA 3BQ5A 3DFSA 3IGSA 3SY8A 3WLMA 4LS2A 1DQXA 1DHPA 4OUEA 4QNEA 4PL1A 2ICSA 1LJYA 3U6WA 3E2QA 1V02E 5AYBA 1Y5WA 4Q7IA 1G4SA 1V3MA 8XIMA 4MPQA 1RJPA 4F3HA 2V3EA 2XVPA 1HKJA 5BYWA 3IUIA 3THCA 2TAAA 1EWEA 4J3WA 2R1NA 2E8YA 4PFHA 2DJLA 3VKAA 2VENA 4IJRA 3VVGA 3H53A 3CMJA 1FWBC 4F79A 1LLWA 1UKPA 3KUMA 1S46A 1EQPA 4LWWA 1WBJA 1BSIA 2OEJA 1HO1A 3KLLA 4LV4A 3AYSA 1Q6GA 3CXOA 1LT7A 2FJUB 1ONXA 4QRNA 3SCNA 1V5XA 4D6EA 2J6XA 3GHRA 4JKLA 2E1DA 1H41A 1UKTA 1ONEA 3PBUA 2D0HA 1QU4A 1H7XA 4GUFA 1XLJA 1SJDA 3BOFA 3P61A 3QZEA 4IHCA 3CNYA 1OT2A 1UOKA 1FKWA 3TWBA 1N8IA 2QGYA 4KQNA 4UTFA 2I17A 3P84A 4GNKB 4ZFMA 1J9YA 3HG3A 1V6WA 2ATMA 1SJAA 1NWTA 2CYGA 5I3FA 1TMLA 2XGBA 2WVUA 3EWWA 4ASTA 3VIGA 1BF2A 2TRSA 4CLMA 1J0HA 2NQZA 6CGTA 3CO8A 2PU1A 3RM4A 2AQOA 3IAQA 1M01A 4J2PA 3AHZA 1QPRA 3UCDA 4FNQA 1A47A 4OTKA 4N4PA 3CZGA 4JD4A 3R0UA 1H0GA 5F1VA 4X2RA 3TCEA 3WD2A 4E0CA 3MCNA 4W84A 1AMKA 1J0JA 2GFTA 2YYTA 4O18A 4GXMA 5FA5A 4AIEA 1W1VA 4GH1A 1EJRC 3O7UA 4AY8A 2Y7FA 4DO5A 2E28A 3T7VA 5GPRA 5T9BG 3SY5A 3WF2A 3OB8A 3L4TA 3RAOA 4FX6M 4YWSA 1WKDA 5E0FA 3W1QA 3EWDA 1MDLA 2VGGA 5FAGA 1MFUA 2AKZA 3ZVIA 2P10A 2G37A 3CPGA 5KETA 4G1NA 3ARWA 1TUFA 1QNOA 4EIVA 1DL3A 1XIFA 1RBAA 4W85A 1L0PA 1VIZA 1X1ZA 4ICCX 1SM9A 4NT0A 1OY0A 3DYOA 7XIMA 2PEVA 3U2ZA 3WJSA 3CLMA 4AVNA 1S2AA 3FKRA 3GWQA 5I5RA 3EA1A 3VZZA 4NNBA 3TZFA 2PF0A 2WNWA 3QY8A 4KPLA 1W31A 3P60A 1FWIC 2X2YA 2R1MA 3VNKA 3ZXWA 3WLIA 1QJWA 4K8EA 5FOOA 1A5BA 1Q6EA 1W8GA 1MW2A 1XIDA 1OYCA 1GCYA 1P0BA 1H1ZA 4NZ1A 2AGTA 5M5DA 1JG9A 4KW2A 2PLJA 1XLAA 2FYMA 4REQB 3VOJA 1XIHA 1JF5A 3TUUA 4NILA 3A5VA 3EDJA 3BLFA 3UXAA 2BXVA 3M07A 3P0WA 2DSZA 4JCMA 3HF3A 4XKMA 1GQKA 4YYCA 1W9DM 1VD6A 4ZE4A 1E0VA 1PYMA 1AQHA 3E1F1 5F4XA 1ZCCA 5EBUA 1O7AA 3K13A 3KBVA 3CZKA 3CWNA 2P3EA 2VC5A 4WDWA 4LYQA 2PMQA 2QJIA 3NA8A 3LENA 3NGFA 4HCDA 3EGJA 4Y6GA 3DFHA 4O0ZA 5GNXA 1G4TA 4GIYA 4GZ7A 4QAWA 3RCYA 3P5YA 1OIMA 1GVRA 2YDSA 3S5NA 4MPKA 4MNJA 1F74A 1CCWB 1KFJA 1PO9A 4I5RA 2WWCA 3D0CA 4UOZA 3TMLA 2HWGA 3BGGA 3VD5A 3HTWA 4UTJA 2I5GA 2PC4A 4MZ8A 5AECA 1RCQA 3BO9A 2QAPA 4UTWC 2XWDA 3ARYA 4X61A 3CAQA 4XTDA 3KFTA 3B8SA 1OD8A 2EKCA 1FDZA 1ZTVA 4F0LA 3HPFA 3Q65A 3ZR6A 5DMYA 3GDRA 4GYJA 1V03A 3SECA 3C52A 3GHTA 3LZ3A 4FI4A 2UZ9A 2DSVA 3QYQA 2PDJA 5C55A 3GDLA 4AEOA 2O9TA 1BGGA 3FA5A 1LCOA 5HQMA 1JCYA 3O63A 1F6KA 3V75A 3UY8A 2DZWA 5A2AA 3VZYA 5G2WA 1TWWA 1FHDA 2JALA 3L4YA 4KS0A 4UTMA 3LRKA 5FJRA 4GHRA 1EJ7L 2RHGA 3L4XA 2O92A 1OYBA 3M0YA 4PMQA 1A5AA 1GKPA 2BGQA 2J78A 1BVNP 3P93A 1JXKA 3SW6A 2G3IA 2NV1A 1FFQA 1XICA 3G1FA 3JW7A 1Q6QA 4GJ1A 1JZ3A 2WHJA 4GXPA 2WMHA 3KL3A 3GTNA 5K4XA 1IE7C 3QBUA 2WANA 3GBEA 1TV8A 3V0TA 3PTDA 4DWSD 4IP4A 1CB2A 1S2WA 3NQAA 1X39A 2R8WA 4JTLA 1V8EA 3PZOA 4GYFA 4BWLA 2ZE0A 1OGSA 1QPQA 2VD8A 1HTIA 1LL6A 1Z42A 1KFKA 3RR4A 3TC3A 3WH5A 1V6TA 3GNOA 4PMJA 3F03K 1KBBA 4OV9A 3AIUA 1CZ1A 4MVAA 5FJPA 2E9MA 4OV4A 4WUIA 5ABGA 1WB0A 3S2LA 2R1KA 3M47A 4NJGA 3CUJA 4YLWA 4F9DA 5LIYX 2W5FA 5KEZA 1W32A 3TK7A 2H8ZA 1W1PA 1OX5A 1EBGA 4BZYA 1P1MA 2PP3A 1SZEA 1SU5A 1WQ5A 4MIMA 2ISDA 1NOWA 3W70A 2Z00A 4IGMA 4YHGA 1R2TA 3E9AA 1XUZA 1FDYA 3SRFA 2V5DA 3TC7A 3TYCA 2WKLA 2PI6A 1I6NA 4KCTA 1GNXA 2PS2A 1QAPA 3AICA 1L6GA 2D2GA 2VVSA 3UW6A 4XK2A 3I3DA 3TN6A 1H4PA 2PE4A 4AZBA 2E9BA 2P0IA 1QO2A 3BV7A 1DJGA 2V3DA 3L67A 4O0KA 1LBLA 1UD2A 2PCQA 3PUDA 5IDZA 3WMCA 1QK2A 1HG3A 3VK5A 1E6ZA 2PDQA 4XKYB 1EJUC 3VOGA 3IRSA 3TJXA 2Z1XA 1QFEA 1XLBA 1DTUA 2PP1A 3NM1A 1WV2A 4MKNA 4IPJA 3MVIA 3SRDA 3N6JA 3S9IA 4L4OA 1UR8A 1A5LC 1A5SA 2CWNA 3CM4A 4CUCA 4RZ6A 4CNSA 2GJXB 4JQAA 2OU4A 3VKKA 4XAGA 1W9UA 2PTZA 3ZO9A 3VINA 3S83A 1Y65A 1H0IA 1F3EA 2ZZ3A 1T5AA 4C6NA 2DZBA 1H1YA 4EX4A 4NAEB 4CCCA 5BOOA 1AH0A 2FH8A 4CQBA 4RPQA 3BAYA 3WSUA 3CH9A 3W76A 4WSJA 3W1LA 2VWSA 3MC5A 1XD1A 5KITA 1VYPX 1XLHA 4RZ5A 4N02A 5CJNA 3LGEA 1BHGA 4AWUA 1XFCA 3R94A 4J7RA 2VDGA 4GCXA 1PZ3A 4ZB5A 2OQHA 3QMRA 4ZQCA 4KEUA 3L4WA 3WIJA 2G3FA 3R10A 3CK5A 5I06A 1W91A 2NUXA 2WHMA 1EJTC 3RMJA 3DKJA 2ZUNA 2A3BA 3ONBA 1AFSA 3DAQA 4C5YA 2QW5A 3UWZA 2WJEA 3CUXA 3SUWA 3MV01 4HJFA 3G1YA 2DJXA 1GKQA 2D2JA 1GVQA 3DENA 4KFNA 1JZ5A 2D0FA 1BTCA 3TYEA 3ZS4A 3R43A 2Y88A 5HMFA 1XM3A 3EOOA 3B0YA 3DG7A 4PEEA 5E9AA 1R5YA 2REQA 3J7HA 2YR1A 2CPUA 5E6ZA 2DUXA 1O5XA 4KRZA 4ZOAA 1MZHA 4H8NA 3LBMA 1GYMA 4JFUA 3L4UA 2REQB 3F4NA 3URQA 3P80A 3L7RA 4JDYA 3L4VA 8CGTA 3QY7A 1I9CB 4I9JA 4ES4A 1X97A 4XZMX 1BVWA 3HGOA 2ZZ1A 7CGTA 3FAWA 3GW0A 2CLKA 4LEQA 2UV8G 4JYFA 4HCLA 3TMQA 3W71A 3FA4A 4XO6A 1MXSA 1RCXB 4HMEA 5FD0A 3KOZA 4C1KA 4AC7C 2W27A 1O95A 5D03A 1A5CA 1XLFA 5CH9A 3CUHA 3KHDA 3MYPA 4B16A 1S1RA 1W5QA 2WNZA 4R33A 3T42A 2V6AA 3GW3A 1AZ1A 3TN5A 3CAKA 5DMLA 2IW0A 1XRVA 4NYUA 4YIWA 3QPYA 5I3KA 3QW3A 1HKIA 3ABOA 4C7GA 2D3LA 3MTWA 2EJAA 3BXWA 3AS0A 3VGGA 3K30A 2FTYA 3PG8A 1KM6A 4ZTYA 4Z2GA 3QVQA 1JPMA 3BLDA 1ISVA 3WDQA 3EDFA 4X22A 1GW9A 3NZ1A 3URBA 1EKOA 2HDJA 5A8OA 4RE4A 1AD4A 1OADA 1XYZA 4KEMA 4FHAA 4MWAB 5ABTA 4GIRA 3L0NA 5CPMA 2E6AA 2F6KA 4KWVA 4D6CA 2DQXA 3SGUA 4NX5A 1UZHA 2GDQA 3LLXA 4S1FA 2XH0A 3VIMA 1P4CA 2AMXA 3QHNA 4JXCA 1PX3A 1KM1A 4F0KA 4EE9A 1GWJA 2IPWA 3NEVA 2VC6A 4G5DA 1WDPA 5I78A 4UFLA 1T40A 4UZUA 3PAJA 3A64A 4IG2A 3KL5A 1DE5A 1G9HA 2NQ5A 4GX9A 3EWCA 2V2HA 3PPGA 5TIMA 5FF3A 3H7RA 3GTHA 3DH7A 1W1A1 3OVPA 1HGYA 5KSWA 3WG6A 4KCVA 3I65A 2PWVA 1VR6A 3CZ8A 5D8ZA 4LNYA 1HNYA 4GYKA 1DQUA 3IGHX 2IKJA 3POHA 5DXXA 3IJ9A 3F5JA 4PYSA 3LHWA 1W5PA 3W7OA 3WL0A 1RBLA 4DX3A 4YL2A 2OT0A 3HGJA 4XSMA 5DCDA 1EF3A 2WHKA 3TKFA 1JUKA 2XM1A 2OGJA 2BHUA 1AL8A 3EZ4A 1ZAIA 2BASA 3OP2A 3EDKA 4M19A 3CHFA 3I6EA 3UXDA 2HMCA 5DANA 2G4JA 3NZPA 5C9UA 1WXYA 3A9BA 1YADA 1W56A 5H6HA 2P8BA 2XU2A 5LZLA 1DWJM 4O8RA 4UTWA 3OQEA 2NVDA 4C91A 2GK1B 2ZRZA 1W3KA 1EYEA 1QNQA 2WNQA 3TTEA 3STFA 2ATSA 1G1YA 2J77A 4NXSA 3H2CA 4JTEA 3KCLA 3R89A 3UJFA 1I2PA 1W5NA 4H1ZA 4GY7A 4ERIA 4PRTA 1Z9AA 1UC4A 4Y96A 2DUAA 3W2MA 3C86A 4F2BA 1JVNA 1LRNA 4FNPA 4I8DA 3TFCA 2ZADA 4IWWA 2NWSA 1HP4A 2V38A 5IRPA 4HA4A 3QFWA 4C6OA 4R7OA 1VFFA 1PZ2A 3W2UA 4U31A 1TCMA 4XZIA 2YBTA 4LV9A 4KFPA 4B2DD 5EBAA 3RRAA 5F7UA 2F6UA 5BRPA 1C8QA 5MHBA 4LX4A 1TPWA 3IANA 2OYLA 1VAHA 2GVJA 4P8VA 1FCVA 1K8CA 3W0KA 1KM4A 4I7VA 2VEIA 2ZWZA 1SJBA 4JTFA 2B7OA 4HU3A 4K8GA 3ICJA 3NQEA 1IXNA 2HPMA 3URNA 1LT8A 4AZIA 5DN1A 2FVLA 3FDKA 5FSDC 4DUXA 3AIRA 1W2VA 3W83A 4QCEA 3FYYA 5HQEA 4HP5A 4I6KA 3MVTA 2IMRA 1EXBA 2FPYA 4YS1A 2DY3A 4Q4QA 3PZNA 2AAMA 4IX2A 4GXWA 3F2CA 5AN7A 1N55A 2NUWA 2VP8A 4FXFA 1UWTA 4UQEA 3TONA 3V18A 4RDYA 1OINA 3WUGA 4XVEA 4B5WA 2EG6A 2A6NA 4H8HA 4LVGA 3S4TA 2ABBA 3WQCA 3JZUA 1V6VA 4HJWA 2QJJA 3XISA 4Q3MA 3S1UA 3LNPA 1PKMA 2WSKA 1B4KA 1MEWA 3U57A 3QJAA 3WBEA 1FCUA 3RNDA 2DEPA 4P8UA 1OG0A 1GZGA 2GWGA 3V5CA 2VCCA 3VUPA 4RNFA 5JUVA 2NVCA 4A2SA 3WNMA 1J0IA 4XIAA 1KW1A 3GUGA 4LALA 1H49A 1N2VA 3ID7A 5H8UA 3W29A 4RL3A 1QXLA 3KAOA 3WDRA 5B7ZA 2HJPA 2YX0A 1UH3A 3LCXA 1VHNA 1XYMA 1SSDA 1BKSA 1TCDA 2ZYFA 1YIXA 2OOFA 3FJNA 4BEUA 4HZMA 4M56A 2PA6A 1RSCA 2PWGA 4OVXA 5AYIA 2C6QA 3QR0A 5FACA 3WMBA 4AD0A 2X30A 5D2TA 1H7RA 2FTWA 1FFRA 3U5UA 3GKFA 4NZJA 1HO4A 1YKWA 5AYZA 3OJGA 3UPMA 4J3SA 2VRQA 3N34A 1GOXA 4QLJA 1S2CA 2DP3A 5I7GA 2OMAA 1KR1A 1M03A 1JNDA 3D6NA 4ZQOA 1YHTA 4IQEA 2GQ3A 1PDYA 2WM1A 2ADAA 3VNJA 2F9RA 1E5NA 3NPXA 3GH7A 1VBJA 2YXOA 3GK0A 5D05A 5HJXA 1DJWA 4M6UA 1FH8A 3VAVA 4FOJA 1XH2A 1E56A 1G01A 1W3JA 4P61A 3WQ5A 4DZHA 4Y90A 3GG1A 1AODA 3WLRA 2CZVA 3WQ4A 1W1B1 5CBBA 4LCSA 3UXKA 2F7FA 2LLEA 4JTHA 1HFBA 2ZTJA 5G4HC 3S2NA 1B57A 4BS0A 2Q01A 2AAAA 1Q6RA 1YTKA 4J3TA 5G4WA 3NEHA 1PPIA 1UWUA 3VE9A 2BY1A 2WWDA 5HPOA 3LN3A 1BXCA 3SUTA 1OK4A 4IIFA 1CXKA 1KBLA 5HMSA 4CU8A 1RP8A 2GLKA 2C0AA 2PODA 1K3UA 4XKYA 1TG7A 2Q6ZA 2YYUA 4H6QA 3MI3A 3A3WA 1QMLA 3MMUA 4FR1A 5DT7A 2BY2A 3WNOA 2XIOA 3A3XA 4LVDA 3MO7A 4JTIA 5JIPA 2XH4A 4PB3A 3TOPA 4AD3A 1GQNA 4ZBCA 3WF3A 4IIHA 3W01A 3PNUA 5E70A 4IGNA 3W7DA 3TQVA 2PRLA 3QMTA 2PFHA 3UXIA 2BDQA 3MI2A 3FEMA 1VBGA 5CC7A 4MNMA 2HBVA 5H1WA 4C6QA 1IEWA 3MY9A 3UD6A 4MWAD 2EAWA 1F76A 5D9OA 3ZM8A 4GZIA 3SEPA 2WZMA 4US6A 3H4WA 3DHUA 4O17A 4F0HA 1FP9A 1UPPA 4HZ6A 3EA3A 2FZ9A 4DN1A 3NPVA 4DYKA 2ZIDA 1F61A 4RX0A 1D7FA 1PTAA 1G7UA 3GYEA 5DMNA 1B0IA 1E1FA 2J74A 1ZY9A 3WK3A 1KCKA 2YW3A 5I03A 4LY4A 4FAMA 4LY8A 4RPPA 5BNKA 2P1FA 4LFYA 3KVLA 4UFJA 3UWVA 4F8XA 3GNNA 2WKJA 2PDGA 4FLOA 1L6SA 4JR5A 4E4UA 4RLIA 2ZE3A 5A3HA 1K1DA 1ESWA 1XQLA 5AHEA 3N4AA 4N7QA 4PFMA 4X2PA 1PEZA 1ZBKA 3KOFA 2AQWA 2WMGA 4C90A 1TVLA 3BZGA 4OIFA 2QUVA 4F0MA 4GKLA 4GFIA 2EPLX 1TPDA 1KCLA 3VCCA 4UTTC 4IIGA 3WK2A 3MW7A 1E6SM 3CU2A 2NT0A 5FJIA 1T99A 3VDAA 1JPIA 4M5PA 3NVTA 6TAAA 1I4NA 2QCCA 4O10A 3RU8X 1UZ1A 1LL4A 3GZAA 2QIIA 3OGSA 1EFZA 3OHIA 3BLPX 3WLLA 1S2UA 4H9XA 4XTIA 3G22A 3O07A 2VFIA 2Q3OA 3OO2A 1FHVA 5TAOA 3TYAA 1L8NA 1JDDA 1CLKA 3UPWA 3FNDA 1IT7A 1M6JA 1RLDA 2QCFA 5IXEA 2BG5A 1LBMA 4WLCA 1HN1A 2C79A 4HNOA 2OQLA 1A3WA 1X7IA 4O1DA 3BLLA 1SFSA 2Q8LA 2SFPA 1M7PA 1X98A 2D22A 3PZVA 1DJHA 3LHTA 5D9MA 3REQA 4DBEA 3MZNA 4B9YA 3PZIA 1V0NA 9XIAA 3VE7A 1V7AA 1RA0A 1KQZA 3NWRA 3FKKA 4AQLA 1US3A 2ESCA 2XHYA 2WCGA 3IPWA 3AU6A 3PZ9A 1MVYA 1N8WA 3GU1A 1EPVA 4KGLA 3WFLA 4A3QA 5A6JA 4O53A 1OEPA 1VF8A 1H7OA 2YGYA 4R85A 3VIPA 4TR9A 2FVMA 1TQJA 2R94A 3UA3A 4G56A 4YN5A 2QJMA 3TQPA 1GOIA 3W07A 1LRTA 1JNEA 1EUAA 4I8YA 4ZA0A 4XBKA 3S1WA 5LKYA 1DWFM 3BTNA 5A8GA 2Y5EA 1GQJA 5F4SA 1J2BA 4Y9MA 1NDYA 4WDXA 3M9YA 4JHOA 1ONWA 4RJEA 3APYA 3WLTA 2ZUWA 3UEQA 3LM3A 4QJ5B 1O5QA 1BGAA 2Q8XA 2WQDA 3VTRA 3WDPP 3SO7A 3A4WA 3BARA 5HK4A 1LLZA 3I6TA 4F0RA 5AC8A 4GI6A 3OGRA 4PMRA 2YL6A 3BVJA 3PUEA 3R2GA 1XWYA 3PPFA 3AHXA 1ZAJA 2J66A 2E6YA 2PBOA 4L6OA 3WBXA 3DHDA 1PB0A 3U5YA 5CAKA 4C5ZA 1YDOA 2WC7A 2HVNA 4MM1A 5M2FX 3QQ1A 4HU0A 2OZ3A 1AA1B 4JGDA 4HNLA 1X1OA 2ASHA 2OR2A 3L2MA 2IQ0A 5I2UA 3FYPA 4G7EB 3W7RA 4GUGA 4YNGA 3LHUA 1V0LA 3GQYA 4G7EA 3VOHA 3COTA 3B0PA 5FL0A 3VC5A 5HR7A 4WHBA 4Z1CA 3W1RA 2RGMA 3U2OA 3EDEA 3PR2A 1JEZA 3MCMA 4DWSA 1REQB 1R2SA 2R9RA 1SO6A 5DRIA 1XDLA 4MF4A 1D9EA 3SY1A 3DN5A 2OQYA 2Z25A 4E8DA 1TV4A 2CW6A 1I0DA 3RILA 2JKEA 1TELA 4TTGA 3CIVA 1O94A 4TX9A 5EMUA 4MDOA 1R3WA 4QE1A 1CW2A 1EOMA 3P67A 3NXFA 5HWJA 3L0KA 1WO2A 2ZFAA 4W8AA 3ABRA 2W4XA 1Q6CA 1CGYA 4XBSA 1PL9A 1I2RA 2Z1KA 1IV8A 5D30A 1VEOA 4TVUA 4ZQNA 4LAOA 3PUOA 3GKAA 4E2BA 3AJXA 2GJXA 1UUMA 3G77A 2OKOA 4IGSA 2OKTA 3SQSA 3IAPA 3CL7A 5J8LA 2JGQA 2FMOA 3AWNA 3CMGA 2C14A 2HXUA 4ADUA 2PGWA 1MQRA 4HGXA 3RFAA 5CBIA 3ABQA 2ZA2A 5AC4A 3GDKA 1JYWA 1OYAA 2QPUA 3W3OA 2D24A 2D3NA 1H5VA 2IUZA 2VVNA 3RITA 5K2ZA 1HP5A 1R6WA 4AMAA 3IJ8A 1UD3A 3FVDA 3WQ6A 1GOKA 1B3YA 4ATWA 1EX1A 1VPXA 1SPQA 4WDTA 3H12A 4AHOA 2XPKA 3MUAA 1SZGA 2X7WA 1UP3A 2QXWA 2DT0A 4WK9A 3O0FA 1BYDA 2QULA 3E0FA 2WCSA 1P48A 5HNTA 3TXZA 3LGGA 2ZVRA 1L2QA 3AAMA 1SW7A 2V5BA 2C3ZA 5A8QA 1JAKA 1BSLA 4OE7A 5EYWA 3KZPA 1CEOA 2H90A 2GDUA 2GJPA 2X1UA 3SJNA 3I4EA 1FX6A 3PZQA 3B8DA 4X9YA 5LA0A 1B30A 4PEKA 3V7PA 4YMZA 4EAYA 3F4WA 3W6YA 3AZSA 2GJRA 2VT0A 3WNLA 3P82A 3A24A 3NXLA 1EEPA 3RLVA 1ZJAA 1TMHA 4CD6A 1DJQA 4E2VA 1F6PA 2XG9A 4XV0A 1FQ0A 2QJHA 1F8MA 4UMBA 4K1WA 4P7QA 3VA8A 5DF0A 4NZ4A 1HVXA 1Q2SA 3KS6A 3SN0A 3GM8A 2X0SA 1WZLA 3HURA 1EDGA 3M0JA 2XFYA 2ZA1A 3LY0A 2UBPC 1WYIA 2EPOA 3GBDA 2IQTA 4OECA 4RXGA 3LLFA 1YPXA 2BGNE 4DO6A 2OEKA 4L1XA 3GFZA 4MFDA 2QF8A 4O0QA 2CLOA 3D5HA 2PWDA 5D37A 3T08A 3M0LA 3R4IA 1TUXA 1DXEA 1UIOA 1CT5A 2RDWA 1PKLA 2G95A 4GFSA 3LM7A 4QEHA 5DQPA 5CEWA 3WLPA 4PZVA 3FCPA 1WNOA 4R27A 2CLIA 2ZZ6A 1AH3A 3PF3A 4IISA 4G2DA 4GBUA 3NFUA 1EP3A 4IMAA 3GXPA 1TJRA 3QXBA 4ZODA 1I2OA 4BEQA 1OZMA 3B9EA 2WJZA 1LBFA 4MFEA 5DMMA 3BGAA 4UWMA 3V35A 1O66A 3TLQA 3AMGA 2ZX7A 3NDYA 3KOXA 1UD6A 2MNRA 1UR3M 3MSDA 4JPGA 1WX0A 1YW1A 1HJSA 4AC1X 4MWAA 2E6DA 4R88A 3CZLA 1BD0A 3SZ8A 3TN3A 4OBSA 5LSMA 3E49A 3H2NA 3AWOA 1CGXA 5A6SA 3ITVA 4JOMA 1PTGA 4P5UA 1SVDA 4TMCA 3WLQA 3DCPA 4RKAA 3N4FA 1JDAA 4EPDC 2YCEA 3EYPA 3FW6A 1A49A 4MAZA 3M1ZA 4J35A 2E68A 4N6FA 5CSUA 4FLQA 2NQJA 2NQLA 1ZPTA 1DTNA 3AC0A 4GVGA 1DJYA 3BAWA 3CO4A 4CNUA 1FXQA 2XDFA 3OQ8A 3V5OA 2BHYA 1WOAA 3IUHA 4MLRA 3ITYA 1LDCA 1XGDA 1XPGA 1XI3A 3NO3A 3TNBA 1MEHA 3M5ZA 3W26A 3QSRA 1O4UA 2AGKA 1V0KA 1YYAA 4W7UA 3U3HA 1T8QA 2WPBA 4M80A 3UG8A 4DJFC 2W0UA 4DPQA 3PTMA 4DNMA 4N2YA 3IV3A 3LTYA 1VFMA 4LS0A 2D20A 1Q7MA 5FAJA 1I2NA 3ARUA 3T78A 3CUGA 4EXAA 3VMNA 4IFKB 1XD0A 3AOFA 3KTCA 1LG1A 1JGMA 4A3HA 1Q85A 1J01A 3T9PA 3VIFA 4QROA 5L9FA 1R47A 2ZXDA 2GK1A 1DE6A 3MJYA 4D2JA 1LROA 3H24A 2QR6A 3QZAA 5AYXA 4REQA 4DF2A 2Z4GA 1K77A 3LCGA 3BL3A 4KWSA 2QZRA 3ZJ7A 1JZ4A 4DUWA 2XFWA 3UWQA 1UHVA