3V4EA

Crystal structure of the galactoside o-acetyltransferase in complex with coa
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
188
structure length
188
Chain Sequence
MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical analysis of the putative acetyltransferase SACOL2570 from methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
molecule keywords Galactoside O-acetyltransferase
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
total genus 75
structure length 188
sequence length 188
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3v4eA00
2IU8A 4N69A 1KGQA 4KPZA 5E3QA 3R0SA 4DCLA 4ISXA 2IC7A 3CJ8A 4M99A 2W0VA 1SSTA 2V0IA 1KRVA 1HM0A 3FSYA 3VBNA 3TDTA 2OI7A 4KPXA 4N27A 1KGTA 4J09A 4M28A 1MR7A 1SSQA 3DJ4A 3FS8A 1Z90A 3MC4A 1KRUA 1XATA 4M98A 2RIJA 3OUPA 3P47A 4E1KA 1YP3A 2IU9A 4E6UA 3SPTA 3NZ2A 1TDTA 2OEGA 3R3IA 1LXAA 2GGQA 1XHDA 3EH0A 3KWCA 3TISA 3R3RA 4R36A 3R8YA 2VD4A 3HJJA 4EAAA 2WLDA 4M9CA 3FOQA 3GUEA 2JF2A 3HSQA 1HM8A 2V0LA 4AAWA 3VBKA 4MZUA 5AFUU 3JQYA 5E3PA 4FCEA 3TK8A 3GVDA 4H7OA 4E6TA 3I3AA 1T3DA 3PMOA 1OCXA 2TDTA 1KK4A 4J18A 5ADXU 1QRFA 2ICXA 3F1XA 1S80A 1J2ZA 1QRLA 3FTTA 2FKOA 4KNRA 4M2AA 2WLCA 3TIOA 3R2WA 4EA8A 2Q4JA 3Q1XA 4EA7A 3BRKX 4EQYA 3EEVA 3KWEA 3R5CA 3R1WA 3D8VA 4EABA 3FSBA 3TWDA 5F42A 3OTZA 4IHFA 4G3PA 4R7PA 1YP2A 5DEPA 3OU9A 4N6AA 2P2OA 1MR9A 3VBJA 5U2KA 3ECTA 3BSWA 3R5DA 5DEMA 1SSMA 4HCQA 3BSYA 4E79A 2QKXA 1QRGA 2V0KA 2AQ9A 4G87A 3GOSA 3BXYA 4EGGA 1V3WA 3FWWA 4EA9A 1FWYA 3IXCA 3I3XA 2QIAA 1HM9A 1THJA 4MFGA 2GGOA 4IHGA 2NPOA 2VHEA 5AFUV 3OTMA 3MQGA 2XATA 1QRMA 3DHOA 4MYOA 2V0HA 3DK5A 3SRTA 4M2BA 3FSXA 4AC3A 3VNPA 3TV0A 1QQ0A 4HZCA 3EG4A 3ST8A 3IGJA 5DG3A 5ADXV 3V4EA 1FXJA 2WLEA 4G3QA 3VBMA 1V67A 3BSSA 4R37A 2OI5A 2OEFA 3VBIA 2JF3A 2OI6A 1KK5A 4IHHA 2I5KA 4HUSA 1KK6A 4KNXA 3T57A 1KQAA 1KHRA 3BFPA 2QIVX 3R5AA 2WLFA 4HZDA 1G95A 2WLGA 3C8VA 4G3SA 4AA7A 2ICYA 3FSCA 1MRLA 5L6SA 1QREA 2W0WA 3MQHA 3D98A 3VBPA 3R5BA 3VBLA 1HV9A 4HURA 5L6VA 4E75A 1KRRA 2V0JA 4N6BA 3OW5A 1YP4A 3KWDA 4KQLA 4K6RA 5E3RA 3P1BA 1G97A 2IUAA
chains in the Genus database with same CATH superfamily
2IU8A 4N69A 1KGQA 4KPZA 5E3QA 3R0SA 4DCLA 4ISXA 3OH3A 2IC7A 3CJ8A 4M99A 2W0VA 1SSTA 2V0IA 1KRVA 1HM0A 3FSYA 3VBNA 3GQ7A 3TDTA 2OI7A 4KPXA 4N27A 1EWWA 1KGTA 4J09A 4M28A 1MR7A 3GQ8A 1SSQA 3DJ4A 3FS8A 1Z90A 3MC4A 1KRUA 1XATA 3SUCA 4M98A 2RIJA 3OUPA 3OGZA 3P47A 4E1KA 1YP3A 2IU9A 4E6UA 3SPTA 3NZ2A 1TDTA 2OEGA 3R3IA 1LXAA 2GGQA 1XHDA 3OH2A 3EH0A 3KWCA 3TISA 3R3RA 4R36A 3R8YA 2VD4A 3HJJA 4EAAA 2WLDA 4M9CA 3FOQA 3GUEA 2JF2A 3HSQA 1HM8A 2V0LA 4AAWA 3VBKA 4MZUA 5AFUU 3JQYA 5E3PA 4FCEA 3TK8A 3GVDA 4H7OA 4E6TA 1N4IA 3I3AA 1T3DA 3PMOA 1OCXA 2TDTA 1KK4A 4J18A 5ADXU 1QRFA 2ICXA 3F1XA 1S80A 1J2ZA 1QRLA 3FTTA 2FKOA 3OH4A 4KNRA 2WLCA 4M2AA 3TIOA 3R2WA 4EA8A 2Q4JA 3Q1XA 4EA7A 1L0SA 3BRKX 4EQYA 3EEVA 3KWEA 3R5CA 3R1WA 3D8VA 4EABA 3FSBA 3TWDA 5F42A 3OTZA 4IHFA 4G3PA 4R7PA 1YP2A 5DEPA 3OU9A 4N6AA 2P2OA 1MR9A 3VBJA 5U2KA 3ECTA 3BSWA 3R5DA 5DEMA 3GQAA 1SSMA 4HCQA 3BSYA 4E79A 2QKXA 1QRGA 1Z2FA 2V0KA 2AQ9A 4G87A 3GOSA 3BXYA 4EGGA 1V3WA 3FWWA 4EA9A 1FWYA 3IXCA 1M8NA 3I3XA 2QIAA 1HM9A 3OH0A 1THJA 4MFGA 2GGOA 4IHGA 2NPOA 2VHEA 5AFUV 3OTMA 3MQGA 2XATA 1QRMA 3DHOA 4MYOA 2V0HA 3DK5A 3SRTA 4M2BA 3FSXA 4AC3A 3VNPA 3TV0A 1QQ0A 4HZCA 3EG4A 3ST8A 3IGJA 5DG3A 5ADXV 3V4EA 3GQ9A 1FXJA 2WLEA 4G3QA 3VBMA 1V67A 3BSSA 4R37A 2OI5A 2OEFA 3VBIA 2JF3A 2OI6A 1KK5A 4IHHA 2I5KA 4HUSA 1KK6A 4KNXA 3T57A 1KQAA 1KHRA 3BFPA 2QIVX 3R5AA 2WLFA 4HZDA 1G95A 2WLGA 3C8VA 4G3SA 4AA7A 2ICYA 3FSCA 1MRLA 5L6SA 1QREA 2W0WA 3MQHA 3D98A 3VBPA 3R5BA 3OH1A 3VBLA 1HV9A 4HURA 5L6VA 4E75A 1KRRA 2V0JA 4N6BA 3OW5A 1YP4A 3KWDA 4KQLA 4K6RA 5E3RA 3P1BA 1G97A 2IUAA
chains in the Genus database with same CATH topology
2IU8A 4N69A 1KGQA 4KPZA 5E3QA 3R0SA 4DCLA 4ISXA 2IC7A 3CJ8A 4M99A 2W0VA 1SSTA 2V0IA 1KRVA 1HM0A 3FSYA 3VBNA 3TDTA 2OI7A 4KPXA 4N27A 1KGTA 4J09A 4M28A 1MR7A 1SSQA 3DJ4A 3FS8A 1Z90A 3MC4A 1KRUA 1XATA 4M98A 2RIJA 3OUPA 3P47A 4E1KA 1YP3A 2IU9A 4E6UA 3SPTA 3NZ2A 1TDTA 2OEGA 3R3IA 1LXAA 2GGQA 1XHDA 3EH0A 3KWCA 3TISA 3R3RA 4R36A 3R8YA 2VD4A 3HJJA 4EAAA 2WLDA 4M9CA 3FOQA 3GUEA 2JF2A 3HSQA 1HM8A 2V0LA 4AAWA 3VBKA 4MZUA 5AFUU 3JQYA 5E3PA 4FCEA 3TK8A 3GVDA 4H7OA 4E6TA 3I3AA 1T3DA 3PMOA 1OCXA 2TDTA 1KK4A 4J18A 5ADXU 1QRFA 2ICXA 3F1XA 1S80A 1J2ZA 1QRLA 3FTTA 2FKOA 4KNRA 4M2AA 2WLCA 3TIOA 3R2WA 4EA8A 2Q4JA 3Q1XA 4EA7A 3BRKX 4EQYA 3EEVA 3KWEA 3R5CA 3R1WA 3D8VA 4EABA 3FSBA 3TWDA 5F42A 3OTZA 4IHFA 4G3PA 4R7PA 1YP2A 5DEPA 3OU9A 4N6AA 2P2OA 1MR9A 3VBJA 5U2KA 3ECTA 3BSWA 3R5DA 5DEMA 1SSMA 4HCQA 3BSYA 4E79A 2QKXA 1QRGA 2V0KA 2AQ9A 4G87A 3GOSA 3BXYA 4EGGA 1V3WA 3FWWA 4EA9A 1FWYA 3IXCA 3I3XA 2QIAA 1HM9A 1THJA 4MFGA 2GGOA 4IHGA 2NPOA 2VHEA 5AFUV 3OTMA 3MQGA 2XATA 1QRMA 3DHOA 4MYOA 2V0HA 3DK5A 3SRTA 4M2BA 3FSXA 4AC3A 3VNPA 3TV0A 1QQ0A 4HZCA 3EG4A 3ST8A 3IGJA 5DG3A 5ADXV 3V4EA 1FXJA 2WLEA 4G3QA 3VBMA 1V67A 3BSSA 4R37A 2OI5A 2OEFA 3VBIA 2JF3A 2OI6A 1KK5A 4IHHA 2I5KA 4HUSA 1KK6A 4KNXA 3T57A 1KQAA 1KHRA 3BFPA 2QIVX 3R5AA 2WLFA 4HZDA 1G95A 2WLGA 3C8VA 4G3SA 4AA7A 2ICYA 3FSCA 1MRLA 5L6SA 1QREA 2W0WA 3MQHA 3D98A 3VBPA 3R5BA 3VBLA 1HV9A 4HURA 5L6VA 4E75A 1KRRA 2V0JA 4N6BA 3OW5A 1YP4A 3KWDA 4KQLA 4K6RA 5E3RA 3P1BA 1G97A 2IUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU8 A;  4N69 A;  1KGQ A;  4KPZ A;  5E3Q A;  3R0S A;  4DCL A;  4ISX A;  2IC7 A;  3CJ8 A;  4M99 A;  2W0V A;  1SST A;  2V0I A;  1KRV A;  1HM0 A;  3FSY A;  3VBN A;  3TDT A;  2OI7 A;  4KPX A;  4N27 A;  1KGT A;  4J09 A;  4M28 A;  1MR7 A;  1SSQ A;  3DJ4 A;  3FS8 A;  1Z90 A;  3MC4 A;  1KRU A;  1XAT A;  4M98 A;  2RIJ A;  3OUP A;  3P47 A;  4E1K A;  1YP3 A;  2IU9 A;  4E6U A;  3SPT A;  3NZ2 A;  1TDT A;  2OEG A;  3R3I A;  1LXA A;  2GGQ A;  1XHD A;  3EH0 A;  3KWC A;  3TIS A;  3R3R A;  4R36 A;  3R8Y A;  2VD4 A;  3HJJ A;  4EAA A;  2WLD A;  4M9C A;  3FOQ A;  3GUE A;  2JF2 A;  3HSQ A;  1HM8 A;  2V0L A;  4AAW A;  3VBK A;  4MZU A;  5AFU U;  3JQY A;  5E3P A;  4FCE A;  3TK8 A;  3GVD A;  4H7O A;  4E6T A;  3I3A A;  1T3D A;  3PMO A;  1OCX A;  2TDT A;  1KK4 A;  4J18 A;  5ADX U;  1QRF A;  2ICX A;  3F1X A;  1S80 A;  1J2Z A;  1QRL A;  3FTT A;  2FKO A;  4KNR A;  4M2A A;  2WLC A;  3TIO A;  3R2W A;  4EA8 A;  2Q4J A;  3Q1X A;  4EA7 A;  3BRK X;  4EQY A;  3EEV A;  3KWE A;  3R5C A;  3R1W A;  3D8V A;  4EAB A;  3FSB A;  3TWD A;  5F42 A;  3OTZ A;  4IHF A;  4G3P A;  4R7P A;  1YP2 A;  5DEP A;  3OU9 A;  4N6A A;  2P2O A;  1MR9 A;  3VBJ A;  5U2K A;  3ECT A;  3BSW A;  3R5D A;  5DEM A;  1SSM A;  4HCQ A;  3BSY A;  4E79 A;  2QKX A;  1QRG A;  2V0K A;  2AQ9 A;  4G87 A;  3GOS A;  3BXY A;  4EGG A;  1V3W A;  3FWW A;  4EA9 A;  1FWY A;  3IXC A;  3I3X A;  2QIA A;  1HM9 A;  1THJ A;  4MFG A;  2GGO A;  4IHG A;  2NPO A;  2VHE A;  5AFU V;  3OTM A;  3MQG A;  2XAT A;  1QRM A;  3DHO A;  4MYO A;  2V0H A;  3DK5 A;  3SRT A;  4M2B A;  3FSX A;  4AC3 A;  3VNP A;  3TV0 A;  1QQ0 A;  4HZC A;  3EG4 A;  3ST8 A;  3IGJ A;  5DG3 A;  5ADX V;  3V4E A;  1FXJ A;  2WLE A;  4G3Q A;  3VBM A;  1V67 A;  3BSS A;  4R37 A;  2OI5 A;  2OEF A;  3VBI A;  2JF3 A;  2OI6 A;  1KK5 A;  4IHH A;  2I5K A;  4HUS A;  1KK6 A;  4KNX A;  3T57 A;  1KQA A;  1KHR A;  3BFP A;  2QIV X;  3R5A A;  2WLF A;  4HZD A;  1G95 A;  2WLG A;  3C8V A;  4G3S A;  4AA7 A;  2ICY A;  3FSC A;  1MRL A;  5L6S A;  1QRE A;  2W0W A;  3MQH A;  3D98 A;  3VBP A;  3R5B A;  3VBL A;  1HV9 A;  4HUR A;  5L6V A;  4E75 A;  1KRR A;  2V0J A;  4N6B A;  3OW5 A;  1YP4 A;  3KWD A;  4KQL A;  4K6R A;  5E3R A;  3P1B A;  1G97 A;  2IUA A; 
#chains in the Genus database with same CATH topology
 2IU8 A;  4N69 A;  1KGQ A;  4KPZ A;  5E3Q A;  3R0S A;  4DCL A;  4ISX A;  3OH3 A;  2IC7 A;  3CJ8 A;  4M99 A;  2W0V A;  1SST A;  2V0I A;  1KRV A;  1HM0 A;  3FSY A;  3VBN A;  3GQ7 A;  3TDT A;  2OI7 A;  4KPX A;  4N27 A;  1EWW A;  1KGT A;  4J09 A;  4M28 A;  1MR7 A;  3GQ8 A;  1SSQ A;  3DJ4 A;  3FS8 A;  1Z90 A;  3MC4 A;  1KRU A;  1XAT A;  3SUC A;  4M98 A;  2RIJ A;  3OUP A;  3OGZ A;  3P47 A;  4E1K A;  1YP3 A;  2IU9 A;  4E6U A;  3SPT A;  3NZ2 A;  1TDT A;  2OEG A;  3R3I A;  1LXA A;  2GGQ A;  1XHD A;  3OH2 A;  3EH0 A;  3KWC A;  3TIS A;  3R3R A;  4R36 A;  3R8Y A;  2VD4 A;  3HJJ A;  4EAA A;  2WLD A;  4M9C A;  3FOQ A;  3GUE A;  2JF2 A;  3HSQ A;  1HM8 A;  2V0L A;  4AAW A;  3VBK A;  4MZU A;  5AFU U;  3JQY A;  5E3P A;  4FCE A;  3TK8 A;  3GVD A;  4H7O A;  4E6T A;  1N4I A;  3I3A A;  1T3D A;  3PMO A;  1OCX A;  2TDT A;  1KK4 A;  4J18 A;  5ADX U;  1QRF A;  2ICX A;  3F1X A;  1S80 A;  1J2Z A;  1QRL A;  3FTT A;  2FKO A;  3OH4 A;  4KNR A;  2WLC A;  4M2A A;  3TIO A;  3R2W A;  4EA8 A;  2Q4J A;  3Q1X A;  4EA7 A;  1L0S A;  3BRK X;  4EQY A;  3EEV A;  3KWE A;  3R5C A;  3R1W A;  3D8V A;  4EAB A;  3FSB A;  3TWD A;  5F42 A;  3OTZ A;  4IHF A;  4G3P A;  4R7P A;  1YP2 A;  5DEP A;  3OU9 A;  4N6A A;  2P2O A;  1MR9 A;  3VBJ A;  5U2K A;  3ECT A;  3BSW A;  3R5D A;  5DEM A;  3GQA A;  1SSM A;  4HCQ A;  3BSY A;  4E79 A;  2QKX A;  1QRG A;  1Z2F A;  2V0K A;  2AQ9 A;  4G87 A;  3GOS A;  3BXY A;  4EGG A;  1V3W A;  3FWW A;  4EA9 A;  1FWY A;  3IXC A;  1M8N A;  3I3X A;  2QIA A;  1HM9 A;  3OH0 A;  1THJ A;  4MFG A;  2GGO A;  4IHG A;  2NPO A;  2VHE A;  5AFU V;  3OTM A;  3MQG A;  2XAT A;  1QRM A;  3DHO A;  4MYO A;  2V0H A;  3DK5 A;  3SRT A;  4M2B A;  3FSX A;  4AC3 A;  3VNP A;  3TV0 A;  1QQ0 A;  4HZC A;  3EG4 A;  3ST8 A;  3IGJ A;  5DG3 A;  5ADX V;  3V4E A;  3GQ9 A;  1FXJ A;  2WLE A;  4G3Q A;  3VBM A;  1V67 A;  3BSS A;  4R37 A;  2OI5 A;  2OEF A;  3VBI A;  2JF3 A;  2OI6 A;  1KK5 A;  4IHH A;  2I5K A;  4HUS A;  1KK6 A;  4KNX A;  3T57 A;  1KQA A;  1KHR A;  3BFP A;  2QIV X;  3R5A A;  2WLF A;  4HZD A;  1G95 A;  2WLG A;  3C8V A;  4G3S A;  4AA7 A;  2ICY A;  3FSC A;  1MRL A;  5L6S A;  1QRE A;  2W0W A;  3MQH A;  3D98 A;  3VBP A;  3R5B A;  3OH1 A;  3VBL A;  1HV9 A;  4HUR A;  5L6V A;  4E75 A;  1KRR A;  2V0J A;  4N6B A;  3OW5 A;  1YP4 A;  3KWD A;  4KQL A;  4K6R A;  5E3R A;  3P1B A;  1G97 A;  2IUA A; 
#chains in the Genus database with same CATH homology
 2IU8 A;  4N69 A;  1KGQ A;  4KPZ A;  5E3Q A;  3R0S A;  4DCL A;  4ISX A;  2IC7 A;  3CJ8 A;  4M99 A;  2W0V A;  1SST A;  2V0I A;  1KRV A;  1HM0 A;  3FSY A;  3VBN A;  3TDT A;  2OI7 A;  4KPX A;  4N27 A;  1KGT A;  4J09 A;  4M28 A;  1MR7 A;  1SSQ A;  3DJ4 A;  3FS8 A;  1Z90 A;  3MC4 A;  1KRU A;  1XAT A;  4M98 A;  2RIJ A;  3OUP A;  3P47 A;  4E1K A;  1YP3 A;  2IU9 A;  4E6U A;  3SPT A;  3NZ2 A;  1TDT A;  2OEG A;  3R3I A;  1LXA A;  2GGQ A;  1XHD A;  3EH0 A;  3KWC A;  3TIS A;  3R3R A;  4R36 A;  3R8Y A;  2VD4 A;  3HJJ A;  4EAA A;  2WLD A;  4M9C A;  3FOQ A;  3GUE A;  2JF2 A;  3HSQ A;  1HM8 A;  2V0L A;  4AAW A;  3VBK A;  4MZU A;  5AFU U;  3JQY A;  5E3P A;  4FCE A;  3TK8 A;  3GVD A;  4H7O A;  4E6T A;  3I3A A;  1T3D A;  3PMO A;  1OCX A;  2TDT A;  1KK4 A;  4J18 A;  5ADX U;  1QRF A;  2ICX A;  3F1X A;  1S80 A;  1J2Z A;  1QRL A;  3FTT A;  2FKO A;  4KNR A;  4M2A A;  2WLC A;  3TIO A;  3R2W A;  4EA8 A;  2Q4J A;  3Q1X A;  4EA7 A;  3BRK X;  4EQY A;  3EEV A;  3KWE A;  3R5C A;  3R1W A;  3D8V A;  4EAB A;  3FSB A;  3TWD A;  5F42 A;  3OTZ A;  4IHF A;  4G3P A;  4R7P A;  1YP2 A;  5DEP A;  3OU9 A;  4N6A A;  2P2O A;  1MR9 A;  3VBJ A;  5U2K A;  3ECT A;  3BSW A;  3R5D A;  5DEM A;  1SSM A;  4HCQ A;  3BSY A;  4E79 A;  2QKX A;  1QRG A;  2V0K A;  2AQ9 A;  4G87 A;  3GOS A;  3BXY A;  4EGG A;  1V3W A;  3FWW A;  4EA9 A;  1FWY A;  3IXC A;  3I3X A;  2QIA A;  1HM9 A;  1THJ A;  4MFG A;  2GGO A;  4IHG A;  2NPO A;  2VHE A;  5AFU V;  3OTM A;  3MQG A;  2XAT A;  1QRM A;  3DHO A;  4MYO A;  2V0H A;  3DK5 A;  3SRT A;  4M2B A;  3FSX A;  4AC3 A;  3VNP A;  3TV0 A;  1QQ0 A;  4HZC A;  3EG4 A;  3ST8 A;  3IGJ A;  5DG3 A;  5ADX V;  3V4E A;  1FXJ A;  2WLE A;  4G3Q A;  3VBM A;  1V67 A;  3BSS A;  4R37 A;  2OI5 A;  2OEF A;  3VBI A;  2JF3 A;  2OI6 A;  1KK5 A;  4IHH A;  2I5K A;  4HUS A;  1KK6 A;  4KNX A;  3T57 A;  1KQA A;  1KHR A;  3BFP A;  2QIV X;  3R5A A;  2WLF A;  4HZD A;  1G95 A;  2WLG A;  3C8V A;  4G3S A;  4AA7 A;  2ICY A;  3FSC A;  1MRL A;  5L6S A;  1QRE A;  2W0W A;  3MQH A;  3D98 A;  3VBP A;  3R5B A;  3VBL A;  1HV9 A;  4HUR A;  5L6V A;  4E75 A;  1KRR A;  2V0J A;  4N6B A;  3OW5 A;  1YP4 A;  3KWD A;  4KQL A;  4K6R A;  5E3R A;  3P1B A;  1G97 A;  2IUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...