3V8LA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotinyl-5'-amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
molecule keywords Biotin ligase
molecule tags Ligase/ligase inhibitor
source organism Staphylococcus aureus
total genus 100
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8lA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8lA02
5BS6A 5DUKA 2G4CA 5DEQA 1W5SA 3GXOA 4HX7A 4XBFA 2YHTA 2JRTA 1CF7B 1KMNA 1D8KA 1QF6A 2EAYA 2DTHA 1X56A 2L02A 1TNSA 1ZGAA 1K6OA 4C92F 2VT2A 4M75B 3G1ZA 4ENMA 4YRMA 3SFZA 2XAQA 4YFXF 3JCMd 1USTA 4XTUA 3V8KA 1FYFA 2Q8KA 5D5UB 5CJ9A 3C1DA 2EV6A 4G7OF 3HY1A 2ZNJA 4YRLA 5LRRA 3H3ZA 2Q5IA 4B09A 2O6GE 3ZMVA 4MHGA 3P9KA 4KIBA 2EJRA 3WU0A 1U5TB 3L2CA 4N9IA 1HSTA 3WTVC 3J80K 2NNNA 1T2KA 4ZYGA 2NS0A 2V1DA 4IRIA 4JK1X 4G94A 2JPBA 5H6RA 5GAN4 3FWEA 5D6FA 2HDCA 3WTYC 3L2ZA 2J5PA 1Q1HA 1SESA 4YDQA 1KYZA 3QSUA 3HSBA 3LAPA 2RHQA 3HRTA 3M8EA 4EMKC 1HK9A 3BZ6A 4J15A 4YRCA 3RKXA 4XTXA 5GAOp 1H9GA 5FB2A 1S7OA 1EQRA 4XTZA 2QENA 1XMKA 1HW5A 1U3EM 2K7LA 5F64A 4R79A 1JRIA 3RIRA 2ZZGA 3UGTA 2CJ9A 4M75D 4ENJA 4ZTZB 3HFOA 1ZRFA 1GGMA 1NJ1A 3UFGA 5CLSA 4EGYA 1FYMA 1YFRA 3DF8A 1B1BA 1OYIA 4JBAA 2W57A 1FC3A 1HBXG 5LJ5h 3GVAA 2L54A 2OQRA 2CIMA 1E17A 3GFJA 2ZNYA 5HOOA 1GXQA 1UFMA 4M77B 2OQGA 4AH6A 1IN7A 3D5LA 1RNLA 3QOPA 1XCBA 1I1SA 4PZJA 3VQYA 4YCVA 1YW8A 2XRNA 3WTUC 5HDGA 3K69A 4LD5A 1TNTA 5HS9A 3PQJA 1X2GA 4EM2A 2P7CB 4L9JA 1FOKA 1M5Q1 4M78C 2FBHA 4IF4A 2IP2A 3ISPA 2ADUA 3F8CA 4M78G 1S8NA 1R5HA 4HZFA 5LRSA 1BBYA 4G9YA 3EFRA 2XKPA 2L01A 2FXAA 5GAN7 1SMTA 1XCVA 1ZH5A 1S29A 1IF1A 4JRIA 2ESNA 4I0AA 3F8BA 4PHCA 4M6XA 4C8QC 3QPTA 2CGPA 3IKMB 4MEXF 4C8QG 4EGZA 2YR2A 3JCMg 5DY9A 3JB9G 4EJTA 4YRTA 2K4BA 2FYKA 4F7UA 4JUVA 1TQMA 5GANd 4CYDA 5BMZA 4PNOA 3SWNA 2D1HA 5K1PA 2F2EA 2VBZA 3QRFF 3MAJA 4YREA 3I64A 4H2UA 4KIFA 4M77D 2GA1A 3CDHA 2ZJ2A 4HYEA 5CYVA 1G3WA 3TEHB 3HFNA 1U1TA 4Z2YA 1BIBA 3FMQA 3EUHA 1G5HA 3ZMSA 1JE8A 1BC8C 1WPYA 3FIFA 3T8TA 1V3FA 3HOTA 4O6JA 2NYXA 1JXSA 4U0WA 3CMQA 3E5QA 5AIQA 1TQIA 1KOGA 1LNWA 1BC7C 2DU7A 4A2UA 3K9TA 11ASA 3GLXA 4HOBA 3ICAA 3P7NA 4Q15A 4BXUA 1FWZA 1BI0A 1XMAA 1KQ0A 5LLQA 5LGNA 4RS8A 2OAZA 4IHTA 3VBBA 4KR2A 1ZRCA 1WNLA 3GYHX 3NRVA 4A54A 3RACA 1SFUA 4S04A 3AHUA 2QHTA 3NQOA 4RQEA 3DP7A 2ALYA 1Z7UA 1IUYA 3RYPA 5K1XA 2DQ0A 3HHHA 4H2SA 2FA5A 4IPAA 3I7FA 4EV0A 2R7FA 4WXCA 2RNJA 2HKOA 1KU9A 2L3DA 2H27A 1E22A 3RUXA 5LGTA 4H2TA 3KFWX 1HTTA 2X4HA 3K2ZA 1MDMB 3HRKA 1QZYA 4LJZF 2QWWA 3P9IA 4M75C 4R8HA 1FYKA 3JCMh 4M75G 5CVUA 2CW0F 2HEOA 1NJ6A 3UH0A 3NEUA 3FXQA 4EJOA 3IWZA 2HFHA 3CTAA 1G51A 2Z5UA 1H4QA 3F8FA 4C92E 4ZYEA 3IRQA 2FU4A 3WGGA 2ZTGA 5LHIA 1U5TC 5ELNA 4M7AC 1CGPA 4J6XA 4P5OA 2PQ8A 2UXXA 4YCUA 4M7AG 3L00A 2X0LA 2RD1A 3MCZA 5F1RA 1I4K1 1YFSA 1JJCA 4ON0A 1W4MA 3F23A 3HYIA 1SD7A 5CVIA 1PP7U 3SZPA 4UP8A 1QBJA 1X3UA 2L4AA 2P4WA 4XLNF 2F5CA 1U78A 3HXWA 2P6SA 4E51A 1NJ8A 4LNSA 1IN5A 1KA8A 4IHSA 5A2QZ 1SRYA 2Q7GA 1P2FA 2EA4A 5K5RA 1EFWA 4HAMA 2D45A 3LQQA 1YCYA 3KLNA 4M9SA 2J3LA 1HQCA 2IY5B 2EJ9A 2QYOA 3KEQA 4ESFA 3COAC 1YO5C 4MGRA 3M7GA 1I8FA 3I0TA 3IG2A 4BHBA 4CS4A 1L3LA 4PJOF 1KU3A 4JRKA 2FF4A 2GZWA 3P8YA 4E70A 1UHMA 3K1PA 5LJ3d 4OU0A 4U7DA 1XGMA 2E41A 1B8AA 4UPAA 3JB9I 4M71A 1JJCB 2EA2A 2YU3A 2C6YA 5HVQC 4HF1A 5E1XA 2ZGWA 1BN5A 4Q48A 2EJFA 2DXTA 2XIGA 2RV8A 4BHCA 3M9AA 4O2DA 2DQLA 2YSRA 5FFZA 4RB1A 4JQFA 3HTZA 2E7WA 3HIFA 3FXUA 2CJAA 4P74A 4TVAA 3VB2A 3HSRA 2DPDA 2YLBA 1FY7A 4K2EA 1HKTA 2STTA 2EFNA 3BW1A 1R1TA 2K86A 1JHFA 2AKWA 1B9NA 3HFZB 4C8QA 4P9UA 4Q4ZF 2XAFA 4XTVA 5D6EA 3JAMZ 3KP7A 1DDNA 4PDKA 2QBYB 2ZKZA 4U7BA 2W24A 4K86A 2CFXA 3KP4A 3L7WA 3NENA 3R0JA 5E18F 3E9HA 1IN4A 1O7FA 5J8FA 4X9DA 3A31A 4ZZDA 2NNYA 4OMYA 3EETA 4RMFA 2V6CA 4EM0B 1R00A 5L3GA 3WQZA 3KCCA 5GANh 3F8MA 4HBLA 5ERIA 4TVYA 1O3RA 3O3KA 2HGCA 3C18A 3MF2A 3J80Z 3R6SA 2P5VA 3RJPA 2GWRA 2A61A 1K78A 3E97A 3KP6A 3VFZA 5BPDA 2K02A 5HGQA 3Q9SA 4LLGF 3QNEA 3PQKA 3V8JA 2Q2EA 5ILVA 1U6GA 3I53A 3B02A 4L0YB 5IT9Z 2DTOA 2I4MA 1IN6A 3HUGA 4H2XA 4N0BA 4P96A 1J9IA 3PCOB 2GXBA 5A2QK 2Y90A 4KQEA 4G6QA 3FZVA 1O3TA 3TOBA 1UHWA 4UVBA 3JCMJ 5ICCA 3SWNC 3ZMTA 4F7UG 2PLYA 2O8XA 1WQWA 1QGPA 3RGLA 1HW2A 5DD8A 4ZYDA 1CF7A 4RGSA 4IRHA 2VXFA 3FHZA 4LK1F 1R22A 4Y13A 1ZG5A 3LSQA 3T5XA 4OMZA 4RDXA 5HDKA 2VBXA 1ON2A 2RQPA 2W25A 1LNXA 5GMKe 1F5TA 4M7DA 2GAUA 2RKHA 2A68F 4AD9A 2EB7A 1T6SA 4DNCA 4H2XB 3O2PE 5E8GA 1IAWA 4F7ZA 3WGIA 1ZREA 4L9VA 2EV5A 2V9VA 2O0YA 4LLLA 1B9MA 3LA7A 1J5WA 2ZT5A 1XB4A 1JHHA 5H20A 3VU3C 2IVMA 4LG0B 1U5TA 1SERA 4CH5A 2D2WA 4XTYA 4TWAA 5GAMd 3F72A 1F9NA 2A3SA 3REOA 1WLEA 2FBKA 4I02A 3JTHA 1N9WA 1VQZA 4UVAA 5F6FA 4ZYHA 3JAMK 4QVCA 3GFMA 2RHSB 4EVIA 2G7HA 1QNTA 4M7DB 5D4RA 3SXYA 1XSXA 1Z7NA 4IRGA 1YIOA 1H4TA 1BBWA 3E6BA 5CVJA 3ZN1A 2F5DA 5L3EA 2IPQX 2KRFA 4CS2A 3REUA 5KVRA 3D0SA 1SD5A 2DW4A 4HWOA 2VXZA 5FLXZ 1SFXA 1C0WA 3RDIA 5DV5A 1ZRDA 4M78F 2CSOA 2I4LA 2PBIA 5JHUA 3P9CA 4ZH4F 1O3QA 4L5JA 2VONA 3BROA 3TEGA 3HY0A 1LQ1A 2W84A 2M30A 3RESA 3TQNA 3QUIA 2IA2A 2YX7A 4M77A 2WTEA 4B8XA 2AMCB 5LJ3h 5BQTA 4A6EA 2VOOA 4C8QF 1X55A 2ELHA 5IT9K 1G4DA 3BY6A 3J7AO 3JB9F 1D5VA 2ZT7A 5E17F 4PJOE 3JCMV 4P71A 4XLPF 3W3SA 4PGGA 5KK1A 2XASA 3JCMP 4M7DD 1PDNC 4KN4X 1R58A 4KA4A 1USYA 3L4GB 3QP6A 1FBSA 4KNYA 5LJ3e 2CO5A 3KE2A 2DJZA 3P8TA 1H4SA 5IT3A 1R1UA 4YYEA 1X01A 2Z9OA 1ZLKA 5FD6A 1R7JA 3M4GA 3M1EA 1QE0A 1QO0D 3HXXA 2QQAA 5LHHA 4P75A 3KEOA 1ASZA 2HQNA 1H9TA 2E10A 4RB0A 4HVCA 5LJ5e 3J81Z 5BPIA 1ODDA 1D8JA 4M6YA 1QZZA 3EDPA 4L87A 4L9NA 3TEHA 5GMKj 2COMA 3Q5FA 5GAMg 4I2OA 1HKSA 3RKYA 3RF1A 5GMKi 1FZPB 3IC7A 4P74C 5ELOA 1B34B 4HLXA 3SHFA 3QAHA 1T38A 3BJUA 3RKWA 2FBIA 5ICFA 3T0YA 5EEHA 1EH8A 3SQNA 1H641 4UP7A 2VODA 2XROA 1Z1DA 3L09A 4Y91A 2ZCWA 5KNNA 4P73C 1L0WA 1AWCA 4ETSA 4UVCA 4RGRA 4WK8F 4BQAA 3FF5A 1FSEA 4OIOF 4M75F 3FMRA 5DD4A 3CLOA 2PEXA 2J3MA 5ED4A 3K1NA 4HWRA 3MQ0A 1S7AA 3V7RA 3QO5A 1HXDA 3U2RA 2ZZEA 1D3YA 5FLXK 2K57A 5E3IA 3CUQB 4WXHA 2KJBA 1N9SA 1LDKB 4M9XA 2PMHA 2DVEA 4O3MA 2IW5A 3F3XA 2XAJA 3HRMA 4IVNA 2RN7A 4KFCA 4M7AF 2HS5A 3ABUA 4PJOB 4YRPA 3E5XA 2HOEA 2UXNA 1KMMA 4OLFA 3OD1A 4EO4A 3HOSA 2A07F 2DO7A 4CS3A 1MDMA 5CAIA 4YRNA 3K1MA 3L9FA 1NYQA 4LFUA 3I4PA 3GX4X 2HYGD 1RZ4A 1OYYA 2YPRA 2FMYA 5GAOl 4I7HA 3CO6C 3KFUA 4A5MA 2VC8A 4GGGA 1XGNA 3GUDA 4YIFA 1WRJA 4YRSA 4HDUA 1QPMA 2H09A 4X5OA 2E1CA 2E5AA 1A04A 5GAN2 2KIUA 4LGWA 5DYMA 2P0LA 1HKQA 2B0LA 3HSEA 4RGXA 3RERA 2MLKA 5HS8A 2CG4A 2MC3A 2M1BA 2Y48A 3LSSA 3E5UA 1E1TA 4EMSA 1LJ9A 1TW2A 1ZLJA 5GAMh 1NJ5A 2ZR3A 3CUOA 1ZYRF 1LYLA 2EFQA 3JSPA 3QU6A 2FSWA 2LF8A 4RAZA 1L0OC 4G8XA 4NB5A 4PGHA 2FRHA 3IALA 1LOJA 3NETA 2MLGA 1KQ1A 2M45A 3QO3A 4UNOA 4P3PA 3I54A 4M7DC 3GFIA 5C52B 2IT0A 4KMUX 3B73A 4K88A 4M7DG 2D1VA 5GAN5 4PJOD 3I5UA 2BYVE 1SAXA 3J81K 3M4PA 4M77F 3GZ6A 3E6MA 2IY5A 5ILUA 3EYIA 4WCGA 3E9IA 1SD6A 2OZ6A 1C0AA 3U1DA 3HXVA 3GO5A 5LJ5j 3JCMe 3WTZA 2KIMA 2ZR2A 1LVAA 3GFLA 2VOPA 1KQ8A 5GAOm 1PP8F 4H2WA 1GXPA 1ZN2A 4A6DA 2HKXA 2ZZFA 2MBFA 3V7SA 4PCQA 4WWCA 2RC4A 3A7UA 4M78E 4HA8A 2FNAA 3WG9A 2XKOA 5L3DA 3HSFA 2HTSA 4J6YA 3VODA 5H6QA 3JB9J 4QVDA 3IRRA 4H02A 1BJAA 4XU0A 4UXNA 5LJ5f 1N9RA 3ERED 2F5FA 2ZXJA 1IXSB 1USSA 3KP2A 5D5WB 3LA3A 2FEZA 1BI3A 4C8QE 4DPGA 3K0LA 3HFZA 3ZQ7A 1P4XA 1XD7A 3LAJA 2Q7HA 1RUNA 4KYWA 1I1GA 1YQAA 1Z9CA 1ZHFA 4KUMA 2QBYA 4CZZA 1MGQA 2J5OA 2OD5A 1B70B 4I09A 3JW4A 4A0ZA 4MQ9F 3DEUA 4L5IA 5ICEA 1FSHA 2I2LA 3RPUA 3BWGA 4Q5SF 4AWXB 4M77C 3LFKA 1HC7A 1O3SA 1EH7A 2ISZA 4M77G 1GVJA 4YP0A 4EJWA 4EM1A 1YLFA 4I98B 4EMKB 4NCXA 1FT9A 3GW2A 4HQMA 1I81A 1IW7F 3HHGA 2ZNIA 1LB2A 4CHUA 4P71C 2CQKA 2ZBKA 5K5QA 3BP8A 4F7UF 2A6HF 5HDNA 2HQRA 1WQ2A 5D8LB 4U0YA 4OIPF 1USYC 2HR3A 2ZNZA 5D5VB 3WTSC 4LLNA 2HZTA 3HTUA 2XGXA 2H94A 3KP5A 3QO8A 5C51B 2ZMEA 4H2VA 4P73A 2NAZA 3TO6A 4KIGA 3OV8A 2CGHA 5L3BA 2ARTA 2P6TA 4C92B 2VT3A 2BEOA 4P3NA 2L4MA 3PCOA 3ABTA 1YFHA 3WTTC 4P75C 1DUXC 1ASYA 3QHSA 4R1HA 2DZCA 1FP1D 4HDVA 4KR3A 3EQLF 2HYFA 3P8VA 2ARSA 2AXLA 1WKMA 2PG4A 4KICA 3IKVA 5LGUA 4BH9A 2PMUA 4KT5C 2JN0A 1DP7P 2ODRD 1IL2A 3DXJF 3CUQC 2QQBA 3DV8A 4QWQA 3BJ6A 1QQIA 2V1XA 2E65A 4M75E 2ZMEB 4YFNF 1MZBA 2ACJA 5GANe 2CWEA 4EMGA 3ECHA 1I6XA 2EWNA 3HFVA 1MJBA 1MKMA 1YG2A 1B7YB 1IRGA 3W6JB 1TQPA 4UV8A 2EV0A 1HW1A 2TDXA 4CH6A 2C8MA 2Q0OA 3IL2A 3I71A 5LEJA 1WWXA 1OYWA 1WI9A 2R7DA 4M7AE 4HLYA 4UUVA 1D3BB 1WSUA 4K87A 1TH7A 4LG0A 2O3FA 1OKRA 3H3UA 3ZN0A 2W85A 4C92D 2E3CA 1YW7A 2Q5HA 1EV7A 4WJ3M 1V4RA 1E24A 2LF7A 1FLIA 4YROA 5DDGA 3CO7C 2QQ9A 4MNUA 1F1ZA 4RAYA 1PYSB 4EQQA 2RHSA 1U8RA 2AS5F 2ZIOA 1FX7A 1Z7MA 2H6BA 2DU9A 3C3WA 4P9FA 5E8IA 2E7XA 3JCMf 2HWVA 2DAOA 3HXUA 3PFIA 4HW0A 3RL6A 1I5ZA 4H2YA 1J0RA 3H92A 4FX4A 2ZFWA 2XTIA 2DLLA 5AONA 3R60A 3DPTA 1BI1A 5F5WA 2H6CA 1LDJA 4GXOA 2JZYA 1ZG1A 4CDGA 2M87A 3M8FA 1FPQA 1BIAA 1S3JA 2JPCA 5CVVA 4L9TA 2EFWA 1J7KA 1XSDA 3LWFA 2XV4S 4HX4A 3IWFA 4MMLA 3EYYA 2ARUA 4CICA 1ADJA 1G3TA 2GQQA 4FT8A 2ZIMA 2K27A 3MWMA 2WV0A 2P5IA 2QHVA 5EEGA 2AMCA 1TTYA 1XN7A 3C7JA 4MMKA 1JBMA 4CXFA 2MA3A 1YFTA 3VQXA 1RUOA 4WF2A 1ATIA 2EK5A 4XTWA 2G7UA 1Y0UA 3FM3A 2XHKA 2C7IA 3IKLA 4AIKA 4ZTUB 3AAFA 1DPUA 2VE8A 1MJ9A 3JTGA 1YS7A 4ASNA 4BWAA 3L4GA 3W6KB 4IXAA 4FX0A 2P5LC 2BE5F 5JFRA 5DUIA 4G7ZF 5FGMA 4ENKA 4M9ZA 1W7PB 4X9CA 4L0ZB 2RA2A 4A0XA 3KZZA 5LBQA 2VBYA 2DK5A 3HRSA 3MEYA 4WXDA 6PAXA 3S2WA 1FBUA 5TRDA 2QHSA 2M5WA 4UP9A 2I4OA 4BHPA 5DCMA 4M7AB 3A7RA 3IHUA 1Y96A 1OR7A 4J5YA 2VBWA 4P72C 4M72A 4J6WA 3FJPA 2KIFA 1YB3A 4QLCU 1MGTA 1G3SA 2PMEA 3QP5A 1G6NA 3JCMc 4YRKA 2HTJA 2DBBA 2WC2A 5LHGA 2R3SA 4ENNA 2PN6A 2PMFA 2DU5A 3V8LA 1Z6TA 4CO8A 3ML6A 4HWSA 2DTIA 5GANj 2ODRC 1BI2A 1YW9A 1Z05A 4ESBA 2STWA 2RDPA 4CH4A 4HWPA 4EJUA 4ZZLA 1B34A 1NYRA 1T39A 5J6XA 5FO5A 5GAN3 4RB3C 2PJPA 3HRUA 1RIQA 3LQRA 5HS7A 2XGTA 4AIJA 2A69F 2Z3YA 5HLHA 4AIHA 3E3VA 2VXEA 2LSOA 2GXGA 1W7PD 3PZCA 5DCMB 4L18B 1Y96B 1FYLA 4F7UE 2Z33A 2DTRA 1WYDA 3TGNA 3OOPA 2YX4A 4RGUA 1XGSA 4ESJA 5GANf 5K5OA 1B59A 5GAOr 4A5NA 3JSOA 3VOEA 4C92C 4OOIA 4N0AA 1BBUA 3F6VA 4M7AD 3TDUC 4JLIA 3TO7A 4C92G 2RHQB 1I27A 4U88A 3ZP5A 1ZG3A 4BW9A 3JCMX 3GWZA 4OIRF 1OPCA 1E1OA 2A5YB 3ULQB 2ZT6A 3CUQA 5E1ZB 5GAN8 4G85A 4MTEA 3CJNA 1Z6RA 4XEOA 1NHAA 4BYYA 4PJOA 4YRRA 3HTSB 3FMSA 3N4MA 3BJAA 2DEQA 4M74A 2VE9A 2EFPA 1W66A 2FOKA 2NRAC 4WI1A 4I0BA 3EFSA 2QUFA 4HV6A 2O61A 3UGQA 5L3CA 4XQ3A 3NEMA 1EIYA 4G6DA 4M7DF 4KN7X 3MZYA 2Q7EA 5I21A 4KMFA 1NNHA 3TO9A 2UWMA 2VC0A 4XSZF 5GAOq 3R61A 2FMLA 1B6AA 1HSJA 5JVTA 2E1HA 4OINF 1EVKA 1S6LA 4U0VA 3ZMUA 4D0PA 1KU7A 3FX3A 3SB2A 3VQWA 4M73A 1TBXA 3INZA 1LEAA 2ZT8A 3HXZA 1ADYA 4TVWA 4V2SA 3TKYA 3N97A 4P3OA 1O7LA 4YRJA 4FHTA 3IKTA 1KQ9A 4HV5A 2XAGA 3WTWC 1GHCA 3WE2A 1PUEE 1YTYA 3TOAA 3MF1A 1EIYB 4Q47A 1U2WA 1H0MA 1KQ2A 3RPQA 3R07A 4GYIA 2Y75A 3GF2A 1TLHB 2DKGA 4YPFA 2ETHA 2M8EA 2G9WA 1J5YA 2Y0MA 1MJAA 1XGOA 4F7UB 3MZHA 3ERRA 3SWNB 4NL2A 4HWTA 3F22A 3QTCA 3KP3A 3ELKA 2QTXA 3TDZC 4OIQF 2P8TA 4IJAA 3LC0A 4H0EA 3F6OA 3NELA 5L3FA 5LJ3j 4DQ2A 3GZ5A 4G84A 4EMHA 3KZYA 2LNBA 12ASA 1REPC 5GAMe 1T0FA 1MD0A 1LJOA 3JB9H 3DPLC 1UB9A 1U1SA 3F21A 1XSVA 5D8KB 4Q6GA 4CH3A 2BGCA 2QZ8A 2OU2A 2YLCA 4YRQA 4Y17A 5D5XB 2LKPA 2DPUA 4N9HA 1K79A 2FB7A 1J75A 2DQRA 5LJ3f 2EL9A 1IXRC 1B70A 4P72A 1R23A 5BOXA 2PI0A 4BNCA 4LB6B 1XDUA 3JCMW 2ALYB 4G7HF 3T1BA 5GAOn 2OA4A 2JT1A 2QM3A 1IXCA 2V79A 4YCWA 1DPRA 3SZTA 1X2HA 3G73A 2KKOA 5K1YA 1AOYA 3G3ZA 1R5GA 2FNPA 2K4JA 4EMKA 2CJBA 4MQVA 1K7AA 4NHJA 3JCMQ 3V7CA 1IN8A 1KGSA 2OBPA 4WJ4A 3WE3A 3LSTA 2IJLA 2DZ9A 1B4AA 3DQVC 5HLIA 4UV9A 2IA1A 1WU7A 4Y15A 5GANg 1J2XA 2DT5A 2QLZA 4HX8A 1M8VA 2JTVA 4YRGA 3ZMDA 3HRIA 2WWYA 2F5EA 3A32A 4NL3A 1BOAA 1ZGJA 3BDUA 1KYWA 2DK8A 2RVCA 5TJJA 4HF2A 3FM5A 2RGVA 4C92A 4XU3A 5LEKA 1RI7A 2ZXFA 1JGSA 4PG3A 2I4NA 1XDSA 4KDPA 5E20A 3BOQA 2XVCA 2P7VB 1P92A 5AIPA 2LDUA 5ILSA 1ZARA 1P6RA 4YRFA 2XAHA 4GO1A 3R0AA 3MFKA 3WU1B 3BPVA 2EFOA 4GYGA 2ZO4A 1UCRA 1P4WA 2QHUA 4MEYF 3KLOA 3DSQA 4XSXF 1I5LA 4M78A 1IRFA 4A53A 3BY7A 3F8NA 3O6BB 3BFMA 4TTVA 1STZA 3A7AA 4EX5A 3BPXA 1R36A 3ZPLA 1H4VB 4YIIA 3M4QA 2IRFG 3T8RA 1X54A 5LJ5d 1G3YA 1RIOH 4XU1A 5FFXA 3GIBA 3DKWA 4S05A 1B7YA 3BDDA 2VN2A 2GIVA 4YFKF 4RCBA 1ONVA 5C53B 2BV6A 4I01A 5DCFA 2DDZA 1W5TA 2UZKA 1SMYF 1FNNA 1TW3A 3WTXC 4ZIBA 3E6DA 1D3BA 1O57A 4OP0A 3VEPA 2BBYA 2HNIA 2VC1A 4N0AC 1OMIA 2O03A 3BJOA 3QPHA 4YG2F 2EJGA 3FB9A 1J59A 4RCCA 2ZINA 4A0YA 3PGGA 1FP2A 3A5YA 3E6CC 4TQDA 5HLGA 3RI4A 1YS6A 4LB5A 3I59A 3L1AA 4M78B 4M7DE 5E1WA 4BAYA 4A12A 5GAN6 1NJ2A 1PYSA 2DQ3A 1EH6A 5GAMj 4HQEA 3A5ZA 3R4KA 4TVAB 3TUPA 1KU2A 1ULYA 1VTNC 1LEBA 4GCVA 4O5VA 2DXUA 5FD5A 1P4AA 1EVLA 4PJOC 2MD5A 4EJVA 1SD4A 4TV7A 4WX9A 4PJOG 1BM9A 5JI6A 2PFBA 2AKWB 5GMKl 1G5IA 1E2XA 4C8QB 2ZCEA 2E64A 4RB2C 1Z91A 3MEXA 2RB6A 3QU3A 3ECOA 3KETA 3A74A 1YYVA 1SETA 2GA2A 1WQ7A 3I58A 5GAMf 3VQVA 1F4KA 3V4GA 3RYRA 4HT8A 4CGZA 1B76A 4UHTA 2FQ3A 4RQFA 2OZUA 4LMYA 2Z99A 3I59B 2A6EF 5GMKh 3ROUA 2IA0A 4HF0A 2ISYA 2ESHA 3LA2A 2DFIA 4NOYA 2RM4A 1T98A 2V1UA 1R1VA 4XU2A 3RTRA 2JSCA 3JCMb 1K78B 4XRFA 4M78D 1YGBA 1SFEA 3HXYA 5J8CA 4AVPA 3ZMZA 2FE3A 5LJ3g 3DFGA 5JR3A 2DI3A 4NQWA 4YRIA 4MTDA 1ZAOA 1LDDA 1EOVA 3FXRA 2MH9A 4M75A 3GEZA 2P5KA 5CVRA 1W7PA 1FBQA 2QVOA 4TQFA 2E1NA 4XEMA 1IZ1A 1ON1A 5D4SA 4P55A 2KJCA 4C8QD 2MH2A 4LK0F 2CYYA 5ICGA 3JB9D 4HT9A 3WODF 4M77E 3QO7A 3WGHA 5GMKm 3Q9VA 3REXA 3U9GA 2XUBA 5LJ5g 4M7AA
chains in the Genus database with same CATH superfamily
2HOSA 2G4CA 2LCCA 1QVFP 4IHWA 4LDYA 1W5SA 3HTRA 1KMNA 1VQLA 4Z88A 2JVGA 1PNJA 2NUPA 5B66C 4CCOA 3VS4A 3OSSC 3BTLA 2BTTA 1QVTA 3G1ZA 4XRMA 3JCMd 1W0UA 4RTTA 1Y7XA 1FYFA 3ER0A 1Z9ZA 3C1DA 2EV6A 4IZZA 1VQ5A 3H3ZA 1TUCA 2EJRA 2E2JJ 2M7BA 4FE4A 1HSTA 4PJJA 3S6WA 2NS0A 4JK1X 2AHQA 5D6FA 1G83A 3IQLA 4YDQA 3QSUA 1KQSA 3M8EA 4X1EA 3CCRI 1UE9A 2VKVA 4J15A 5TISC 3RKXA 1NTCA 1VUBA 4D5CA 1W36D 2K9LA 1U3EM 1B8IB 4PSWA 2K2VA 5E3MA 1NJ1A 4EGYA 1YFRA 1S72T 2OUMA 4ZYAA 1OYIA 3H9QA 4JBAA 3CPWS 4IX7A 2PJRA 4C2UA 1A6IA 4B48A 2VKEA 1IN7A 3QOPA 5FLVA 3S8PA 2PUOB 1AWWA 1YW8A 3WTUC 1ZSZB 1TNTA 2HL5C 3PQJA 3LSRA 4EM2A 1FOKA 2JW4A 4M78C 1VQMI 4IF4A 2ADUA 1S8NA 3FXKA 2EYQA 2RHUA 3UA6A 1BBYA 4BB7A 2WY8Q 1XCVA 1XQHA 4I0AA 4M6XA 3TL4X 3E7LA 1OU8A 2XDPA 2CGPA 4MEXF 1Y1VJ 1I0CA 1VQPI 1KHCA 3QWLA 2FYKA 4BACA 1T33A 4CYDA 2HQXA 3MAJA 3I64A 3P8DA 3M4OJ 3TEHB 3HFNA 3CCRT 2QASA 1U1TA 1QQJA 1BB9A 3KFVA 4DZJA 2HQEA 2XAUA 5M5YJ 2L9VA 1JE8A 4O6JA 4IKFA 4CC3A 4CYCB 5AIQA 1W2BS 1KOGA 1BC7C 2DU7A 3WVDB 5KE3A 3GLXA 3W2VA 4FYVB 4Q15A 2RI5A 2KVQG 4RS8A 2JM8A 3VBBA 3GYHX 4A54A 2M9HA 2QHTA 2ALYA 2PVGB 1WPKA 2VQCA 2FA5A 1N8RC 3I7FA 1A5JA 1KU9A 3S3NA 4C0GA 2L3DA 3GF5A 1Y8RB 3JCUC 3CXCS 1VQMT 5CKEA 3IV5A 3M0RA 2LJ3A 4RMNA 1QZYA 1TWAJ 4M75C 4R8HA 2ZJPF 4RAGA 4JJNK 1FYKA 3UH0A 4EJOA 3IWZA 4A3EJ 4BJ5C 2Z5UA 4C92E 4LVJA 2GIZA 3IRQA 1VQPT 2Y31A 3WGGA 2ZTGA 4V2GA 3LH5A 4M7AC 1JI8A 1CGPA 2PQ8A 3MCZA 2CZ1B 1I4K1 4C5EA 3F23A 1PP7U 4UP8A 3JRAA 1S72Q 2BW3B 4NS5A 1NJ8A 2O88A 2R7WA 2DPPB 1SRYA 1SEUA 1EFWA 1YCYA 5K7FA 2J3LA 4LVMA 2KMTA 3KEQA 5C6SA 3WU2C 3I0TA 4BDYA 4PJOF 3P8YA 4E70A 4IUTA 1UHMA 1M2VA 4OU0A 4CH7A 3DLLF 1JJCB 2YU3A 3HHTB 3M4YA 2L0AA 1TS9A 4C5IA 2IEKA 4Q48A 2EQIA 2DXTA 2RV8A 1OCZH 2F4MB 3M9AA 2YSRA 4OMOA 3ZCOA 5JLXA 3CC2I 3HTZA 3JRFA 2CJAA 4TVAA 3CMEI 3UATA 4Y3OA 2QQSA 2HXOA 2EFNA 4CC4B 3BW1A 2E5KA 2AKWA 2K3XA 5JHFA 3MKDA 4GLMA 4C8QA 2XAFA 3KP7A 2ZKZA 4LXCA 3CCRQ 3KP4A 1QVGS 2CQXA 3URGA 5M5WJ 3OR2C 3NENA 3R0JA 2PQWA 3GTOJ 3GNGA 3A31A 2NNYA 1K4SA 1WJFA 1FMVA 2QEXI 4TVYA 3V42A 1ZR4A 3O3KA 2QSHX 2JUGA 2DILA 3G2BA 3RZDJ 4D5FA 5F0FA 3E97A 3KP6A 2DIQA 4J9BA 4LLGF 4KRTA 2Q2EA 4BBRJ 5ILVA 1ACMB 1SANA 2AK5A 3HUGA 2VJIA 1HA8A 2GXBA 4NBQA 4DGWB 1VQMQ 3ZMTA 1WQWA 1QGPA 3FK6A 1E0EA 2ELJA 3OS1A 1D1BA 2RK1A 2KEAA 1ON2A 2RQPA 1LNXA 3CMET 1IDZA 2RAEA 3Q0UA 4FT4A 1VQPQ 1S7EA 1RAAB 5E8GA 1IAWA 4E7IA 2RJFA 2O0YA 3DTEA 1B9MA 3OYJA 5EZHA 4P5NA 3HPWA 4XKVA 2AXTC 3C94A 2M8GX 2AO9A 3PUFA 3REOA 2L9SA 1N9WA 4UVAA 3QQAA 3JAMK 3S2DJ 2WAQA 2KAFA 4EVIA 2QEXT 4ZTFA 2QA4I 4M7DB 2DJQA 2FPEA 4IRGA 4BUGA 1H4TA 4LUDA 3ZN1A 3CBMA 5L3EA 1LFBA 3E2UA 3F70A 1WGSA 1IJWC 1H92A 4RBOA 1AU7A 5F27A 3QYFA 2LP5A 1ZRDA 2L7MP 1AWJA 3WXMB 4ZH4F 2FPFA 1LQ1A 2YX7A 2DERA 5LJ3h 2ELHA 5IT9K 9ATCB 3A01B 3G71A 1N25A 5DLQE 4P71A 3K4NA 2O01E 2XASA 1J09A 3M0QA 1R58A 1EKEA 2D8HA 3L4GB 4KNYA 5LJ3e 1HJDA 2M0CA 2DJZA 4CSWA 1TU0B 2H8WA 3M4GA 5HNHA 2F5KA 1JT6A 1M1GA 2VKHA 3KEOA 1K1ZA 2HQNA 2E10A 1RAIB 3SDGA 4BY6C 4FISA 4M6YA 1QZZA 3CQTA 4E6RA 2XSJC 1QLYA 4HSTA 4L87A 3TEHA 2COMA 2MYSA 1A0NB 5GAMg 1YCSB 2DT6A 3IC7A 3VDXA 3SHFA 1T38A 2FBIA 3S16J 1NG6A 3L09A 2E5QA 2OI3A 1AWCA 2YU9J 1XTDA 4WK8F 3HPGA 3ZOBA 3CC2Q 5DD4A 3CMEQ 1QU3A 2PEXA 4RKUE 1NE8A 4HWRA 3QO5A 2H3EB 1MBEA 2LH9A 4IHXA 1X27A 5FLXK 2K57A 4QQGA 2KJBA 1LDKB 1VQ8T 3HRMA 2HS5A 2LJ0A 1G2HA 4CCNA 3BZCA 2UXNA 3P5JA 4OLFA 4M3BA 4EO4A 3HOSA 1WIEA 5CAIA 3L9FA 1WXBA 4LG3A 3I4PA 1OYYA 2YPRA 2FMYA 3KFUA 5EF6A 3L2VA 1LVKA 1VYTA 2QEXQ 1QPMA 2H09A 3MO8A 4X5OA 4ZGDB 3GBQA 5DYMA 3M07A 3HSEA 2CS7A 2EIMH 2M1BA 3E5UA 1E1TA 1OYXA 2CSQA 3CUOA 1ZYRF 1LYLA 2EFQA 5DM7F 4NB5A 1PRLC 2BE9B 4WCIA 4KJZA 4DJAA 4C3IJ 2BW3A 4UNOA 3GFIA 5C52B 2IT0A 3PFSA 3EGDB 3WHBA 1VQ9T 2ME6A 2BYVE 1SAXA 2LQ8A 1WJDA 5I11A 3MEVA 1WJQA 3CCMA 3E9IA 4XK8E 2JVVA 4JS5A 1K0XA 4QQDA 1OCTC 3WTZA 4KGXB 2VOPA 1KQ8A 5GAOm 4XLEA 2LVSA 2ZZFA 2MBFA 3BTJA 2ZPEB 2JOYA 2LKSA 1MUZA 2RC4A 3OB9A 3GPLA 3OYKA 2FNAA 1KFZA 4ZC3A 1M90U 1Z77A 2OX7A 5J47A 2XKOA 2HTSA 4ZN3A 1VQ6T 4J6YA 5IOYA 3JREA 3VSLA 3M0TA 1WHMA 3G1LA 2RQWA 4H02A 4IQJA 1N9RA 1IXSB 1USSA 2EFIA 1R5ID 2VB6A 1BR4A 1YX5A 4DPGA 2QCOA 2DBMA 3ZQ7A 4MZMA 1Z9CA 1MGQA 4DYCA 2QA4Q 2HPIA 5KYXB 3JW4A 5FRMA 4MQ9F 5ICEA 1FSHA 2COWA 4Q5SF 4ZGJB 3SJMA 3ASOH 1EH7A 4EM1A 1KG1A 1FT9A 1U5SA 1I81A 4FL6A 3OQ5A 1Y71A 2P81A 2CQKA 5K5QA 2J6FA 1WQ2A 4U0YA 2EIKH 4AUXA 1I3AA 3EUKL 2ZNZA 3WTSC 3CCVI 2HKQB 5C51B 4F55A 3M0PA 4IHVA 1K76A 2YUSA 3TO6A 2M1HA 2CGHA 4Z89A 5L3BA 3GMEA 4J7FA 3ZQIA 2XGCA 1XS9A 1AWOA 5KYUB 3X26B 3OL4A 2P6TA 2K3PA 3CMMA 2L4MA 2L3SA 1D0YA 4AG1C 3WTTC 3TREA 5CR2A 5I22A 3P8VA 2AXLA 3O8GA 4DYRA 2PVOB 1WKMA 2PG4A 4KICA 2A8EA 1PG5B 2IG0A 4XKWA 2QQBA 3BJ6A 2V1XA 2E65A 2ZMEB 2IGKA 2OJED 1MHNA 3OYHA 2DD5A 4IHYA 2Y4XA 1YG2A 3W6JB 1M90R 1X19A 4UV8A 2TDXA 3KPHA 3CCQI 2C8MA 2Q0OA 4BKXA 1ZGWA 4HLYA 1D3BB 1TH7A 2MK5A 1P7IA 3BT9A 4C92D 2E3CA 3QBYA 1EV7A 5HKCA 1YI2I 2JJ9A 2WY7Q 3PT9A 3CBOA 3CO7C 2LR8A 2M2EA 1F1ZA 1WFWA 4RAYA 1U8RA 2KHMA 1FX7A 1Y0NA 3C3WA 2HKNA 2NVTJ 5E8IA 2HWVA 2DAOA 1MMGA 4H2YA 1HCRA 4ZTJA 1YJWI 1PKTA 4BL0B 4A3GJ 2ZFWA 3CCVT 1K4US 2A08A 2CREA 2R5ZA 1O4XA 4BE2A 4CZCA 1MSEC 4CDGA 4LDVA 5C0MA 2ATCB 1FPQA 1S3JA 1S1NA 4L9TA 2Y9ZA 3LWFA 3IWFA 4MMLA 3EYYA 2GLOA 2HAXA 1Y1WJ 2V7FA 2WV0A 3MWMA 2P5IA 2QHVA 3RNJA 2LX9A 2K85A 1JBMA 4RG8A 3A01A 1JT0A 3S17J 1ATIA 1A6QA 1V5GA 4ITVA 3S2HJ 4XTWA 2C7IA 3IKLA 1YFNA 4IIMA 3VS7A 2WSEE 3QYHB 4NQWB 4BWAA 3L4GA 3W6KB 4J00A 2E1MB 4FX0A 1OPLA 1W7PB 4X9CA 3VYTB 2RA2A 3CCQT 3KZZA 3PJRA 3HRSA 1OX8A 1BL0A 4ANJA 4F17A 2VJJA 3E19A 3LFUA 5DCMA 1Y96A 2E19A 4M72A 1YI2T 2PMEA 2XU8A 3QP5A 5EG2A 3MJXA 4YRKA 3R6OA 2R3SA 4ENNA 1WA7A 2PMFA 2MGQA 1YHQI 4HWSA 2ODRC 2STWA 2JVHA 3HOUJ 4EJUA 4ZZLA 1YJWT 1CSKA 5K7ZA 2RQUA 5HCKA 1T0HA 2KZVA 2XHCA 1IRXA 2A69F 4BEHB 4JP0A 4L5EA 1K61A 2HQ5A 4F7UE 1WYDA 2YX4A 2KP6A 4QPQA 1XGSA 5CCAA 4A5NA 1WHLA 1WCMJ 2DXIA 4M7AD 3ZR8X 4C92G 2RHQB 3JCMX 2JA6J 1WJAA 1E1OA 1OPCA 4R0KA 1TWHJ 2ZT6A 5E1ZB 5GAN8 4G85A 4GFBA 2KROA 4XEOA 4BYYA 2CYZB 4HCZA 2WSCE 3EHRA 1JO8A 3BJAA 2NRAC 3RSNA 1JKRC 1K73U 4XQ3A 4AT1B 3OS5A 4XSZF 5CQYA 1MBKA 2E1HA 4OINF 3LL7A 1K9MU 3ZMUA 4D0PA 2DFHA 4V2FA 1AVZC 1TBXA 5KYYB 2EYXA 1ADYA 4QVZA 2AHJB 4TVWA 4V2SA 3OBYA 1O7LA 2L9RA 4DOVA 3IKTA 3LWHA 4HV5A 2GTJA 1GHCA 3EGDA 3A0HC 4Q47A 3RMSA 1H0MA 1GL5A 4M3DA 3RPQA 3R07A 4GYIA 4JJDA 2ETHA 2G9WA 1M90C 1XTAA 4F7UB 3ERRA 5FU6B 2X6OA 4HWTA 4L6V5 1TUGB 3MEAA 1NLOC 4Y28E 4ZDPA 2RH2A 2DA7A 2D5VA 2OTJT 3KP3A 3BQYA 2BXYA 1N78A 4IJAA 5L3FA 3FC3A 2JK3A 1BOBA 3CCQQ 4MFEA 5HODA 3KZYA 5GAMe 1T0FA 1UGQB 2ZXIA 1IDYA 3D7SB 3BC8A 1UB9A 4FW2A 2JRMA 2IS1A 2VV5A 5D8KB 1ZQ1A 2VASA 2BGCA 1VQKA 2YLCA 1YI2Q 3F0CA 2DD4A 2DPUA 4N9HA 2FB7A 1J75A 2DQRA 4P72A 5BOXA 2PI0A 4LB6B 4G7HF 3T1BA 5GAOn 1RETA 2OA4A 2JT1A 3CJRB 1IXCA 4LIVA 1MV3A 1DPRA 1YJWQ 3ME9A 1AOYA 1R5GA 1ORKA 3GTMJ 1K7AA 5FLMJ 1IN8A 4WJ4A 2OTLA 1CQTA 1B4AA 5HLIA 4UV9A 2HVSA 2DMQA 4C5HA 3TEDA 2PNIA 4B6MA 2QLZA 4HX8A 2K5IA 5KHDA 3W2AA 3ZMDA 3BG3A 3CCYA 1ZGJA 3M1CA 1KYWA 2DK8A 4HF2A 1WXTA 3QJYA 5KYUA 1EA3A 4XU3A 1Q1VA 5LEKA 1JGSA 4PG3A 1XDSA 1OZ3A 1R0BG 5E20A 4XLHA 5ILSA 1J3TA 2J6OA 3IH2A 2GM4A 2DBKA 3G4SA 2LBFB 3IAM2 5E79C 3I55A 3CPWA 4MEYF 4XSXF 1TL8A 2E60A 4BE0A 1IRFA 1IXDA 2QQ8A 1F1BB 4KITB 4EX5A 3AG1H 3M4QA 1G3YA 1VNDA 4S05A 1X1BA 2DDBA 4E7SA 2QQRA 4IEJA 1ONVA 3LOCA 1UJ8A 2UZKA 2NVYJ 4ZIBA 2EIJH 1D3BA 3BE3A 1YHQQ 2HOAA 2BBYA 3QZ5B 4DBRA 2EW3A 3H36A 1U9OA 4OVAA 2EJGA 3VUBA 4A0YA 3A8LB 4I6ZA 5HLGA 1YS6A 3I59A 4M78B 4A12A 3S1MJ 1NJ2A 5GAMj 3EH1A 1ENHA 4BXFA 4XORA 1VTNC 3LGFA 2DXUA 4PJOC 4EJVA 4TV7A 4B9WA 5CK9A 3FXLA 1BM9A 3K2AA 5GMKl 3CC7A 1E2XA 4AFSC 1N77A 5CO7A 1Z91A 2RB6A 1ZLMA 3ECOA 1YYVA 5GP9A 2GA2A 2F4OB 2RHZA 3DWLE 3I58A 1U06A 5GAMf 4UHTA 2EGCA 3CCJI 1YNZA 1C6VX 4HF0A 3A5ZB 4B44A 1W2BA 1OULA 2O7OA 2RK2A 2DFIA 2V1UA 4MFDA 2JSCA 4DEXA 3HXYA 3ZMZA 2HI3A 3DFGA 4NQWA 1G59A 1ZAOA 1LDDA 1YE9A 3DBLB 3GEZA 3A02A 1FTZA 1W7PA 1FBQA 3CCLA 2QVOA 1ON1A 3SD4A 2NOGA 3Q0VA 4P55A 4ME7A 2KMUA 2ME0A 4LK0F 5ICGA 1EZZB 4M77E 3QO7A 4C3JJ 3Q9VA 2ID3A 2XUBA 5BS6A 1GBQA 3M59A 3H5NA 2H3JA 4HX7A 4XBFA 2JRTA 1CF7B 1RI0A 4Y92A 1D8KA 1QF6A 3FDYA 2E3HA 2K3BA 2DTHA 5K7HA 5KCHA 5FW9A 3PIPA 1K6OA 4X0GA 4C92F 2HEQA 2VT2A 3DEEA 3J81E 4M75B 4ENMA 2CH4W 4YRMA 3SFZA 4YFXF 1USTA 1M1EB 3V8KA 1QCFA 5CJ9A 1QW1A 2CJJA 4G7OF 4N4IA 3HY1A 4DOZA 2ZNJA 4F91B 4YRLA 2A7YA 2O6GE 4UC4A 3P9KA 4KIBA 4BEHA 3CZ6A 3S3OA 3NMZC 6AT1B 4N9IA 1D0XA 3WTVC 2PZ1A 2NNNA 1T2KA 4ZYGA 2CQ7A 1SC7A 5H6RA 2Y2ZA 2JTEA 1FEXA 3LSHA 2HDCA 3WTYC 3H0FA 2BZXA 1Q1HA 2P0KA 1KYZA 2RHQA 3LAPA 3I56I 3VS5A 2JN6A 2LC2A 8ATCB 4PSXA 1JXOA 2LX7A 4YRCA 4XTXA 3S15J 1EQRA 1WX6A 5F64A 2DDAA 1JRIA 1IG7A 1VQ4A 4FU6A 3UGTA 1LUJB 1ZRFA 3UFGA 5CLSA 1FYMA 2OAUA 1B1BA 2C0TA 4UB8C 1HBXG 5LJ5h 3GVAA 2EYZA 2QYZA 3NTIA 2EIFA 2OQRA 1OV3A 5CKBA 2XSDC 3GTGJ 3HOZJ 3OYAA 3QXEB 2ZNYA 3W3CA 2CRGA 4M77B 4PZJA 2EGEA 1YBYA 2KGTA 1WI3A 2LP0A 5IP7J 5KYYA 5GTHC 3BTIA 2Q1ZB 2EVRA 1M5Q1 1LKXA 2LNVA 1QVGA 3F8CA 1YWOA 2JSPA 5LRSA 4G9YA 2LKXA 2L01A 1W1FA 1K8AR 3ABKH 2ESWA 2HBWA 1IF1A 4BUPA 3F8BA 2ZSIB 2YR2A 5DY9A 4B1RA 1FOWA 4EJTA 3ASKA 2K4BA 5GAGJ 3AL0C 4F7UA 4JUVA 2LCSA 5BMZA 2LZ6B 4PNOA 2VBZA 4YREA 4H2UA 4DYQA 2ECCA 3I56T 4A63B 5JVGF 1GCQC 3EUHA 1G5HA 2M7AA 3ZMSA 3FIFA 2FZGB 1VA7A 1JXSA 4FW1A 1LNWA 4XOPA 2ZCFB 2Z2SB 5EZGA 4HOBA 1BI0A 2XPWA 1RADB 1XMAA 1KQ0A 2OAZA 4KR2A 4S04A 3AHUA 4LD6A 1JJ2P 3NQOA 2CS3A 3DP7A 4XR6A 5K1XA 1K4TA 4A69C 1ZBJA 4GY5A 2DYSH 2GF7A 1W36C 1PJRA 4II3A 2LD5A 3AFHA 4LJZF 2QWWA 3P9IA 1DP3A 5LFAA 3CCJQ 3JCMh 2P4RA 3QYGB 5CVUA 2CDTA 2KRCA 2CW0F 3MP6A 5L23A 3CTAA 3SYTA 3F8FA 4ZYEA 1OCOH 3EFOB 2DA9A 4HVWA 1QVPA 2CP5A 2UXXA 2RD1A 1GV2A 1YFSA 1SD7A 2WSFE 2LBFA 1X3UA 3BR3A 2P4WA 1U78A 3CMAA 5EC7A 4E51A 4XKCA 4LNSA 1TZLA 1KA8A 5A2QZ 2EA4A 3EG9A 5K5RA 1M8MA 1VQ5Q 3G6EA 4L5GA 1KHIA 4M9SA 2R58A 4DOWA 1RLQC 5GTIC 5IYCJ 3COAC 2HVQA 1YO5C 2X48A 2DTZA 4MGRA 3M7GA 1I8FA 4BHBA 2LMJA 2LQWA 4CS4A 3PO3J 4JRKA 3L2RA 2EH3A 2YDLA 4KBMB 3K1PA 1XGMA 3JB9I 2ZJQF 3PTAA 4OB2B 1YRNB 2EA2A 1LPLA 5E1XA 2RJDA 2ZGWA 2EJFA 2XIGA 2DQLA 3BG9A 2HZDA 3M8JA 3PVQA 2E7WA 4D1QA 4P74A 3VB2A 3DB3A 4K2EA 1ARKA 2STTA 3QWYA 2V9PA 1JHFA 3HOWJ 1I3QJ 4P9UA 4XTVA 4PDKA 4U7BA 3SEMA 3I56Q 2R7VA 4CCJA 2CFXA 4UUSB 2CT4A 3H5RA 3L7WA 3QDRB 1HDDC 5H2FC 5LD2C 4ZZDA 3A8OB 4UUTA 3EETA 4RMFA 4EM0B 5L3GA 3F8MA 4HBLA 5ERIA 1O3RA 3LSKA 2JA7J 4Y4RA 2HGCA 3C18A 1BW5A 2P5VA 3RJPA 2GWRA 1G8XA 1QPIA 5BPDA 5HGQA 2I5UA 2NS7A 3QNEA 3PQKA 2YUNA 1V1CA 4Y52J 4ABZA 2JMAA 2W82A 5F0HA 1JUPA 2DTOA 1SVOA 4H2XA 3PCOB 2C0OA 1K8AC 4KQEA 2UV1A 4KUIA 4OMNA 4F7UG 2O8XA 4C0ZA 2VKDA 3RGLA 2MIOA 5J1YA 1CF7A 2CH0A 2VXFA 2YUOA 4Y13A 1ZG5A 2E71A 1UAAA 3PSFA 2X4XA 2RKHA 4AD9A 4PFPA 4U87A 2L7KA 2EB7A 1T6SA 3ZQLA 3HC7A 3M54A 2EV5A 2BOLA 1BW6A 1YJ9I 1IV8A 1J5WA 1XB4A 1YX3A 5D6YA 5H20A 2IVMA 5C4XJ 1GT0C 4CH5A 4NNJA 4BQOA 4XTYA 4TWAA 3BG6A 5GAMd 1F9NA 2A3SA 2CFOA 2FBKA 4I02A 1VQZA 5F6FA 2KRHA 2RHSB 1RR7A 3ZQCA 1XSXA 3FIWA 2ZPGB 3G71I 5L8RE 3HKZA 2KRMA 3U23A 2F5DA 4B9XA 1YITT 2NYSA 4CS2A 3BR5A 2EBIA 3OYYA 1SD5A 3EG3A 4HWOA 4MDWA 1C0WA 4QW2A 5DV5A 2BUDA 3NAUA 2I4LA 3P9CA 5FKNA 1O3QA 5CKHA 3C2GA 2W84A 3GOXA 2M30A 3TQNA 1JKQC 3CQZJ 3QUIA 4M77A 5FKKA 5BQTA 2VI6A 4IO9F 1UJ0A 3I4NJ 2VOOA 2KXCA 1G4DA 3BY6A 1D5VA 3CJTB 4BU2A 1YWPA 1Y07A 1X43A 4S0HB 1PDNC 1TT5B 4KA4A 2OCCH 3OW2P 1RLPC 4D9JA 4OAZA 3IP4B 2CSIA 1YJ9T 2Z9OA 1R4MB 3UDCA 3M1EA 2CQQA 2DFEA 2QQAA 4RB0A 1ODDA 1XPXA 1D8JA 1MH4A 1W5CC 3MMYB 4AG2C 5IYBJ 1GDTA 2W4SA 1PSFA 1Q86U 4OGCA 3Q5FA 1HKSA 3KXTA 3G71T 3QAHA 3RKWA 1O9SA 1H641 1C0MA 1MBGA 1QHHD 5KNNA 2K9SA 1E3HA 2XG8D 3Q1JA 1ITYA 4BQAA 3M9QA 1B72B 1OCRH 3RR6A 4HG2A 5CPRB 5ED4A 1S7AA 1WDXA 2D0NA 3U2RA 3LSGA 5EGOA 2AQFA 4M9XA 2L5QA 3F3XA 2XAJA 2WBMA 2RN7A 2NVQJ 4YRPA 3E5XA 2HOEA 1QWEA 2E4HA 1KMMA 4PJMA 3OD1A 2A07F 3B6AA 4LFUA 3GX4X 3PIPF 4I7HA 3ZXSA 4A5MA 4GGGA 3L2UA 3CMYA 4HDUA 3QWXX 3K7AJ 4D8DA 1HKQA 3VYRB 2B0LA 3CCMI 4RGXA 3RERA 3EFOA 4DW6A 4PLLA 2MLKA 5HS8A 2MC3A 4AFUC 1FOXA 1HD3A 1JXMA 1LJ9A 1TW2A 2WAQN 1SSHA 3JSPA 1TWBA 4PGHA 2FRHA 5D6XA 2DL5A 1LOJA 3FISA 2MLGA 3RDVA 3QO3A 1N27A 4K88A 3B73A 1ETOA 1X4OA 5GAN5 4PJOD 4BI4A 3I5UA 3M4PA 3J81K 4B3AA 3GZ6A 1E6GA 1ZKGA 2PTKA 5TGTA 4FSXA 4LNPA 1Q86R 2DA3A 4WCGA 1WZ2A 4BD3A 3CP2A 1SD6A 5HK0A 4AFZC 1C0AA 1M1KR 2NS8A 1SKUB 2RQQA 1LVAA 1YRNA 5CKDA 4H2WA 1SPKA 5IY5H 2IVWA 4OAYA 4WWCA 5FKMA 3OOUA 4HA8A 3K4JA 5KYWA 5L3DA 3HSFA 1YJ9Q 3OR1C 1GV5A 4QVDA 2YS9A 3C95A 1ZR2A 1WHGA 5M9OA 4XU0A 2F5FA 2ZXJA 4OGEA 5IOZA 5D5WB 2FEZA 1BI3A 2KQWA 4C8QE 2YRVA 3TEEA 1XD7A 1ZHIA 1RUNA 8AT1B 4J19A 4KUMA 1UGVA 1TT0A 2LCLA 4I09A 4UUSA 2QK0A 1TWGJ 3O8VA 3CCMT 4L5IA 3RPUA 3H8ZA 3BWGA 3G71Q 1HC7A 1O3SA 4M77G 1GVJA 4YP0A 4EJWA 2QG9B 4I98B 4EMKB 3GW2A 1IW7F 1LB2A 4CHUA 3SDZA 4P71C 2FO0A 4E4HA 4F7UF 2A6HF 2ZB9A 3PL8A 4ELYC 5D6WA 4HCKA 4OIPF 4QIWN 4MIMA 1NM7A 3HTUA 4H2VA 1QP3A 1NK2P 1MMNA 3OV8A 4JRPA 4QSHA 1M3CA 1IHVA 3B6CA 2ARTA 2BEOA 3FLGA 3PCOA 2BVLA 2DEUA 1Q7YU 4JPBW 3MP1A 2XPVA 3RCOA 3RZOJ 2WAFA 1SRLA 3M0UA 3T9NA 2PMUA 3CPWP 2XPUA 4KT5C 2LY1A 3DXJF 2R0QC 3CUQC 3DV8A 4QWQA 1PC0A 5BNGA 1MZBA 5GANe 2CWEA 1MKMA 3RQ4A 1B7YB 4GLKA 1HSQA 5FKLA 4CH6A 3D5SC 3REAB 3I71A 2KDOA 1WWXA 2XMFA 1WSUA 2L7FP 2O3FA 4FYWB 1PRMC 1OKRA 3ZN0A 2W85A 2R7RA 3S14J 1YW7A 1QVFA 4WJ3M 2JZ2A 2HDWA 2V6EA 2LF7A 1FLIA 4YROA 1PCXA 4E7KA 3K4MA 4EQQA 2RHSA 3BG7A 3M53A 1RL2A 1Z7MA 1I5OB 4P9FA 4ATOA 4J8OA 4LITA 5C44J 4FETA 2C06A 3RL6A 3LSJA 3H92A 2XTIA 5AONA 3R60A 1BK2A 1BI1A 1KZHA 5F5WA 1LDJA 2JZYA 2JPCA 1PWTA 1XSDA 1X6OA 2XV4S 4HX4A 2EQKA 4CICA 1ADJA 2GQQA 2X9HA 4FT8A 1V76A 2HD0A 2ZIMA 4C2TA 1LFUP 1TTYA 3HL8A 1IC8A 4CXFA 3CLQA 1RUOA 3GBGA 4WF2A 1Y0UA 5KAIC 5A0LA 5DS9A 2EQUA 1DPUA 4ASNA 3X20B 1K6YA 2P5LC 5DUIA 4G7ZF 3CCMQ 4ENKA 4M9ZA 4BY7J 3ZQHA 4KISA 2VBYA 2DK5A 4WXDA 3BTCA 3S2WA 6PAXA 2KFDA 5TRDA 2M5WA 3P8HA 4F16A 1NH3A 3CXCP 1Q86C 3IHUA 1OR7A 2GNCA 2X1EA 2VBWA 4J6WA 3G1JA 1MGTA 1G3SA 1M1KC 4YELA 1HOMA 2RHIA 2M9UA 3TU4K 3LYIA 2DU5A 2KE9A 2XKOC 2I8DA 4GBQA 2DFFA 3H35A 2DTIA 5GANj 1BI2A 4ESBA 3I3LA 4CH4A 2O4XB 4HWPA 2NOJB 1T39A 5FO5A 4RB3C 2PJPA 3M58A 2B7EA 2DVJA 5KCOA 5CQGA 2CUJA 3LQRA 4A3CJ 4UY8I 2XGTA 1O75A 5J4YA 2KY9A 4C5GA 5CQEA 5HLHA 3E3VA 1MMDA 2VXEA 2JUFA 5GAHJ 3ZEHA 3PZCA 4CCLA 3OA6A 1NJIU 3TGNA 2FX0A 3VV0A 3BQZA 2FZKB 4N4NB 2ZXWH 4CC7A 5GANf 2QSFX 1VQ8A 2EZIA 1B72A 3PNWC 3VOEA 4C92C 1BBUA 1CKBA 2KISA 1AHJB 3F6VA 2QDYB 4JLIA 4U88A 1ZG3A 4D7MA 1U3OA 4OIRF 2G0EA 3CD6A 2E3IA 3ULQB 2ID6A 2QKMB 2HNHA 4MTEA 1M3BA 1WH5A 1H8AC 1I1JA 2DFUA 2LLKA 2X1CA 3NGPA 1HYOA 1B07A 4YRRA 3HTSB 3FMSA 1NPRA 3QYEA 1Y57A 3K70D 3EFSA 3K4KA 4HV6A 2KR3A 1MMSA 1Z3YA 2L89A 4KMFA 2W00A 2UWMA 2VC0A 2R93J 4N4GA 1B6AA 3M56A 2A05A 2D1XA 2ZJRF 1S6LA 4FT2A 2EZHA 2W7NA 3SB2A 3INZA 1VQ9A 2ZT8A 2R7ZJ 3HXZA 1MW7A 4V19K 1QVGP 5GPCA 4P3OA 5M3MJ 2FL7A 4YRJA 1T8IA 1U0JA 4NC7A 1SHFA 5D7UA 3UKGA 3DKYA 1EIYB 1Y39A 4RMOA 4JX5A 4IUQA 4JX6A 3E0JB 2K40A 2RI3A 1PKSA 2XI9A 1R6RA 2MG4A 3AT1B 1IO6A 4C2MJ 1VQKI 2ZFUA 1XGOA 2K6DA 4RTVA 3SWNB 4NL2A 2HZYA 1VQ6A 4QKUA 3F22A 3HBLA 1OOTA 3HKSA 1NJIR 2P8TA 2R7OA 3LC0A 4H0EA 3F6OA 4J9EA 4DQ2A 1POGA 3MQZA 12ASA 2XICA 1M1FA 3GLLA 2ZSHB 2XF6A 4MDXA 1LJOA 1VIFA 2K7AA 3MEWA 4PJLA 2MF2A 4HPQA 4XNFA 1QP2A 2QZ8A 4NUBA 2OTLI 2LC4A 2V1NA 4YRQA 4Y17A 4R55A 2RN8A 2LKPA 2J6KA 1WFXA 1K79A 5IN1A 1ACIA 2EL9A 2VQGA 3OWTA 1DGRM 1WVRA 3KYCB 3Q3SA 2KYBA 2AZSA 5IXFA 2JT4A 4XMYA 2FOWA 1X2HA 2KKOA 3G3ZA 2FNPA 4EMKA 1KC8U 1NYGA 3M55A 1KGSA 2CP3A 3J7AF 1YN8A 3LSTA 2BHYA 5AT1B 3DQVC 1WU7A 3MKYB 1J2XA 1M4ZA 2R5YB 2JTVA 2DXBA 2WWYA 1VIEA 2EYWA 3H3VK 3NPFA 3NFCA 4LVKA 1BOAA 3HJEA 2DOEA 2RVCA 5TJJA 1TC3C 2E6NA 3FM5A 2RGVA 1VQKT 2R4GA 3OYMA 4KDPA 3U1KA 1QA6A 1P6RA 4YRFA 3H5AA 3WU1B 3OYLA 3BPVA 4IUPA 2V8IA 2EFOA 4GYGA 2ZO4A 3HZJA 1SVLA 1NK3P 3KLOA 3TW6A 2AKLA 4TTVA 1STZA 2YWWA 2AZVA 3ZPLA 1R36A 1VQ7A 4YIIA 2DL8A 1ZA2B 3IH4A 5FFXA 1UGSB 1B7YA 2VN2A 1K0SA 2LVMA 2HBPA 3DLAA 1UECA 3O8HA 3CC7I 4RCBA 4J9GA 1WGXA 4PUSA 4I01A 5DCFA 4HCBA 1W5TA 1SMYF 1ZQ3P 2LNHB 2O03A 3QPHA 3FB9A 2ZINA 2JM9A 2VKNA 4XN0A 3CCVA 4LB5A 4M7DE 3FK7A 5GAN6 4MLOA 1EH6A 2DN0A 3S1RJ 4HQEA 3R4KA 4ORZA 2R7XA 2HMAA 4XN3A 1SD4A 4WX9A 2V8JA 1IUFA 3VSKA 1QHGA 2PFBA 4JZ3A 1Y0MA 4YRVA 2F69A 3X2QH 2DO3A 5EG0B 3A74A 2IGOA 3VQVA 4CI0C 1Y56A 3CCLI 1BCOA 4HT8A 1B76A 2FQ3A 1VQNA 2Z99A 2A6EF 3QPSA 1W4SA 3CJQB 2CUZA 3LA2A 4PLIA 1K78B 1SFEA 1ETYA 3CC2T 4XK4A 2K5FA 2DI3A 3FXRA 1NG2A 2P5KA 2RQTA 3ESWB 1Q82U 1GRIA 4TQFA 1YI2A 2WV1A 4XEMA 2AQEA 4C8QD 1GBRA 3CC7T 1NEGA 3GP8A 3JB9D 1X1CA 4OB0B 4II2A 3HDDA 2ZZDA 1QKXA 1RAEB 4WTOB 1UELB 1WJBA 2QAZA 3VRYA 2YHTA 1YJWA 3MZ8A 5IYDJ 1TNSA 1T0FC 1NJIC 1NBEB 2NLUA 2XAQA 1VQKQ 2O4XA 2D6FA 1BR1A 2COYA 4XTUA 2M0MA 1B8IA 4F04B 2CW7A 2RHYA 3ZMVA 3E9FA 1VQ4I 4XOTA 4PFZA 4RTXA 3CCLT 1JEGA 2V1DA 2DT7B 4Y33A 1AHDP 4G94A 5GAN4 3FWEA 3K4CA 3JRDA 2DIGA 2J5PA 2X35A 1SESA 3OYEA 3HSBA 3HRTA 3DBRB 1HK9A 2OTLQ 1AKHB 2CP0A 2HSEB 3OYCA 5FB2A 1S7OA 2QENA 2IBDA 1ZSZA 5B1BH 4A4KA 1WLPB 4R79A 3RIRA 2M51A 2CJ9A 4ENJA 4ZTZB 2E12A 4PK4A 3DF8A 3K4LA 1KONA 1RI9A 2XK0A 4A4GA 1FC3A 1ZSGA 1R4NB 2CIMA 1E17A 3GFJA 5ECAA 5F0CA 4IOCF 2L2PA 4EDUA 1X1DA 1GXQA 3G4SQ 3A1YA 2GQVA 2OQGA 4HNVA 1GCPA 1Z67A 1XCBA 3VQYA 4YCVA 2XRNA 4IOAF 3J7YJ 4BI3A 3K69A 2L3QA 1X2GA 2QA4T 4L9JA 2HVRA 1APLC 3OYNA 3ZFJA 3ISPA 3DLLA 4KGVB 1TWCJ 4F14A 2GQIA 3GTKJ 2ZPIB 2XKPA 3VS2A 4CYCA 1SMTA 2YRCA 1ZH5A 1S29A 2IS2A 1VQ4T 4JRIA 4PHCA 4AM3A 4LDXA 2OTJA 4JX4A 3QPTA 2AKKA 4FM4B 4C8QG 4QT7A 3JB9G 4YRTA 1TQMA 5GANd 3SWNA 5K1PA 3QRFF 1DJ7B 4JJCA 4KIFA 3CDHA 2ZJ2A 1X3WB 1G3WA 4VUBA 1NYFA 1JKPC 4J7IA 1BIBA 3FMQA 5FKOA 3CCEA 1AOJA 1OZ2A 1WPYA 3CC7Q 2MW8A 3HOTA 3NTKA 2CUBA 1R77A 3CMQA 3OYFA 1TQIA 2W48A 11ASA 3BCAA 2JXBA 3NWSA 4P1WA 2DL3A 2BIVA 2XGDA 3ICAA 2QGGA 1FWZA 4IHTA 1MSFC 4OMMA 1ZRCA 2LJ1A 3QODA 3NRVA 1BR2A 1Z7UA 1IUYA 1PSEA 3RYPA 3HHHA 4H2SA 4IPAA 1ZTRA 4EV0A 4WXCA 2RNJA 2HKOA 3BLYA 3PM1A 4RUGA 2R7QA 1E22A 5LGTA 4H2TA 2UUZA 5DM6F 4E2FB 3KFWX 1HTTA 3CMAI 3CCLQ 1IB8A 3C0CA 2E1MC 2EGAA 2HEOA 3FXQA 3G6EI 1KK7A 2JA8J 5B5EC 5J1RA 1H4QA 3GNFB 4YIRX 1NEBA 2XDDA 3OW2S 2FU4A 5IH2A 1U5TC 4BXXJ 4J6XA 4P5OA 1YJNA 2DA5A 2DA1A 4HNUA 1JJCA 4ON0A 3HYIA 3J7ZI 1TOVA 3QPLA 1QBJA 4XLNF 2F5CA 3HXWA 2E35A 2E6ZA 4IHSA 2DE0X 2LG4A 2Q7GA 2D45A 4E7LA 4ELZC 1MIJA 2EYYA 1OISA 2EQJA 2QYOA 4ESFA 4BY1J 4C30A 3IG2A 3A1PA 2X6YA 3NWTA 1KU3A 3CC4A 2FF4A 3TVTA 2CUFA 4HVUA 2GZWA 3CDLA 3VS6A 2FJ1A 2E41A 4UPAA 3BR1A 4M71A 1RKWA 3WG7H 2C6YA 5HVQC 1LCKA 1UJYA 1BN5A 2H8RA 2DETA 2FUG2 1D5YA 2DMOA 2LREA 5FFZA 4HNTA 2QKLB 1VQ4Q 1X1AA 3C4SA 2FD5A 2YLBA 1ZUUA 2M4KA 1HKTA 3CEYA 2K86A 3QG1A 1B9NA 1M9SA 4A93J 1RAHB 5IHIA 5D6EA 3JAMZ 3CPFA 1X6GA 2W24A 1VYUA 4K86A 1M2VB 1E3PA 5EG0A 3PE0A 2CP7A 2YRDA 3E9HA 1O7FA 5J8FA 4X9DA 2IPOB 4BBSJ 4X1VA 4FCYA 4OMYA 1YP5A 2V6CA 1R00A 3WQZA 3KCCA 5FU7C 1WXUA 1UG0A 3ERMA 4KGZB 4PFOA 1NG7A 1AEYA 3H0HA 1K78A 3VFZA 3Q9SA 3V8JA 1DGWY 1U6GA 5IT9Z 1IN6A 5CIUA 2MAMA 2X6XA 4J9HA 4P96A 1J9IA 3KZIC 4G6QA 1O3TA 1W6XA 1GUUA 4UVBA 1IREB 3H1CA 2PX9A 5DD8A 4ZYDA 3VKIA 4IRHA 2EKHA 5J39A 1H3ZA 3FHZA 1JUSA 4RDXA 2VBXA 2W25A 3EUHC 5GMKe 4M7DA 2GAUA 1E6HA 5E3LA 2E36A 4Z6YA 1OFCX 1I39A 2X4WA 3OSFA 4DNCA 2L9NA 3O2PE 4D7NA 1ZREA 1ABQA 2JMWA 4L9VA 4LLLA 3LA7A 2KQRA 1AZGB 4Z8AA 1YIJA 1JHHA 4LG0B 2XGEA 2D2WA 1IZ6A 4RG2A 2QTVA 1SAUA 1WLEA 3JTHA 4JYKA 3X25B 2F5VA 4QVCA 3GFMA 1SRMA 1ZX6A 1AKHA 3SXYA 1XX5A 4PKCC 3LMMA 3E6BA 5IAYA 1D1AA 2IPQX 1WHHA 2KRSA 2KRFA 5KVRA 2DW4A 2KZGA 5FLXZ 1DQUA 3VJPA 2PBIA 4I76A 4EEFG 3FKJA 4L5JA 3TEGA 3HY0A 2OF7A 2DX1A 2AMCB 3CMAQ 4C8QF 3JB9F 5E17F 3JCMV 2H1KA 4XLPF 2OV7A 3OYBA 1LFPA 3JCMP 3G6EQ 4M7DD 4RAFA 4KN4X 2XIDA 1USYA 3QP6A 3KE2A 2FQ4A 5IT3A 1PVEA 4YYEA 1X01A 5FRNA 1ZLKA 5FD6A 4JDSA 3I56A 1R7JA 4KUDK 4DA4A 5CQXA 3HXXA 2B9SA 3ABLH 4IURA 4P75A 2LQKA 4HVCA 1UHFA 2WB1A 1T95A 5BPIA 5J3BA 3DTKA 2K5CA 1WI7A 1KQSP 1GFCA 5GMKj 4I2OA 3EG1A 2X1DA 3RKYA 1FZPB 3A98A 5HK3A 4P74C 5ELOA 3BJUA 2DL7A 3T0YA 5EEHA 3UNGC 4UP7A 3R6NA 2VODA 3O5ZA 2JQ7A 4DIQA 4P73C 2XDVA 2KDZA 4UVCA 1H88C 1Z21A 4AFQC 1FSEA 4EIKA 2VJ5A 2KBTA 2J3MA 3W6VA 3K1NA 3MQ0A 4A3JJ 2B86A 3CUQB 4WXHA 4O3MA 4KFCA 2F6CA 3QOEA 1YHQT 3HOVJ 3PIOA 4AIDA 2DO7A 4CS3A 1B3QA 2J7IA 3MN2A 4RA2A 1QVFS 4YRNA 3K1MA 1EFNA 2PU9B 1NYQA 4M3FA 2Y0SA 5GAOl 3CO6C 3LH0A 1I07A 2ZPHB 1R49A 4YIFA 3GTQJ 4YRSA 3DU6A 2D8JA 5GAN2 4OWRB 1EX4A 1MNDA 3SFIA 2MWPA 3LSSA 5HY6A 4EMSA 5GAMh 2QSGX 2FSWA 4G8XA 1OEBA 2B63J 3NETA 2IGNA 3DTIA 3FXJA 3HKZN 2M45A 1KQ1A 2AIRB 4P3PA 3I54A 3DLMA 3FDRA 4M7DG 2D1VA 3QIIA 1JTXA 5LL6S 4BQNA 3CBPA 1XNIA 3S32A 1IGUA 3A0BC 3E6MA 3EYIA 5KYNA 3LSPA 2EPDA 1SG5A 2PMZA 3U1DA 3HXVA 3GO5A 4DBFA 2KIMA 5KYXA 1PP8F 1FYNA 2H8HA 4PCQA 1K73R 3HM5A 1BU1A 4M78E 2EZLA 1ZELA 1W70A 1WH7A 1X2MA 2E34A 5H6QA 3IRRA 1BJAA 3OSVA 2V8KA 4UXNA 3KYDB 3LA3A 1K9MR 1TSFA 2OPTA 2Q7HA 3A03A 3J80E 2RPNA 1I1GA 1ZHFA 4CZZA 2J5OA 2OD5A 1ZK8A 1B70B 4A0ZA 1D1CA 1OU9A 3DEUA 2XC7A 4M77C 4XLCA 5EJCA 3VRZA 2VUBA 1X2QA 4NCXA 4HQMA 3HHGA 2ZNIA 4JLGA 1PD0A 2ZBKA 3BP8A 4A4FA 4BDZA 3DU5A 2HQRA 2R5AA 1KD1U 1CKAA 4LLNA 2PVDB 2H94A 3KP5A 2EPFA 2ZMEA 3MCAB 3OBWA 2K5LA 2NAZA 3CCSA 4KIGA 4BI8B 4AYBA 3ZQQA 3THKA 4C92B 4P3NA 2YSQA 4OB3B 3ABTA 1YFHA 5J1UA 1DUXC 1MMAA 3ABMH 3QHSA 1H8KA 1FP1D 4HDVA 2ARSA 2O5RA 3IKVA 4BH9A 2JTFA 4A3IJ 4XICA 1KIKA 3ZQGA 2A0FB 4HRIA 4M75E 4YFNF 1U9NA 2VPLA 2K3FA 4BE1A 2QGFB 1IRGA 1UFFA 1TQPA 2EV0A 3IL2A 1G2BA 3MKLA 4KT6A 1OYWA 2R7DA 1R71A 4M7AE 1UDLA 4BQQA 4XKBA 2L3PA 3UPUA 4LG0A 3H3UA 1OPKA 1P9QC 1BKBA 2GXAA 4XQFA 1SF9A 1V4RA 2ED0A 5DDGA 2QQ9A 1YITA 2GBYA 2DU9A 2DODA 1WJEA 2X9DA 2P84A 2BY1A 3L1PA 3HXUA 3PFIA 3EH2A 4HW0A 3LWIA 1VQLI 4FX4A 2NUTB 2DLLA 4FIBA 2H6CA 4JJBA 3CCUA 2M87A 3M8FA 4CCKA 1BIAA 1KD1R 4A4HA 1VQ5I 1KJWA 2M0OA 1G3TA 1K9AA 2RQRA 2AMCA 4MMKA 2CP2A 1YFTA 2MA3A 2FG0A 2G7UA 3FM3A 2XHKA 4AIKA 1YJ9A 3AAFA 2R5ZB 2DRMA 3REBB 3JTGA 4C0FA 3MEUA 1N6AA 4B3XA 5JFRA 2KT1A 5FGMA 2DJIA 2R57A 4A0XA 3CDIA 3JV3A 3MEYA 1FIPA 1MBHA 2QHSA 4QTRA 4M7AB 2TRTA 2VQLA 2XF7A 2KL4A 1YB3A 4MZPA 3CCJT 3NARA 3JCMc 2HYJA 2K4YA 1VQ8I 2PN6A 3VYUB 1X75C 5M5XJ 1MNMC 3V8LA 1ETQA 1Z6TA 4CO8A 3ML6A 1YW9A 2MFZA 3A8MB 3CD6I 1K73C 1NYRA 1VQLT 5J6XA 5GAN3 2CU7A 1RIQA 5GJWB 5HS7A 4F52A 4FSSA 2GXGA 1W7PD 2W0ZA 5DCMB 1Y96B 2Y9YA 1K9MC 4HEA2 2DTRA 3IAS2 1UEBA 1OJLA 5K5OA 1B59A 5GAOr 4YEJA 1VQ5T 3JSOA 2M4GA 4N0AA 3KBGA 4JRQA 3TDUC 3TO7A 1I27A 4BW9A 3GWZA 1FJLA 3HOYJ 3NHNA 3RMQA 4XRSA 1N75A 3CUQA 1Z6RA 1NHAA 1VQ9I 2GBQA 3I35A 4JOMA 3GTJJ 2DLPA 2DEQA 2DOAA 2VE9A 4RLQA 2FOKA 1NZ9A 4NC8A 4DZPA 4WI1A 2HDDA 2C0IA 4I0BA 3CP8A 1ERDA 2FHDA 3UGQA 3EGXB 5L3CA 3NEMA 3FXMA 4C0DC 4M7DF 1XJWB 2Q7EA 4IL6C 5I21A 2DA2A 1VQOA 4XM3A 2ECZA 5GAOq 3R61A 4RTYA 5JVTA 1NPPA 1JJ2A 2DAQA 4U0VA 4H4KC 2DYBA 3FX3A 2ENMA 3VQWA 2KSSA 2LTOA 1VQ6I 3D5RC 3TKYA 1M27C 3CD6T 4ZJZA 3M0SA 1KQ9A 3EPZA 3SHWA 3MPUB 2XAGA 3EG0A 1PUEE 1YTYA 3TOAA 3MF1A 2Z16A 2D0QB 1FIAA 1WHJA 4D8KA 2RJEA 1KQ2A 4A3BJ 1QCOA 5A2QE 3GF2A 2DMTA 3UA7A 4YPFA 1PHTA 2M8EA 1QWFA 1LPQA 2VWFA 1MJAA 2IGMA 2DOFA 3I5SA 2Z0WA 3M3YJ 3QTCA 1V5EA 4RTUA 2VGMA 4LUEA 3ELKA 2QTXA 1A31A 3I4MJ 3NELA 3N05A 3P8BB 5LJ3j 3GZ5A 4G84A 4EMHA 2LNBA 2F2VA 3RKQA 2FZCB 1MD0A 5HNFA 3DPLC 4CRIA 1YOVB 3H0GJ 2L2OA 1U1SA 1XSVA 4ZDLA 4CH3A 4OF1A 1Z3XA 1PD1A 2SEMA 4XLAA 5M3FJ 5D5XB 3MD2A 1VZ0A 1XMXA 2EQMA 5LJ3f 2OJ2A 4LIUA 1B70A 5E3OA 1R23A 3OL3A 2QGUA 3TP3A 1XDUA 3JCMW 2GGRA 1KD1C 4F93B 5I2SA 4RM2A 4M6VA 1VQLQ 3NTHA 3SZTA 1DU0A 5K1YA 2Y69H 3I9QA 4NHJA 3JCMQ 4Q5WA 3V7CA 2OBPA 1XC5A 3CESA 3G1OA 2IJLA 2IA1A 5GANg 5GADJ 2DT5A 1M8VA 2VJ4A 1JJ8C 2XDBA 3K70C 3HRIA 2OCEA 2E2HJ 2F5EA 1WHKA 3A32A 1ZUYA 1VQ7I 2KYMA 2CQNA 4C92A 3MKZA 2ZXFA 1OR7C 3BOQA 2P7VB 1P92A 2LDUA 1ZARA 1AD5A 3R0AA 3MFKA 3OS2A 1JB0E 1HLVA 3FEOA 3G1MA 4G12A 1N5ZA 4NDLA 2QHUA 3F9KA 4I99C 1I5LA 3QKJA 4M78A 2EINH 3BY7A 3F8NA 3A7AA 2VUMJ 1H4VB 3T8RA 1SFKA 3K6GA 3GIBA 1Y6IA 2SRCA 4YFKF 4J83A 4KULA 1VQ8Q 2DDZA 3PIOF 1FNNA 1TW3A 3E6DA 4OP0A 3VEPA 3CD6Q 2HNIA 2VC1A 4BY6B 1SEMA 1OMIA 3BJOA 4YG2F 1MH3A 2DL4A 2ZPBB 1FP2A 3A5YA 1B7TA 2VVKA 1V54H 1QZEA 3L1AA 1VQNI 2GOMA 4BAYA 1EF4A 4XRSG 4X6AJ 3A5ZA 4CA0A 1KU2A 1LEBA 4GCVA 5FD5A 2O9VA 1P4AA 2MD5A 4E7JA 4BJ6C 5JI6A 3ZGKA 2NUTA 4XONA 2G6FX 2ZCEA 1GLNA 4RB2C 2BHZA 1VQ7T 2COBA 5E3NA 3VWBA 1D0ZA 3RYRA 3HXLA 4CGZA 1WJSA 1VQ9Q 4RQFA 2OZUA 2WACA 4LMYA 3I59B 2IA0A 2E70A 1D09B 1A36A 2ESHA 4DEYA 4GRIA 2V26A 2J06A 4NOYA 3OIQA 2NVXJ 4B43A 1T0JA 3K4BA 4IUVA 2RM4A 1T98A 1R1VA 4XU2A 1GFDA 3FXOA 3EUAA 1F43A 3JCMb 4M78D 3FRNA 3JRIA 1ZA1B 5JR3A 2O8KA 4YRIA 4MTDA 2HPMA 4M75A 2ICWG 2MH9A 2MPXC 5CVRA 2IAIA 2E1NA 1IZ1A 5D4SA 3IUOA 1JJ6C 2MD0A 2MH2A 3QZ9B 2CYYA 4HT9A 3WODF 1A35A 3X24B 1VQ6Q 3WGHA 5GMKm 3OYGA 3REXA 2JUCA 5LJ5g 4M7AA 5DUKA 5DEQA 3AG3H 3VYGA 3GXOA 4A3FJ 3AG4H 3FJ5A 1VQNT 2EAYA 1FTTA 1X56A 2L02A 3SFMA 2KNBB 1ZGAA 4HKEA 1S72A 5JLWA 1RKTA 3OW2A 4C9YA 2Q8KA 2GCXA 5D5UB 2EILH 5LRRA 1JQQA 2Q5IA 4B09A 4MHGA 3WU0A 2LRDA 1U5TB 3S1NJ 3BCBA 2GFAA 3L2CA 3J80K 3LW5E 3BG5A 2RREA 4IRIA 2JPBA 3JRHA 3L2QA 3FKIJ 1UG1A 3L2ZA 3UT1A 5EEAA 3VUZA 1TP4A 4EMKC 2ZC2A 3BZ6A 5GAOp 1QKWA 3H0IA 1H9GA 1UZCA 4XTZA 4ZGEB 1XMKA 1HW5A 2K7LA 3PFYA 1U8BA 2RO0A 2LMDA 2ZZGA 5EDNA 1WJCA 2BZYA 4M75D 5GPAA 3HFOA 1GGMA 4LD9K 2W57A 2ZPFB 3EGXA 2DNUA 2HQHA 2L54A 5FWBA 1RAGB 5HOOA 3CCRA 1UFMA 2CV2A 2OTJI 4AH6A 1JUMA 3D5LA 1RNLA 1I1SA 2YT6A 3ULRB 5HDGA 2M02A 1VFCA 3A8HB 4LD5A 5HS9A 4E6KG 2P7CB 1VQ7Q 2FBHA 3PUBA 2EZKA 2IP2A 4M78G 2P4TA 2HQAA 1R5HA 4HZFA 3CCEI 3EFRA 2K9MA 2FXAA 3HG9A 5GAN7 2V4JC 4JS4A 2ESNA 5IHNA 4C8QC 3IKMB 4EGZA 3JCMg 1MNEA 1QMCA 2R7TA 3PNYA 3ZL7C 3PNTA 3L2WA 3X28B 3CCVQ 2D1HA 2WA0A 2F2EA 5FU7B 4M77D 2GA1A 2Z1DA 4HYEA 5CYVA 3OY9A 1VQMA 2FRWA 9ANTA 2YXYA 4Z2YA 3ZRGA 5IP9J 1BC8C 3T8TA 1V3FA 2NYXA 1OCCH 4U0WA 2MCNA 2O31A 3E5QA 1HF0A 4A2UA 3K9TA 1VQPA 2VPRA 2VYTA 2HCKA 3P7NA 4BXUA 1VQNQ 1X3ZB 3UR3C 5LLQA 5LGNA 2QI2A 1WNLA 2RNGA 2XF5A 3RACA 2JS2A 1SFUA 4RQEA 4W97A 2DQ0A 3S93A 2W1OA 4J01A 4RM3A 2R7FA 1YJNI 1WZOA 2H27A 3RUXA 2CZ0B 3EGUA 1BYMA 2X4HA 3K2ZA 1MDMB 4KH0B 3HRKA 3CCET 4LVLA 2CP6A 3ASNH 3JRGA 4M75G 5F1JA 1NJ6A 2ABLA 2IS4A 3NEUA 1ETXA 2HFHA 1G51A 3OS0A 4OMLA 1HDPA 1MV0B 1UHCA 3KX2A 5LHIA 5ELNA 2DA6A 3CC4I 4YCUA 4M7AG 3L00A 2X0LA 3VS3A 5F1RA 1W4MA 4Z02A 5CVIA 4A3DJ 4C3HJ 3SZPA 5CKTA 4PJNA 2L4AA 2P6SA 1ABOA 1IN5A 1WYXA 1P2FA 2P0PA 4HAMA 4A3KJ 3LQQA 4L59A 1RPWA 2HXIA 1V55H 3KLNA 2RNAA 1HQCA 2IY5B 1KQSS 5KNLA 2EJ9A 1KSWA 1VI0A 1UG2A 3C2HA 1L3LA 2BVMA 2HOTA 5LJ3d 4U7DA 3H9GA 1B8AA 2RHXA 4AC0A 2IIMA 4HF1A 4BHCA 4LVIA 4O2DA 2BZTA 1YJNT 4RB1A 3EG9B 4JQFA 1RR8C 1M30A 3HIFA 3FXUA 2GOXB 5KE2A 3Q0WA 3HSRA 4FYYB 2DPDA 1ZSZC 4A3LJ 1LE8B 1FY7A 3H6ZA 2Y4YA 3DPUA 1R1TA 2F48A 3HFZB 3TCJA 4Q4ZF 4CCMA 1DDNA 2QBYB 2KLOA 1IV6A 3VS0A 2I10A 1OX9A 5E18F 3QDFA 1IN4A 3CC4T 2HL3A 3CC2A 3CMEA 4YTLA 5GANh 4AU7A 1P7JA 3MF2A 3J80Z 4G6TB 3R6SA 3HGGA 2D9TA 2X4JA 2A61A 1FMKA 3FHNA 1OCPA 2K02A 2ROLA 1NLPC 1FMWA 4IUUA 3TMOA 2BY2A 1OQKA 2OTJQ 3I53A 2A6TA 1ZUKA 3B02A 2A37A 4L0YB 3GZNB 4AMCA 2I4MA 1RACB 4N0BA 5A2QK 3JR9A 2Y90A 3FZVA 4EPCA 3TOBA 2QEXA 3KIOA 3U21A 1UHWA 1E7OA 1YIJI 2P0QA 3JCMJ 5ICCA 3SWNC 2PLYA 3RPUD 1HW2A 2EQRA 4B47A 4RGSA 3CCEQ 3PVLA 4LK1F 1R22A 3LSQA 3T5XA 4OMZA 5HDKA 4E47A 1F5TA 2CKKA 2CUDA 1X6BA 2A68F 4FQGA 3LX7A 4H2XB 4F7ZA 3WGIA 5A0DA