3V7EA

Crystal structure of ybxf bound to the sam-i riboswitch aptamer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosome-associated protein L7Ae-like
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ribosomal protein/rna
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7eA00
3J7AR 3NVIB 2BO1A 3LWPC 3LWOC 3J80M 4X3LA 2OHWA 1YJNF 3HJWC 1M1KH 3OBWA 3NMUC 1CN7A 3O85A 2VGNA 3G6EF 1K73H 1KC8H 3J81M 1VQ6F 3CCJF 1SDSA 3JAMM 3MCAB 3VI6A 3LWRC 5GINC 3G71F 3PLAC 1VQNF 3IR9A 3I56F 3RA6A 3CC4F 2LBWA 2KG4A 1W40A 5GAPK 3HAXD 5GIOC 3V7EA 2AIFA 1W3EX 3CCMF 5A2QM 3CG6A 1M90H 3FFMA 1GO1A 1YITF 3CCEF 3WXMB 1VQPF 3E1YA 1GO0A 3CC2F 3OBYA 1RLGA 1NJIH 1ZWZA 3SIUA 1VQMF 2FC3A 1X52A 3LWVC 1VQOF 3VMFB 1W41A 1T0KB 2ALEA 3AGKA 1PXWA 4X3MA 1GZ0A 3CD6F 3JCMM 1Q81H 1RA4A 1VQ4F 1YIJF 1Q86H 1XBIA 1NMUB 1JJ2F 3RA5A 3NVKE 2KTUA 1S72F 2OTJF 3CMEF 3CCSF 1VQ8F 3NK7A 1Q7YH 3NK6A 1YI2F 1Q82H 5G4UC 1VQ9F 2HVYD 1VQKF 3I55F 3N4ZA 2VGMA 2KTVA 1YJWF 3G4SF 5FJ4C 2OZBA 1W42A 3CPQA 3V7QA 5GANK 5G4VC 1X7OA 3LFOA 5EWRA 3CMAF 3GYQA 1N8RH 1YJ9F 1QVFF 1DT9A 1KQSF 1KD1H 3LWQC 5IT9M 2I6DA 2CZWA 3OW2F 3E20B 3CXCF 3CCUF 2WALA 2LBXA 1VQ5F 1VQLF 5DCVA 1H7MA 3CCRF 3CCVF 2QA4F 3PAFA 3SIVA 4BY9D 1X7PA 1E7KA 3CCQF 3CC7F 4TZZA 2QEXF 4LCKA 1QVGF 5EO3A 3ON1A 2JNBA 4NUTA 1YHQF 1CK2A 1VQ7F 2QI2A 4C4WC 1K8AH 3CPWF 1K9MH 4BW0B 2OTLF 5FLXM 1W2BF 3CCLF 1IPAA 5GIPC 3N4YA
chains in the Genus database with same CATH superfamily
3J7AR 4ZK7A 4YJ3B 3ZP7A 3LWPC 4X3LA 3I7TA 2LBTA 3OBWA 2G9IA 3JASA 3IMPA 3G6EF 1YQNA 2F9ZC 1KC8H 1COMA 4R40B 3RYIB 1VH8A 2R6R1 3JATB 3JAMM 4O2AA 3JVHA 3M84A 3KJKA 4EI7A 3KIZA 1VQVA 4I50A 3V4DA 4BT3A 2GLZA 4ZI7B 2GVIA 3F0EA 3JAWA 4ZHQA 4O4LA 2ZVYA 5GAPK 1W40A 3HAXD 5LP6B 2PHNA 2EWCA 3FFMA 3VO8A 3WXMB 4IHJB 3VYUC 1VQPF 2KGWA 2I6RA 1FNKA 1RLGA 5J2TB 4HNAA 3SIUA 3C8LA 3HKDB 4G88A 4ZHYB 4EI8A 3RYFA 5HXZA 2FC3A 2RHOA 3U0OA 1W41A 2LCAA 3VCZA 3WGKA 1Q81H 3S0HA 1YIJF 5EB0A 3MCQA 2B33A 2H8EA 3MBMA 2YYEA 5HY2A 1YI2F 5G4UC 1VQ9F 3VOBA 2DT4A 1SZQA 5IJ0A 3V7QA 3KE1A 3UT5B 4B46A 4IIJA 5GANK 4KWEA 3JARA 4BVTA 1TUBB 4C8IA 3GYQA 5IJ9A 1N8RH 3QUWA 3N2GA 3VYTC 1Z5WA 4BVSA 3ESJA 4FFBA 5EYPB 5JH7A 3S02A 5IT9M 3N2KA 1FFXB 3I3FA 4RQOA 3OW2F 3CCUF 2VAPA 4HNAB 1X25A 5CA1A 4E6EA 1W59A 3IKEA 5JQGA 2QA4F 3MQWA 5KMGA 3M4SA 1E7KA 4C8GA 4WBNA 3CC7F 5EZYB 4O2BB 4YJ3A 1IV2A 3HKBB 4NUTA 5HXUA 2QI2A 1JFFB 2CWJA 1K8AH 2IG8A 1IV4A 3IEQA 1K9MH 5B8FA 1W2BF 1IPAA 5GIPC 5HP8A 3JATA 3KJJA 4BT7A 3NVIB 2BO1A 2DYYA 4X1YB 5CA0B 3BYQA 2OHWA 2Z1TA 1XHOA 1YJNF 1W55A 3JARB 1CN7A 5JVDB 3O85A 4ZI7A 2UYPA 2AMTA 2CW4A 5BMVB 5KX5A 5LP6A 4DXDA 4FFBB 3CCJF 5JH7B 3N2KB 4NQ3A 4C81A 5HY4A 3C9UA 3WPWA 4IHJA 2UYKA 5GINC 3PLAC 2HRYA 4X1KA 1YGYA 1W5FA 5J2TA 5JQGB 2ZF8A 3RA6A 2BTQB 3HKDA 5JCOA 4WBNB 3E22B 3CCMF 5A2QM 3CG6A 3RE3A 3CYPB 4F6RB 5HP7A 2K1SA 3WJRA 3P10A 4ZHWA 5FNVB 4C82A 1ZWZA 1U43A 3M1XA 4LNUB 2HS0A 1X52A 3IEWA 4X20B 3RYCA 3JALB 1T0KB 3RYHB 2ALEA 4X3MA 1GZ0A 3CD6F 4BVQA 4XCQA 1RA4A 5MN6A 1VQ4F 1T0AA 3UT5A 1JJ2F 3RA5A 3NVKE 2N48A 2QTPA 5KX5B 1TUBA 1Q7YH 1ONIA 4TV8B 5LXTB 3C9TA 3S03A 3TD5A 3I55F 3N4ZA 5EYPA 1RQ7A 4X1KB 1FFXA 5FJ4C 2RHHA 3WPXA 4O4JB 2Z1FA 4O4IB 5C8YA 1DBFA 4C8EA 2ZODA 1U40A 2MQEA 1YJ9F 4B45A 1DT9A 4I4TA 5EZYA 4O2BA 3HKBA 3FBAA 5LA6B 1IV1A 4BT2A 5AVMA 3WGNA 3S0WA 3L7QA 2LBXA 1JFFA 1VQLF 3CCVF 3ELCA 3PAFA 4I55B 3SIVA 3RYCB 1X7PA 5HY0A 3F0FA 1J7HA 3R0PA 4X1YA 5CA0A 2CHSA 2JNBA 1YHQF 1VQ7F 4G4ZA 5JVDA 4YJ2B 1QAHA 3HKCB 5FLXM 1XV2A 3CCLF 5BMVA 1GX1A 4TV9B 2H8CA 4U39A 3J80M 5C8YB 1W5EA 4G4XA 1M1KH 4RHAA 2VGNA 1CLIA 3S06A 1IV3A 3QTYA 1K73H 1U3LA 4ZHVA 5ITZB 4I4TB 1W5AA 1UFYA 2L26A 3E22A 1W57A 5J2UB 4X1IB 3VI6A 3LWRC 1QD9A 3WJQA 5IYZA 3G71F 4F6RA 1VQNF 1VK3A 3I56F 5EIBC 5FNVA 2ZAUA 3CC4F 2KG4A 3TD3A 3P4EA 4LNUA 3V7EA 2YXZA 4X20A 1XRGA 3JALA 3RYHA 3DDNA 5LYJA 2P6YA 3F0GA 3E1YA 1GO0A 3OBYA 3JAKB 4BT5A 1NQ3A 1OAPA 3HTNA 2Z01A 1VQOF 4TV8A 5LXTA 1KNKA 4NWOB 3VMFB 2V9YA 2HP0A 1PXWA 2CSLA 2Z1UA 4O4JA 2Q1XA 4O4IA 3GTZA 2KTUA 3WGMA 1S72F 2OTJF 3NK7A 2HP3A 3C9RA 4O4HA 3VIUA 3EORA 1Q82H 2HVYD 2PMPA 3LDTA 2BTOA 1VQKF 4TUYB 5IYZB 4DRXB 1FSZA 5LA6A 1OFUA 2FGYA 3G4SF 3CPQA 3T80A 3S0YA 2HX0A 3FPIA 4ERHA 2W8BC 3KHNA 3D01A 5EWRA 2ZOVA 1RQ2A 4I55A 4BT4A 2HS4A 3LWQC 5LYJB 1Q8RA 5LP6C 3E20B 5HY1A 1W5BA 2WALA 5LOVA 2R751 1VQ5F 4YJ2A 3VOAA 1H7MA 1R1MA 2Z1EA 3D00A 3HKCA 3ERNA 3CCRF 4U3JA 3F6MA 1W581 4TV9A 2HP0B 3CCQF 1SA0B 3FD5A 2UYNB 3ZO8A 4EB6B 5EO3A 3ON1A 5JCOC 2CVLA 1CK2A 5GONB 4C4WC 3HKEB 3CPWF 3GHZA 2OTLF 4BW0B 1TVKB 1PF5A 4O4HB 3WGJA 5ITZA 2VAWA 4ZOLB 1KNJA 5J2UA 3LWOC 4X1IA 3B6NA 4B62A 3HJWC 1FNJA 3NMUC 3IKFA 5CB4B 2GZLA 1JD1A 1UI9A 3WJPA 3J81M 2OTMA 1VQ6F 1SDSA 4G4VA 4G4YA 3LMEA 3K12A 3MCAB 5LOVB 3CB2A 3D54A 3Q8HA 1H47A 5MN4A 3JASB 2HRUA 3IR9A 3JAKA 5EB1B 2Q1YA 4U3JB 2LBWA 5GIOC 2AIFA 1W3EX 2H6LA 1M90H 2VAMA 3FD6A 1GO1A 3VYSC 4O2AB 1YITF 3CCEF 3ZOPA 2NMUA 4I50B 2RHLA 3P0ZA 3CC2F 3JAWB 3OONA 4O4LB 4ZHQB 1NJIH 5EAZA 2IAFA 1VQMF 3LWVC 2RHJA 5EIBD 3DC2A 3HWUA 4TUYA 3AGKA 3K14A 4DRXA 3JCMM 1Q86H 1XBIA 1NMUB 2HQSC 4B5CA 3CMEF 3CCSF 3RYFB 3V3TA 1VQ8F 3C9SA 3NK6A 1JY8A 2AIZP 2ZVZA 4EI9A 1U3PA 2KTVA 2VGMA 5MN5A 1YJWF 4G4WA 1QU9A 1H48A 3F0DA 1W42A 2OZBA 3ZP4A 2IQQA 1ODEA 3K0TA 5G4VC 1X7OA 3TD4A 3LFOA 3CYQA 2VXYA 3CMAF 4BVRA 1QVFF 4PWTA 1KQSF 2RB9A 1SA0A 1KD1H 3RYIA 2UYNA 5IJ0B 4EB6A 2I6DA 2CZWA 1Z5VA 3CXCF 3VTIC 4IIJB 5GONA 5DCVA 3HKEA 1TVKA 3WGLA 2HS3A 4BT6A 5HWEA 1RLUA 5IJ9B 3N2GB 4BY9D 2UZHA 4TZZA 1VHAA 2QEXF 2CHTA 1QVGF 4LCKA 4ZOLA 3LYBA 3QHDA 3MDOA 2BTUA 5CB4A 5CA1B 3K2XA 1JN1A 2UYJA 4M8IA 5KMGB 3N4YA
chains in the Genus database with same CATH topology
3J7AR 3NVIB 2BO1A 3LWPC 3LWOC 3J80M 4X3LA 2OHWA 1YJNF 3HJWC 1M1KH 3OBWA 3NMUC 1CN7A 3O85A 2VGNA 3G6EF 1K73H 2F9ZC 3J81M 1KC8H 1VQ6F 3CCJF 1SDSA 4NQ3A 5HY4A 3JAMM 3MCAB 3VI6A 3LWRC 4EI7A 5GINC 3G71F 3PLAC 1VQNF 3IR9A 2GLZA 3I56F 3RA6A 3CC4F 2LBWA 2KG4A 1W40A 5GAPK 3HAXD 5GIOC 3V7EA 2AIFA 1W3EX 3CCMF 5A2QM 3CG6A 1M90H 3FFMA 1GO1A 1YITF 3CCEF 3WXMB 1VQPF 3E1YA 1GO0A 3CC2F 3OBYA 1RLGA 1NJIH 1ZWZA 3SIUA 1VQMF 4EI8A 5HXZA 2FC3A 1X52A 3LWVC 1VQOF 3VMFB 1W41A 1T0KB 2ALEA 3AGKA 1PXWA 4X3MA 1GZ0A 3CD6F 4BVQA 4XCQA 3JCMM 1Q81H 1RA4A 1VQ4F 1YIJF 1Q86H 1XBIA 1NMUB 1JJ2F 3RA5A 3NVKE 2KTUA 1S72F 2OTJF 3CMEF 3CCSF 3V3TA 5HY2A 3NK7A 1Q7YH 1VQ8F 3NK6A 1YI2F 1Q82H 5G4UC 1VQ9F 2HVYD 1VQKF 3I55F 3N4ZA 4EI9A 2VGMA 2KTVA 1YJWF 3G4SF 2FGYA 5FJ4C 2OZBA 1W42A 3CPQA 3V7QA 5GANK 5G4VC 1X7OA 4BVTA 3LFOA 5EWRA 3CMAF 3GYQA 4BVRA 1N8RH 1YJ9F 1QVFF 4BVSA 1DT9A 1KQSF 1KD1H 3LWQC 5IT9M 2I6DA 2CZWA 3OW2F 3E20B 3CXCF 5HY1A 3CCUF 2WALA 2LBXA 1VQ5F 1VQLF 5DCVA 1H7MA 3D00A 3CCRF 3CCVF 5HWEA 2QA4F 3PAFA 3SIVA 4BY9D 1X7PA 5HY0A 1E7KA 3CCQF 3CC7F 4TZZA 2QEXF 4LCKA 1QVGF 5EO3A 3ON1A 2JNBA 4NUTA 1YHQF 1CK2A 5HXUA 2QI2A 1VQ7F 4C4WC 1K8AH 3CPWF 1K9MH 4BW0B 2OTLF 5FLXM 1W2BF 3CCLF 1IPAA 5GIPC 3N4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A R;  3NVI B;  2BO1 A;  3LWP C;  3LWO C;  3J80 M;  4X3L A;  2OHW A;  1YJN F;  3HJW C;  1M1K H;  3OBW A;  3NMU C;  1CN7 A;  3O85 A;  2VGN A;  3G6E F;  1K73 H;  1KC8 H;  3J81 M;  1VQ6 F;  3CCJ F;  1SDS A;  3JAM M;  3MCA B;  3VI6 A;  3LWR C;  5GIN C;  3G71 F;  3PLA C;  1VQN F;  3IR9 A;  3I56 F;  3RA6 A;  3CC4 F;  2LBW A;  2KG4 A;  1W40 A;  5GAP K;  3HAX D;  5GIO C;  3V7E A;  2AIF A;  1W3E X;  3CCM F;  5A2Q M;  3CG6 A;  1M90 H;  3FFM A;  1GO1 A;  1YIT F;  3CCE F;  3WXM B;  1VQP F;  3E1Y A;  1GO0 A;  3CC2 F;  3OBY A;  1RLG A;  1NJI H;  1ZWZ A;  3SIU A;  1VQM F;  2FC3 A;  1X52 A;  3LWV C;  1VQO F;  3VMF B;  1W41 A;  1T0K B;  2ALE A;  3AGK A;  1PXW A;  4X3M A;  1GZ0 A;  3CD6 F;  3JCM M;  1Q81 H;  1RA4 A;  1VQ4 F;  1YIJ F;  1Q86 H;  1XBI A;  1NMU B;  1JJ2 F;  3RA5 A;  3NVK E;  2KTU A;  1S72 F;  2OTJ F;  3CME F;  3CCS F;  1VQ8 F;  3NK7 A;  1Q7Y H;  3NK6 A;  1YI2 F;  1Q82 H;  5G4U C;  1VQ9 F;  2HVY D;  1VQK F;  3I55 F;  3N4Z A;  2VGM A;  2KTV A;  1YJW F;  3G4S F;  5FJ4 C;  2OZB A;  1W42 A;  3CPQ A;  3V7Q A;  5GAN K;  5G4V C;  1X7O A;  3LFO A;  5EWR A;  3CMA F;  3GYQ A;  1N8R H;  1YJ9 F;  1QVF F;  1DT9 A;  1KQS F;  1KD1 H;  3LWQ C;  5IT9 M;  2I6D A;  2CZW A;  3OW2 F;  3E20 B;  3CXC F;  3CCU F;  2WAL A;  2LBX A;  1VQ5 F;  1VQL F;  5DCV A;  1H7M A;  3CCR F;  3CCV F;  2QA4 F;  3PAF A;  3SIV A;  4BY9 D;  1X7P A;  1E7K A;  3CCQ F;  3CC7 F;  4TZZ A;  2QEX F;  4LCK A;  1QVG F;  5EO3 A;  3ON1 A;  2JNB A;  4NUT A;  1YHQ F;  1CK2 A;  1VQ7 F;  2QI2 A;  4C4W C;  1K8A H;  3CPW F;  1K9M H;  4BW0 B;  2OTL F;  5FLX M;  1W2B F;  3CCL F;  1IPA A;  5GIP C;  3N4Y A; 
#chains in the Genus database with same CATH topology
 3J7A R;  4ZK7 A;  4YJ3 B;  3ZP7 A;  3LWP C;  4X3L A;  3I7T A;  2LBT A;  3OBW A;  2G9I A;  3JAS A;  3IMP A;  3G6E F;  1YQN A;  2F9Z C;  1KC8 H;  1COM A;  4R40 B;  3RYI B;  1VH8 A;  2R6R 1;  3JAT B;  3JAM M;  4O2A A;  3JVH A;  3M84 A;  3KJK A;  4EI7 A;  3KIZ A;  1VQV A;  4I50 A;  3V4D A;  4BT3 A;  2GLZ A;  4ZI7 B;  2GVI A;  3F0E A;  3JAW A;  4ZHQ A;  4O4L A;  2ZVY A;  5GAP K;  1W40 A;  3HAX D;  5LP6 B;  2PHN A;  2EWC A;  3FFM A;  3VO8 A;  3WXM B;  4IHJ B;  3VYU C;  1VQP F;  2KGW A;  2I6R A;  1FNK A;  1RLG A;  5J2T B;  4HNA A;  3SIU A;  3C8L A;  3HKD B;  4G88 A;  4ZHY B;  4EI8 A;  3RYF A;  5HXZ A;  2FC3 A;  2RHO A;  3U0O A;  1W41 A;  2LCA A;  3VCZ A;  3WGK A;  1Q81 H;  3S0H A;  1YIJ F;  5EB0 A;  3MCQ A;  2B33 A;  2H8E A;  3MBM A;  2YYE A;  5HY2 A;  1YI2 F;  5G4U C;  1VQ9 F;  3VOB A;  2DT4 A;  1SZQ A;  5IJ0 A;  3V7Q A;  3KE1 A;  3UT5 B;  4B46 A;  4IIJ A;  5GAN K;  4KWE A;  3JAR A;  4BVT A;  1TUB B;  4C8I A;  3GYQ A;  5IJ9 A;  1N8R H;  3QUW A;  3N2G A;  3VYT C;  1Z5W A;  4BVS A;  3ESJ A;  4FFB A;  5EYP B;  5JH7 A;  3S02 A;  5IT9 M;  3N2K A;  1FFX B;  3I3F A;  4RQO A;  3OW2 F;  3CCU F;  2VAP A;  4HNA B;  1X25 A;  5CA1 A;  4E6E A;  1W59 A;  3IKE A;  5JQG A;  2QA4 F;  3MQW A;  5KMG A;  3M4S A;  1E7K A;  4C8G A;  4WBN A;  3CC7 F;  5EZY B;  4O2B B;  4YJ3 A;  1IV2 A;  3HKB B;  4NUT A;  5HXU A;  2QI2 A;  1JFF B;  2CWJ A;  1K8A H;  2IG8 A;  1IV4 A;  3IEQ A;  1K9M H;  5B8F A;  1W2B F;  1IPA A;  5GIP C;  5HP8 A;  3JAT A;  3KJJ A;  4BT7 A;  3NVI B;  2BO1 A;  2DYY A;  4X1Y B;  5CA0 B;  3BYQ A;  2OHW A;  2Z1T A;  1XHO A;  1YJN F;  1W55 A;  3JAR B;  1CN7 A;  5JVD B;  3O85 A;  4ZI7 A;  2UYP A;  2AMT A;  2CW4 A;  5BMV B;  5KX5 A;  5LP6 A;  4DXD A;  4FFB B;  3CCJ F;  5JH7 B;  3N2K B;  4NQ3 A;  4C81 A;  5HY4 A;  3C9U A;  3WPW A;  4IHJ A;  2UYK A;  5GIN C;  3PLA C;  2HRY A;  4X1K A;  1YGY A;  1W5F A;  5J2T A;  5JQG B;  2ZF8 A;  3RA6 A;  2BTQ B;  3HKD A;  5JCO A;  4WBN B;  3E22 B;  3CCM F;  5A2Q M;  3CG6 A;  3RE3 A;  3CYP B;  4F6R B;  5HP7 A;  2K1S A;  3WJR A;  3P10 A;  4ZHW A;  5FNV B;  4C82 A;  1ZWZ A;  1U43 A;  3M1X A;  4LNU B;  2HS0 A;  1X52 A;  3IEW A;  4X20 B;  3RYC A;  3JAL B;  1T0K B;  3RYH B;  2ALE A;  4X3M A;  1GZ0 A;  3CD6 F;  4BVQ A;  4XCQ A;  1RA4 A;  5MN6 A;  1VQ4 F;  1T0A A;  3UT5 A;  1JJ2 F;  3RA5 A;  3NVK E;  2N48 A;  2QTP A;  5KX5 B;  1TUB A;  1Q7Y H;  1ONI A;  4TV8 B;  5LXT B;  3C9T A;  3S03 A;  3TD5 A;  3I55 F;  3N4Z A;  5EYP A;  1RQ7 A;  4X1K B;  1FFX A;  5FJ4 C;  2RHH A;  3WPX A;  4O4J B;  2Z1F A;  4O4I B;  5C8Y A;  1DBF A;  4C8E A;  2ZOD A;  1U40 A;  2MQE A;  1YJ9 F;  4B45 A;  1DT9 A;  4I4T A;  5EZY A;  4O2B A;  3HKB A;  3FBA A;  5LA6 B;  1IV1 A;  4BT2 A;  5AVM A;  3WGN A;  3S0W A;  3L7Q A;  2LBX A;  1JFF A;  1VQL F;  3CCV F;  3ELC A;  3PAF A;  4I55 B;  3SIV A;  3RYC B;  1X7P A;  5HY0 A;  3F0F A;  1J7H A;  3R0P A;  4X1Y A;  5CA0 A;  2CHS A;  2JNB A;  1YHQ F;  1VQ7 F;  4G4Z A;  5JVD A;  4YJ2 B;  1QAH A;  3HKC B;  5FLX M;  1XV2 A;  3CCL F;  5BMV A;  1GX1 A;  4TV9 B;  2H8C A;  4U39 A;  3J80 M;  5C8Y B;  1W5E A;  4G4X A;  1M1K H;  4RHA A;  2VGN A;  1CLI A;  3S06 A;  1IV3 A;  3QTY A;  1K73 H;  1U3L A;  4ZHV A;  5ITZ B;  4I4T B;  1W5A A;  1UFY A;  2L26 A;  3E22 A;  1W57 A;  5J2U B;  4X1I B;  3VI6 A;  3LWR C;  1QD9 A;  3WJQ A;  5IYZ A;  3G71 F;  4F6R A;  1VQN F;  1VK3 A;  3I56 F;  5EIB C;  5FNV A;  2ZAU A;  3CC4 F;  2KG4 A;  3TD3 A;  3P4E A;  4LNU A;  3V7E A;  2YXZ A;  4X20 A;  1XRG A;  3JAL A;  3RYH A;  3DDN A;  5LYJ A;  2P6Y A;  3F0G A;  3E1Y A;  1GO0 A;  3OBY A;  3JAK B;  4BT5 A;  1NQ3 A;  1OAP A;  3HTN A;  2Z01 A;  1VQO F;  4TV8 A;  5LXT A;  1KNK A;  4NWO B;  3VMF B;  2V9Y A;  2HP0 A;  1PXW A;  2CSL A;  2Z1U A;  4O4J A;  2Q1X A;  4O4I A;  3GTZ A;  2KTU A;  3WGM A;  1S72 F;  2OTJ F;  3NK7 A;  2HP3 A;  3C9R A;  4O4H A;  3VIU A;  3EOR A;  1Q82 H;  2HVY D;  2PMP A;  3LDT A;  2BTO A;  1VQK F;  4TUY B;  5IYZ B;  4DRX B;  1FSZ A;  5LA6 A;  1OFU A;  2FGY A;  3G4S F;  3CPQ A;  3T80 A;  3S0Y A;  2HX0 A;  3FPI A;  4ERH A;  2W8B C;  3KHN A;  3D01 A;  5EWR A;  2ZOV A;  1RQ2 A;  4I55 A;  4BT4 A;  2HS4 A;  3LWQ C;  5LYJ B;  1Q8R A;  5LP6 C;  3E20 B;  5HY1 A;  1W5B A;  2WAL A;  5LOV A;  2R75 1;  1VQ5 F;  4YJ2 A;  3VOA A;  1H7M A;  1R1M A;  2Z1E A;  3D00 A;  3HKC A;  3ERN A;  3CCR F;  4U3J A;  3F6M A;  1W58 1;  4TV9 A;  2HP0 B;  3CCQ F;  1SA0 B;  3FD5 A;  2UYN B;  3ZO8 A;  4EB6 B;  5EO3 A;  3ON1 A;  5JCO C;  2CVL A;  1CK2 A;  5GON B;  4C4W C;  3HKE B;  3CPW F;  3GHZ A;  2OTL F;  4BW0 B;  1TVK B;  1PF5 A;  4O4H B;  3WGJ A;  5ITZ A;  2VAW A;  4ZOL B;  1KNJ A;  5J2U A;  3LWO C;  4X1I A;  3B6N A;  4B62 A;  3HJW C;  1FNJ A;  3NMU C;  3IKF A;  5CB4 B;  2GZL A;  1JD1 A;  1UI9 A;  3WJP A;  3J81 M;  2OTM A;  1VQ6 F;  1SDS A;  4G4V A;  4G4Y A;  3LME A;  3K12 A;  3MCA B;  5LOV B;  3CB2 A;  3D54 A;  3Q8H A;  1H47 A;  5MN4 A;  3JAS B;  2HRU A;  3IR9 A;  3JAK A;  5EB1 B;  2Q1Y A;  4U3J B;  2LBW A;  5GIO C;  2AIF A;  1W3E X;  2H6L A;  1M90 H;  2VAM A;  3FD6 A;  1GO1 A;  3VYS C;  4O2A B;  1YIT F;  3CCE F;  3ZOP A;  2NMU A;  4I50 B;  2RHL A;  3P0Z A;  3CC2 F;  3JAW B;  3OON A;  4O4L B;  4ZHQ B;  1NJI H;  5EAZ A;  2IAF A;  1VQM F;  3LWV C;  2RHJ A;  5EIB D;  3DC2 A;  3HWU A;  4TUY A;  3AGK A;  3K14 A;  4DRX A;  3JCM M;  1Q86 H;  1XBI A;  1NMU B;  2HQS C;  4B5C A;  3CME F;  3CCS F;  3RYF B;  3V3T A;  1VQ8 F;  3C9S A;  3NK6 A;  1JY8 A;  2AIZ P;  2ZVZ A;  4EI9 A;  1U3P A;  2KTV A;  2VGM A;  5MN5 A;  1YJW F;  4G4W A;  1QU9 A;  1H48 A;  3F0D A;  1W42 A;  2OZB A;  3ZP4 A;  2IQQ A;  1ODE A;  3K0T A;  5G4V C;  1X7O A;  3TD4 A;  3LFO A;  3CYQ A;  2VXY A;  3CMA F;  4BVR A;  1QVF F;  4PWT A;  1KQS F;  2RB9 A;  1SA0 A;  1KD1 H;  3RYI A;  2UYN A;  5IJ0 B;  4EB6 A;  2I6D A;  2CZW A;  1Z5V A;  3CXC F;  3VTI C;  4IIJ B;  5GON A;  5DCV A;  3HKE A;  1TVK A;  3WGL A;  2HS3 A;  4BT6 A;  5HWE A;  1RLU A;  5IJ9 B;  3N2G B;  4BY9 D;  2UZH A;  4TZZ A;  1VHA A;  2QEX F;  2CHT A;  1QVG F;  4LCK A;  4ZOL A;  3LYB A;  3QHD A;  3MDO A;  2BTU A;  5CB4 A;  5CA1 B;  3K2X A;  1JN1 A;  2UYJ A;  4M8I A;  5KMG B;  3N4Y A; 
#chains in the Genus database with same CATH homology
 3J7A R;  3NVI B;  2BO1 A;  3LWP C;  3LWO C;  3J80 M;  4X3L A;  2OHW A;  1YJN F;  3HJW C;  1M1K H;  3OBW A;  3NMU C;  1CN7 A;  3O85 A;  2VGN A;  3G6E F;  1K73 H;  2F9Z C;  3J81 M;  1KC8 H;  1VQ6 F;  3CCJ F;  1SDS A;  4NQ3 A;  5HY4 A;  3JAM M;  3MCA B;  3VI6 A;  3LWR C;  4EI7 A;  5GIN C;  3G71 F;  3PLA C;  1VQN F;  3IR9 A;  2GLZ A;  3I56 F;  3RA6 A;  3CC4 F;  2LBW A;  2KG4 A;  1W40 A;  5GAP K;  3HAX D;  5GIO C;  3V7E A;  2AIF A;  1W3E X;  3CCM F;  5A2Q M;  3CG6 A;  1M90 H;  3FFM A;  1GO1 A;  1YIT F;  3CCE F;  3WXM B;  1VQP F;  3E1Y A;  1GO0 A;  3CC2 F;  3OBY A;  1RLG A;  1NJI H;  1ZWZ A;  3SIU A;  1VQM F;  4EI8 A;  5HXZ A;  2FC3 A;  1X52 A;  3LWV C;  1VQO F;  3VMF B;  1W41 A;  1T0K B;  2ALE A;  3AGK A;  1PXW A;  4X3M A;  1GZ0 A;  3CD6 F;  4BVQ A;  4XCQ A;  3JCM M;  1Q81 H;  1RA4 A;  1VQ4 F;  1YIJ F;  1Q86 H;  1XBI A;  1NMU B;  1JJ2 F;  3RA5 A;  3NVK E;  2KTU A;  1S72 F;  2OTJ F;  3CME F;  3CCS F;  3V3T A;  5HY2 A;  3NK7 A;  1Q7Y H;  1VQ8 F;  3NK6 A;  1YI2 F;  1Q82 H;  5G4U C;  1VQ9 F;  2HVY D;  1VQK F;  3I55 F;  3N4Z A;  4EI9 A;  2VGM A;  2KTV A;  1YJW F;  3G4S F;  2FGY A;  5FJ4 C;  2OZB A;  1W42 A;  3CPQ A;  3V7Q A;  5GAN K;  5G4V C;  1X7O A;  4BVT A;  3LFO A;  5EWR A;  3CMA F;  3GYQ A;  4BVR A;  1N8R H;  1YJ9 F;  1QVF F;  4BVS A;  1DT9 A;  1KQS F;  1KD1 H;  3LWQ C;  5IT9 M;  2I6D A;  2CZW A;  3OW2 F;  3E20 B;  3CXC F;  5HY1 A;  3CCU F;  2WAL A;  2LBX A;  1VQ5 F;  1VQL F;  5DCV A;  1H7M A;  3D00 A;  3CCR F;  3CCV F;  5HWE A;  2QA4 F;  3PAF A;  3SIV A;  4BY9 D;  1X7P A;  5HY0 A;  1E7K A;  3CCQ F;  3CC7 F;  4TZZ A;  2QEX F;  4LCK A;  1QVG F;  5EO3 A;  3ON1 A;  2JNB A;  4NUT A;  1YHQ F;  1CK2 A;  5HXU A;  2QI2 A;  1VQ7 F;  4C4W C;  1K8A H;  3CPW F;  1K9M H;  4BW0 B;  2OTL F;  5FLX M;  1W2B F;  3CCL F;  1IPA A;  5GIP C;  3N4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...