3VDPA

Structure and biochemical studies of the recombination mediator protein recr in recfor pathway
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
molecule keywords Recombination protein recR
molecule tags Recombination
source organism Thermoanaerobacter tengcongensis
total genus 59
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vdpA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vdpA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vdpA03
4O6OA 3VDPA 1VDDA 1D3YA 5GUJA 2Q2EA 4E2KA 2ZBKA 4JCVA 4EDKA 1T6T1 3VE5A 4EE1A 2V1CA 1EQNA 1DDEA 4EDVA 3D00A 4O6PB 4EDGA 4EDRA 2AU3A 4EDTA 3B39A 1DD9A 3VDUA
chains in the Genus database with same CATH superfamily
1QAQA 2F5NA 3UGIA 4O6OA 1UVGA 1IXSB 2YUUA 3B7QA 1TIHA 4AI6A 1XMQM 2V6ZM 4G4OA 2ZANA 4IBEA 1GKIA 3HHXA 5DNYA 2MROB 2N35A 3THGA 2NU3I 2JY8A 1SG9A 4JI4M 3IG5A 2L7IA 4IBKA 2VF8A 2WGCA 2QNJA 5L8RF 2VIIA 2ZBKA 4WW0A 4EDKA 3L26A 2ERWA 3AOGA 4DR4M 4PDGA 3VFDA 1VEKA 2R45A 2D7HA 1TH3A 1PJTA 1GJTA 4JI2M 3K1JA 4KODA 3LVWA 5FTJA 2CWBA 5ITTA 4B7FA 2J87A 3U6EA 1OJLA 2DAIA 5BPVA 4PD2A 1MT1A 3U60B 1J09A 4L4UA 3TO9A 1N75A 1V92A 4FCVA 4IIWA 3FE3A 3PNYA 2GKRI 4PT5A 2VQEM 3KY9A 4A24A 5GKNA 3UMMA 1K7UA 1ZAEA 3FTEA 3VK7A 3U6MA 3FUXA 1DGGA 2QQ8A 4KO8A 2DZOB 3LMMA 3A42A 2CHQA 3GLHB 3TWMA 2XGNA 2DKVA 1OVOA 2CWHA 1WTJA 4FWGA 2RGOA 1CE3A 1TOTA 1YTPA 2DZNB 3NBIA 1SXJC 2JZ1A 2F3CI 1J7KA 3A46A 1DS3I 3DZDA 1DDEA 3MHVC 3RGSA 1SGYI 3HHWA 2ORVA 3B9PA 4DV1M 2G5GX 4GITA 1WGLA 4NRVA 1SXJB 2L2DA 3IHPA 5E26A 2LEOA 3UJNA 4HGUA 3U5ZA 1YSYA 4B6DA 5IT9S 2R62A 1TDZA 1N77A 2WSFF 4I8OA 2M5XA 2MH8A 1OQYA 2VRWB 4UXHA 3U6DA 1F4IA 2JZMA 1G3IA 2QHOB 1TH2A 1NHGC 3D8BA 5IWAM 2OZUA 4IBDA 2LTUA 4IBFA 2JA1A 1IBKM 3JAMS 1L2CA 2Y21A 1H6UA 5H37D 2JXDA 1BUSA 3GRRA 4Z8XA 1GABA 3FTDA 3L2AA 3SAUA 2C9OA 2JNHA 5F3WA 4X66M 3EIHA 4GMQA 2KNAA 5EP4A 4DR7M 1C7YA 1NVMA 1K82A 4LZZA 2XH9A 7CATA 3J2PB 3FRIA 2B8TA 4DUZM 1EIJA 1H0ZA 2L09A 1X4SA 1PJJA 1M8BA 1HPTA 2R4EA 2X49A 2R18A 3HU1A 4GHAA 4B3TM 4HEOA 2JUJA 3C58A 1OTRA 1HR0M 2NU2I 1ZMVA 2M5ZA 1ULKA 3IECA 1N34M 2L7XA 1Y8FA 1YE9A 1NXUA 4KLNA 2W0TA 2J9RA 4LGYA 3R5CA 7WGAA 4NSOB 3K2LA 3H4MA 4RF1A 2JY6B 3SMPA 4SGBI 3KS8A 1XHBA 2A20A 1XX6A 4AZFA 3GLIA 3M6AA 3OL0A 4G6ZA 1DV0A 1R79A 1HNXM 1HEVA 4RKUF 1DGBA 3UK6A 1OIZA 4EE1A 2N71A 4QNRA 2C96A 2LBCA 1CT4I 3PDNA 4L78A 5HQ8A 3TWKA 4MH0E 1W3SA 1DO2A 4DV0M 5ITXA 3TE6A 3CF0A 2G3QA 2F5QA 4DV7M 2J7OA 2HCBA 5BR8M 2R4JA 3HZJA 3W68A 2DZLA 1OMTA 4DV6M 1P9GA 2YQZA 1NV9A 8CATA 4JN6A 4LJ7A 4IBIA 1Y1CA 3W67A 2R65A 3I4VA 4K0KM 1PJIA 1ULNA 4CGYB 1PJQA 2JY7A 5ITRA 3KP0E 1PCEA 2CV2A 5C18A 3LQRA 1LV7A 4JCVE 1XXHE 3UEYA 2LVQD 1VG5A 2OPFA 1OAIA 2GKTI 4L6V6 4PDIA 2C98A 2FFJA 1OYVI 2KW0A 5DAEA 5JHWC 1QZEA 1IW4A 2UXCM 5FUWA 1NY5A 5EXPA 4GI3C 2CHVA 3KVWA 5EXTA 3SGQI 4F2LA 1P3QQ 2F4VM 1N13A 5E6JA 3R5AA 1IBMM 2OO9A 1T3TA 2YFQA 2BWEA 3E59A 1AUAA 3RFWA 1D2NA 2LHGA 2LWXA 3E9SA 1IY6A 2OQ4A 1PPFI 2DWLA 2Y0TA 3CXLA 1XWIA 4XK8F 3GO8A 2QSFX 1BVSA 1I4WA 5C1BA 3RGPA 4KHPM 1L2DA 2QBYA 1NJFA 2ZAMA 1IXZA 1HJAI 4LY6A 4FKDA 1AN1I 1GL7A 1M8CA 3BOSA 1QANA 3AJIB 2Z7JA 1S3SA 5J8CA 3QYBA 1IN7A 2MR9A 3GOXA 1TGUA 4GHLA 1VDLA 3HGIA 4OVZB 1UM8A 2XSZA 3KOYE 1HNWM 1XXHB 5IREB 3KFUG 2CHGA 3PVSA 1JR3E 3GLHA 1WXQA 2GKVA 3J27B 4E1PA 1WR1B 4B7GA 2KRUA 4IJEA 4FWHA 4IBJA 1OAOC 3C9PA 5FTMA 1IBLM 1PJSA 4UXIA 4F1IA 4A3VB 2ARPF 4IBCA 3L27A 1FYBA 3SAVA 1W5TA 2NU1I 3F92A 3GQ4A 4EDRA 2K6BA 4YHHM 1SGQI 1IY2A 3UOEA 2N1AB 3L28A 1WGNA 1OMUA 4EIWA 2FS1A 1SXJA 1HNZM 3U6SA 1SGRI 4NXNM 3T6PA 2LH0A 3ZCBB 1SGPI 1PRBA 1ZMWA 1K3WA 1R0RI 1CGJI 2LUYA 1SGDI 4I5SA 1DGHA 3MK6A 1TBOA 3QWPA 3KOWE 1LR9A 3WHLA 1JQJC 2Z8YM 2Q2EB 4KT0F 4LFBM 4P17A 3HU2A 2F5SA 5LMNM 2ZTDA 3QWLA 3A98B 1Q3CA 3IG8A 1NUBA 1G41A 1TTEA 2DAMA 3E21A 2ERCA 1XNQM 3SHGB 3T1HM 1WJ7A 3KDSE 4WP4A 1TF0B 3BJIA 5FTNA 2XZUA 3SASA 2AHMA 1ZQ9A 1G4AE 4OX9M 2V1CC 3AV0A 3J7BA 3GPPA 1Z59A 1UHAA 4QHTA 3Q8XA 4XGIA 4RF0A 2J5YA 4L15A 3U6PA 2KEBA 2G8LA 3HU3A 2YR0A 3MEKA 4NSRA 4NRWA 1ZV1A 2VF7A 3HJSA 4LG2A 1W5SA 2C9CA 1DS2I 1TURA 3FC3A 2QPAA 1QZMA 3OXFA 1WKXA 2R46A 2DKLA 4Y28F 2AU3A 4M9SA 2KMQA 4GC9A 1Z5CA 3UGJA 4MGIE 3GQ3A 1R2YA 3SEKC 4LJ4A 1UFZA 2CJSC 4E2KA 3TJQA 4G3OA 4JI0M 2ZAOA 3U6QA 3FYCA 4II7A 1QDTA 1R5LA 5A2QS 1XNRM 5HI7A 4D80A 3GQ5A 1U5KA 4IBBA 4OW0A 3FSXA 4Z6YA 3AL0C 3OVOA 2SGEI 2DIPA 2QCUA 3GRYA 4NC6A 1IY0A 4L16A 2ENZA 1A5TA 2K47A 4IJFA 5EP2A 1YU6C 2P6AC 3KP1E 3HH2C 4I81A 3LCUA 3PXGA 3TQSA 2VQFM 3JR5A 1PGYA 5EP3A 2JA2A 2LVOC 2L7HA 4NXMM 2ZBKB 1OIPA 3TOBA 3KW6A 4G4QA 2SGPI 3QAHA 1N78A 1GJSA 2LVNC 1TBQR 2XZFA 1FJGM 3MJ5A 3GLFA 1DO0A 4GC5A 1EFUB 3SARA 2GVIA 3CF2A 1XB2B 4LF8M 4DNCA 5KPTA 2UUBM 2QQCA 4DR5M 1YUBA 2DWMA 2W82A 3FUVA 4LRTA 4DR2M 1OKSA 1W4RA 5GUJA 3T15A 1BMOA 2DAGA 4LF7M 4B7HA 2O01F 5FUYA 1MJGM 3M7GA 4FCTA 1QUSA 4X65M 3LW5F 3TWLA 3QYEA 2MGWA 5EX0A 4YY3M 2X3TA 1L1ZA 2FE8A 3LQQA 1TH4A 3R9XB 4LF5M 2KNVA 3C3DA 5KQDA 5EJCA 1IQPA 2B0UC 1I94M 3DOAA 1JR3D 4ITQA 4LJ8A 1PTQA 1PM5A 1G8PA 1Q39A 1SGNI 3TPZA 1GO5A 2SGDI 3B74A 1MJ9A 1Z5BA 2ELIA 4OU7A 1WIVA 3M0EA 3GLIE 1TBRR 2EUCA 3GLGA 3E4RA 1MJBA 2XFSA 1K7VA 2SGFI 3FUUA 3E2IA 2HAKA 1TGSI 3LVVA 5FUXA 4JI6M 4AMLA 5JI3E 5LMUM 2V1UA 3L29A 2MJ5B 2UUCM 3CGWA 5FTLA 2UXBM 1IN6A 2E5LM 1YLAA 2HL7A 4JI7M 4WURA 5EP1A 4AKHA 1GVNA 4MGKE 3FRHA 4NOOB 1QAMA 3I4YA 3GP1A 2BUSA 3AFHA 3GPYA 2QQDA 2R44A 2JP7A 2KXEA 1XC8A 2LVPC 4FWDA 3HWSA 4OVOA 1V34A 2WZJA 4S12A 3K9PA 4JI5M 4JCVA 3C3EA 4LJAA 1MJAA 1HQYE 4ZPXA 4FVMA 4CIZA 2ZM6M 4M9ZA 3HY5A 3HHZA 3DA1A 5E3PA 2OOBA 1T6OA 3U61A 4FW9A 1R6BX 3WHKA 1S20A 1X37A 2X8AA 2Y0QA 3I01M 1QYRA 1CHOI 4DV5M 4TUWA 1IXSA 1QDRA 4XBOA 2PQ8A 2ROWA 1D0LA 2I5RA 3KXEC 2LHCA 3HKPA 3GLIB 1QUTA 2X4AA 2QENA 3SMSA 1Z2IA 4GKKM 2KMPA 4PCZA 3JR4A 2DENA 9WGAA 3NBXX 1NJGA 2KDLA 3R8FA 3ZQJA 1R7RA 1NNJA 2APLA 2SGQI 1CT0I 1DGFA 4LZJA 3UEJA 2D7GA 2JWSA 1RFHA 1G59A 5CCLA 1QAOA 3J7AS 2DWZB 1EE8A 3U60A 2LXEA 1CSOI 2CP8A 2FCJA 3AOEC 5DYGA 4P16A 1FARA 3GRVA 4LFCM 2KA6B 2CWGA 2CV1A 2C99A 4R71A 1P9ZA 2Z4RA 2CWFA 4L9MA 4W5WA 2V1CA 2N17A 4AKIA 4LF6M 1JB0F 4AG6A 4WP2A 3OTOM 2R0IA 4B08A 4JV5M 3BXWA 3HJ8A 3VDUA 4M0DA 1Y1BA 1IY1A 4HLQA 2EO2A 5ITYA 4MGHA 4FCWA 4M0WA 5FLXS 4UXJA 1OFHA 4HL4A 1IN8A 3CF6E 1E94E 2UUAM 4LJ5A 1CT2I 2JYYA 3SATA 3L25A 3KSJA 2CFOA 1VQ1A 2JZ0A 3FUWA 3FSYA 5EX3A 1IY5A 3U6CA 4EDVA 1KYIA 4D82A 2X52A 4LF9M 3PNVA 2GQFA 1FAQA 5DYIA 3B89A 5FUVA 4X64M 1CUKA 2DWNA 3MMPA 2OOAA 1L8QA 3HX3A 2CE7A 3TO7A 3R5DA 1IXRC 2FNAA 1NV8A 1LTMA 3VKGA 2Z3XA 2RKOA 3BBZA 3E46A 3KOXE 4L8RC 2C5RA 1RU3A 4BLCA 3U6LA 4REZA 2QQEA 5J8FA 4JYAM 3SHFA 2KMOA 1CGII 3QAUA 2ORWA 2QBYB 1Z5AA 3ILKA 4LF4M 3SAWA 4GRIA 1KSFX 2F5OA 4B3MM 1D3YA 4BBAA 1VEGA 2UZ3A 1XMOM 2RC4A 3UGLA 1HJPA 3B4VC 1N36M 2KNZA 2LB7A 2CV0A 4MGZE 3K8ZA 4DV2M 2CEAA 2WSCF 3KSXA 1N32M 4G4RA 1MN3A 2M60A 2NU4I 2L6OA 1TDHA 4DUYM 1V33A 3ZC7B 2EJSA 1AIPC 5EXXA 1IM2A 2JY5A 4DV3M 1R2ZA 2H1RA 4GKJM 1R4GA 4Q7JA 5DFLA 2L8EA 3B39A 2DAKA 3B7ZA 1XA6A 5EQTA 5FTKA 1L2BA 1PJUA 2DHRA 5IZ7D 1K7TA 3HJQA 4IBGA 1NHWC 1TBNA 2DB6A 4G4NA 2DAEA 1Z6TA 1DGHB 2F5PA 2XF3A 3UZUA 3OXGA 3RE8A 2DVWB 1NO1A 1HQCA 2RRUA 2KCXA 4DR1M 1FNNA 2RIJA 1Z7KB 2BJVA 3RU0A 3FYDA 3D00A 1QVRA 4JI1M 1LR7A 1DD9A 2D7EA 1PTRA 3UFFA 3U6OA 3V76A 1OFIA 4RNAA 4AKGA 1Q9BA 2XLJA 1WHCA 3SFZA 3A45A 3SYLA 4BB9A 3GLFE 2YQPA 1HDLA 2WVJA 1N33M 3T38A 2ODDA 4FD2A 2BWBA 2XRCA 4DR6M 2BNKA 5JI2E 2Z4SA 4LGMA 2JW6A 1K3XA 4AW4A 4X62M 2HHHM 2FOIC 3D8LA 3J80S 4GIPA 2O25A 1D0KA 5EXSA 2OVOA 2XSZD 3TO6A 2BJWA 2E5RA 1WGTA 3K92A 3FUTA 5KPZA 2K0BX 4LCBA 3J81S 2K9DA 3U5ZB 2DXIA 2KHHA 2ENNA 4QOSA 3VKHA 5FSWA 1VEJA 2R6FA 4MGYE 1KMAA 4UN2B 2NQ8C 3GLGE 1MX0A 4DV4M 4QNMA 4R3DA 2GIVA 3FD9A 3VE5A 2YNMD 4E1RA 1SXJD 4DR3M 5ITXE 3NWLA 3W0FA 5KO3A 3I51A 3VDPA 3CTWB 2WSEF 3OXLA 3SBJA 4OVZA 1Q3BA 2OU2A 2HWJA 1G71A 4GH9A 2N52A 1E32A 1J5EM 2VDBB 1V1HA 1KFVA 2RGHA 4I4LA 2KRKA 5E3RA 1HT1E 3GPUA 1VDDA 4B3RM 4MM3B 2DI0A 3AOEA 3GLFB 4LJ6A 1XXHA 2KZUA 3FTFA 4LFAM 1TUSA 3DFZA 1UVFA 3VLFB 2B3TA 2H5XA 1SGEI 2HKJA 4CJ6A 2DHYA 1XBTA 3R5BA 1KBFA 1IFYA 2L4FA 3FTCA 2K9HA 2UXDM 2XEPA 4QHSA 2CUZA 1V1IA 3KS4A 4GEWA 1Y8GA 4O6PB 1IN5A 4JI3M 3ZH9B 3LCVB 2LNHC 1FY7A 3GPXA 2KMRA 3EIEA 3H4JA 5CCMA 2P5TA 3SYKA 4AQYM 2KZSA 1ORYB 1X74A 2EKKA 3B7NA 2E73A 5ITUA 5E3QA 3HHYA 1T43A 5ITQA 1C1KA 4DBGB 2Q2EA 3FKEA 2EKFA 1E9RA 3GLGB 2JXNA 4LRSA 2GNOA 2I7NA 2I7PA 3KOZE 2ZTCA 1LR8A 3Q8GA 5KQ8A 4LJ9A 4NL4H 2LVAA 2A5YB 1Q02A 4M9XA 1EQNA 2XFTA 3TL4X 1UUCA 2QP9X 1KBEA 4D81A 3GRUA 4MB7A 3QTLD 2DNAA 1ULMA 2QPOA 2Y0MA 1NY6A 3T1YM 3K9OA 4CHTB 4MPIA 3VK8A 1T6T1 2CRUA 4B3SM 3TOAA 1IN4A 2QQ0A 1TR8A 1JR3A 1WGCA 2FH0A 2QZ4A 4R7GA 3SGBI 3GLHE 1NNUC 3PFIA 4JI8M 2V53A 1MU5A 2FNFX 1GL6A 2WCYA 4AG5A 4EDGA 4QOZC 2O5RA 1L1TA 3UGDA 2Y20A 3W0LB 2NU0I 1QQWA 1E9SA 1NSFA 3SC3A 2OD1A 1ZMUA 2J7NA 5KPRA 1HT2E 4ANRA 3U61B 2L4EA 4CISA 3AKZA 1SXJE 2UVOA 3I04M 1D0MA 4JXJA 4EDTA 1GLNA 2UU9M 2EA0A
chains in the Genus database with same CATH topology
1QAQA 2YFQA 2F5NA 2SGDI 3UGIA 3E59A 5EQTA 1UVGA 1Z5BA 5FTKA 4O6OA 2ELIA 1L2BA 1PJUA 3RFWA 4OU7A 1D2NA 1IXSB 2DHRA 5IZ7D 2YUUA 3HJQA 3M0EA 4IBGA 1NHWC 3E9SA 2LWXA 1TBNA 1IY6A 2DB6A 1TBRR 2OQ4A 1TIHA 4G4NA 4AI6A 1XMQM 2V6ZM 1PPFI 2EUCA 4G4OA 2ZANA 3GLGA 3E4RA 4IBEA 1GKIA 2DWLA 3HHXA 2Y0TA 2XFSA 5DNYA 1Z6TA 1DGHB 3THGA 2F5PA 2SGFI 2NU3I 3FUUA 3E2IA 2XF3A 3UZUA 3CXLA 3OXGA 3RE8A 1SGNI 1XWIA 2DVWB 4JI4M 3IG5A 2L7IA 4IBKA 1HQCA 3GO8A 2KCXA 1TGSI 3LVVA 4DR1M 5FUXA 1FNNA 4JI6M 2VIIA 5JI3E 2ZBKA 4WW0A 4EDKA 3L26A 1I4WA 5LMUM 2V1UA 2ERWA 3L29A 5C1BA 3RGPA 4KHPM 1L2DA 1Z7KB 2BJVA 3RU0A 3AOGA 1NJFA 2QBYA 2ZAMA 1IXZA 2UUCM 4DR4M 1HJAI 4LY6A 4PDGA 3FYDA 5FTLA 2UXBM 4FKDA 3D00A 3VFDA 2R45A 1AN1I 1GL7A 1QVRA 2D7HA 1IN6A 1TH3A 3BOSA 1QANA 1M8CA 3AJIB 4JI1M 1LR7A 4JI2M 1DD9A 3K1JA 2E5LM 2D7EA 1PTRA 3UFFA 4KODA 2Z7JA 3LVWA 1S3SA 2HL7A 5FTJA 4JI7M 3U6OA 1IN7A 4WURA 5EP1A 5ITTA 4AKHA 3GOXA 1GVNA 4B7FA 4MGKE 2J87A 1OFIA 1TGUA 3U6EA 4GHLA 1OJLA 4NOOB 1QAMA 5BPVA 4PD2A 1MT1A 3I4YA 1J09A 4L4UA 3HGIA 4OVZB 3GP1A 3U60B 1N75A 4RNAA 4AKGA 2BUSA 3AFHA 4FCVA 2XLJA 3GPYA 2QQDA 2KXEA 3SFZA 3A45A 4IIWA 3SYLA 3PNYA 4BB9A 2GKRI 4PT5A 2VQEM 2YQPA 1XC8A 3KY9A 1HDLA 4A24A 1UM8A 5GKNA 3UMMA 4FWDA 1ZAEA 3HWSA 3FTEA 4OVOA 2XSZA 3KOYE 3VK7A 3U6MA 3FUXA 2WVJA 4S12A 1N33M 3T38A 2ODDA 4JI5M 4JCVA 1DGGA 4FD2A 1HNWM 1XXHB 4KO8A 5IREB 2DZOB 3KFUG 3LMMA 2CHGA 4LJAA 2XRCA 3PVSA 1HQYE 3A42A 3GLHA 2CHQA 4DR6M 2BNKA 4ZPXA 1WXQA 3GLHB 5JI2E 2XGNA 3TWMA 1OVOA 4FVMA 2Z4SA 2GKVA 4LGMA 2JW6A 3J27B 4E1PA 4B7GA 2KRUA 4IJEA 4FWHA 4IBJA 1K3XA 2ZM6M 4M9ZA 4FWGA 4AW4A 3DA1A 3HHZA 4X62M 2HHHM 2FOIC 2RGOA 1CE3A 3D8LA 5FTMA 1IBLM 3J80S 1TOTA 1YTPA 4GIPA 4UXIA 2DZNB 3NBIA 1SXJC 4A3VB 2ARPF 4IBCA 3U61A 2F3CI 4FW9A 1J7KA 3L27A 3A46A 1DS3I 3DZDA 1R6BX 1DDEA 5EXSA 3WHKA 1FYBA 3SAVA 1W5TA 3MHVC 2NU1I 3RGSA 1X37A 3GQ4A 1SGYI 2X8AA 2Y0QA 4EDRA 3HHWA 4YHHM 2OVOA 1SGQI 2ORVA 2XSZD 3B9PA 4DV1M 1IY2A 1QYRA 2N1AB 2G5GX 3L28A 4GITA 1OMUA 4EIWA 2BJWA 1SXJA 4NRVA 1HNZM 1CHOI 3U6SA 2E5RA 1SXJB 4DV5M 1SGRI 5E26A 2LEOA 3UJNA 3K92A 4NXNM 3ZCBB 2LH0A 4TUWA 1SGPI 4XBOA 3FUTA 5KPZA 4HGUA 1K3WA 3U5ZA 1YSYA 4B6DA 4LCBA 3J81S 5IT9S 3U5ZB 2DXIA 2ROWA 2R62A 1TDZA 1R0RI 1CGJI 2ENNA 2LUYA 1N77A 4I5SA 1SGDI 4I8OA 2M5XA 1DGHA 3MK6A 4QOSA 2VRWB 3KXEC 3HKPA 1TBOA 3VKHA 5FSWA 3GLIB 2X4AA 2QENA 3SMSA 3QWPA 4UXHA 4GKKM 3KOWE 2KMPA 3U6DA 4MGYE 1KMAA 4PCZA 1LR9A 3WHLA 2NQ8C 3JR4A 1JQJC 1MX0A 4DV4M 2JZMA 4QNMA 2Q2EB 4R3DA 1G3IA 4LFBM 1TH2A 1NHGC 1NJGA 3FD9A 3HU2A 3R8FA 2YNMD 2F5SA 5LMNM 3VE5A 3D8BA 5IWAM 4E1RA 4IBDA 4IBFA 3QWLA 3A98B 1Q3CA 1R7RA 2JA1A 1IBKM 3IG8A 1NNJA 3JAMS 1SXJD 1L2CA 4DR3M 2SGQI 5ITXE 1CT0I 3NWLA 1G41A 1NUBA 2Y21A 1DGFA 4LZJA 1H6UA 3W0FA 3UEJA 5KO3A 3I51A 2D7GA 3VDPA 5H37D 2JXDA 1BUSA 3GRRA 4Z8XA 3CTWB 2ERCA 1XNQM 3FTDA 1G59A 3SHGB 3L2AA 1RFHA 3SAUA 5CCLA 2C9OA 3T1HM 1QAOA 3OXLA 3J7AS 3SBJA 2DWZB 1EE8A 3U60A 2LXEA 4OVZA 1CSOI 1Q3BA 5F3WA 4X66M 3KDSE 3BJIA 3AOEC 5DYGA 5FTNA 4GH9A 4P16A 2N52A 3EIHA 1E32A 2XZUA 1J5EM 3SASA 1FARA 1V1HA 2AHMA 1KFVA 1ZQ9A 3GRVA 4GMQA 1G4AE 4OX9M 2V1CC 2RGHA 5EP4A 3AV0A 3J7BA 4I4LA 4DR7M 4LFCM 3GPPA 1Z59A 2KRKA 1HT1E 1NVMA 2KA6B 4QHTA 3Q8XA 3GPUA 1K82A 1VDDA 2CV1A 4LZZA 2XH9A 7CATA 2C99A 4B3RM 3J2PB 2Z4RA 4MM3B 3AOEA 3GLFB 4LJ6A 2B8TA 4DUZM 1XXHA 4XGIA 2KZUA 4RF0A 3FTFA 4L9MA 4LFAM 4L15A 1H0ZA 2L09A 4W5WA 3U6PA 2KEBA 1TUSA 1X4SA 2V1CA 1PJJA 2N17A 3DFZA 4AKIA 2G8LA 4LF6M 1M8BA 1UVFA 3HU3A 1HPTA 2R4EA 4AG6A 3VLFB 2X49A 2R18A 3HU1A 2YR0A 4GHAA 1SGEI 3MEKA 3OTOM 4NSRA 4NRWA 4B08A 4JV5M 4B3TM 3HJ8A 3VDUA 4M0DA 1Y1BA 1IY1A 2HKJA 1XBTA 4HLQA 3HJSA 2EO2A 5ITYA 3C58A 4LG2A 1KBFA 4MGHA 4FCWA 4M0WA 3FTCA 1W5SA 2C9CA 5FLXS 1HR0M 2UXDM 2K9HA 2NU2I 1DS2I 2XEPA 4QHSA 1TURA 4UXJA 3FC3A 2QPAA 1QZMA 1OFHA 2CUZA 1V1IA 4HL4A 3OXFA 3KS4A 2M5ZA 2R46A 1IN8A 4O6PB 1IN5A 3CF6E 1N34M 2L7XA 2AU3A 4JI3M 1E94E 2UUAM 4M9SA 1Y8FA 2KMQA 3ZH9B 4GC9A 1YE9A 1Z5CA 3UGJA 2LNHC 4LJ5A 4MGIE 3GQ3A 3GPXA 1CT2I 2JYYA 3SATA 2KMRA 3EIEA 3L25A 1R2YA 3SEKC 3KSJA 4KLNA 5CCMA 4LJ4A 2CJSC 2CFOA 2P5TA 2W0TA 4E2KA 3TJQA 2J9RA 4LGYA 3SYKA 3FUWA 4AQYM 4NSOB 5EX3A 3K2LA 1IY5A 3U6CA 3H4MA 4RF1A 3SMPA 4JI0M 2ZAOA 3U6QA 2KZSA 3FYCA 4EDVA 1ORYB 4II7A 4SGBI 3KS8A 1KYIA 4D82A 1XHBA 2A20A 1XX6A 4AZFA 3GLIA 5A2QS 1X74A 4LF9M 3PNVA 1XNRM 2E73A 5HI7A 3M6AA 4D80A 3OL0A 3GQ5A 4G6ZA 5ITUA 1FAQA 5DYIA 3HHYA 1R79A 5FUVA 5ITQA 4X64M 1U5KA 1C1KA 4IBBA 1HNXM 4OW0A 2DWNA 2Q2EA 3FKEA 4Z6YA 1L8QA 3AL0C 1DGBA 3UK6A 2CE7A 3OVOA 2SGEI 2DIPA 4EE1A 2QCUA 3GRYA 1IXRC 2N71A 4QNRA 1E9RA 2C96A 2FNAA 1CT4I 3PDNA 4L78A 3GLGB 1IY0A 4L16A 2ENZA 2K47A 4IJFA 3VKGA 5EP2A 1YU6C 2Z3XA 2P6AC 4LRSA 5HQ8A 2RKOA 3KP1E 3TWKA 3HH2C 4I81A 3PXGA 4MH0E 3KOXE 2I7NA 2I7PA 3TQSA 4L8RC 1W3SA 2C5RA 1DO2A 3KOZE 2VQFM 4DV0M 4BLCA 3U6LA 3JR5A 5ITXA 3TE6A 4REZA 2QQEA 3CF0A 5EP3A 1LR8A 2JA2A 5KQ8A 2L7HA 4LJ9A 4NL4H 2ZBKB 4NXMM 4JYAM 3SHFA 2KMOA 3KW6A 1CGII 3QAUA 4G4QA 2ORWA 2F5QA 2A5YB 2SGPI 4M9XA 1EQNA 4DV7M 2QBYB 2XFTA 1Z5AA 2J7OA 3ILKA 4LF4M 2HCBA 5BR8M 1N78A 2R4JA 3TL4X 1UUCA 2QP9X 1KBEA 4D81A 3GRUA 3SAWA 1OMTA 4GRIA 4MB7A 1TBQR 1KSFX 4DV6M 2YQZA 2XZFA 2F5OA 8CATA 3QTLD 1FJGM 4JN6A 2QPOA 4LJ7A 3MJ5A 1NY6A 4IBIA 4BBAA 3T1YM 4B3MM 1Y1CA 1D3YA 3GLFA 2UZ3A 4CHTB 2R65A 3I4VA 3VK8A 1T6T1 1DO0A 4GC5A 1XMOM 4B3SM 3UGLA 4K0KM 3SARA 1PJIA 2GVIA 1N36M 3B4VC 3CF2A 1IN4A 4CGYB 5ITRA 4LF8M 3KP0E 2QQ0A 1PCEA 5KPTA 2CV2A 5C18A 3LQRA 2CV0A 2UUBM 1LV7A 2QQCA 4JCVE 4DR5M 1YUBA 4MGZE 2DWMA 3UEYA 1JR3A 3K8ZA 4DV2M 2CEAA 2QZ4A 2W82A 3FUVA 4R7GA 2OPFA 3SGBI 4LRTA 4DR2M 1W4RA 5GUJA 3T15A 1NNUC 3KSXA 1N32M 1BMOA 4G4RA 3PFIA 4LF7M 4B7HA 2GKTI 4PDIA 4JI8M 5FUYA 2C98A 2FFJA 2V53A 1MU5A 2FNFX 3M7GA 2M60A 2NU4I 4FCTA 2L6OA 1TDHA 1OYVI 1GL6A 2KW0A 2WCYA 4X65M 5DAEA 3TWLA 4AG5A 4DUYM 4EDGA 4QOZC 5EX0A 2O5RA 5JHWC 3ZC7B 4YY3M 1IW4A 5EXXA 2UXCM 1L1TA 3UGDA 1L1ZA 2FE8A 2Y20A 1IM2A 3W0LB 3LQQA 1TH4A 2NU0I 3R9XB 4DV3M 1R2ZA 1QQWA 5FUWA 1E9SA 1NSFA 1NY5A 2H1RA 3SC3A 4LF5M 2OD1A 5EXPA 4GI3C 2J7NA 5KQDA 5KPRA 2CHVA 3KVWA 1HT2E 5EXTA 3SGQI 5EJCA 4GKJM 1IQPA 2B0UC 2F4VM 3U61B 1I94M 4CISA 1N13A 3AKZA 3DOAA 5E6JA 1JR3D 1SXJE 4ITQA 4LJ8A 1PTQA 2L8EA 4JXJA 1PM5A 1IBMM 4EDTA 1GLNA 1T3TA 2UU9M 3B39A 1G8PA 2EA0A 1XA6A 1Q39A 3TPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6O A;  3VDP A;  1VDD A;  1D3Y A;  5GUJ A;  2Q2E A;  4E2K A;  2ZBK A;  4JCV A;  4EDK A;  1T6T 1;  3VE5 A;  4EE1 A;  2V1C A;  1EQN A;  1DDE A;  4EDV A;  3D00 A;  4O6P B;  4EDG A;  4EDR A;  2AU3 A;  4EDT A;  3B39 A;  1DD9 A;  3VDU A; 
#chains in the Genus database with same CATH topology
 1QAQ A;  2F5N A;  3UGI A;  4O6O A;  1UVG A;  1IXS B;  2YUU A;  3B7Q A;  1TIH A;  4AI6 A;  1XMQ M;  2V6Z M;  4G4O A;  2ZAN A;  4IBE A;  1GKI A;  3HHX A;  5DNY A;  2MRO B;  2N35 A;  3THG A;  2NU3 I;  2JY8 A;  1SG9 A;  4JI4 M;  3IG5 A;  2L7I A;  4IBK A;  2VF8 A;  2WGC A;  2QNJ A;  5L8R F;  2VII A;  2ZBK A;  4WW0 A;  4EDK A;  3L26 A;  2ERW A;  3AOG A;  4DR4 M;  4PDG A;  3VFD A;  1VEK A;  2R45 A;  2D7H A;  1TH3 A;  1PJT A;  1GJT A;  4JI2 M;  3K1J A;  4KOD A;  3LVW A;  5FTJ A;  2CWB A;  5ITT A;  4B7F A;  2J87 A;  3U6E A;  1OJL A;  2DAI A;  5BPV A;  4PD2 A;  1MT1 A;  3U60 B;  1J09 A;  4L4U A;  3TO9 A;  1N75 A;  1V92 A;  4FCV A;  4IIW A;  3FE3 A;  3PNY A;  2GKR I;  4PT5 A;  2VQE M;  3KY9 A;  4A24 A;  5GKN A;  3UMM A;  1K7U A;  1ZAE A;  3FTE A;  3VK7 A;  3U6M A;  3FUX A;  1DGG A;  2QQ8 A;  4KO8 A;  2DZO B;  3LMM A;  3A42 A;  2CHQ A;  3GLH B;  3TWM A;  2XGN A;  2DKV A;  1OVO A;  2CWH A;  1WTJ A;  4FWG A;  2RGO A;  1CE3 A;  1TOT A;  1YTP A;  2DZN B;  3NBI A;  1SXJ C;  2JZ1 A;  2F3C I;  1J7K A;  3A46 A;  1DS3 I;  3DZD A;  1DDE A;  3MHV C;  3RGS A;  1SGY I;  3HHW A;  2ORV A;  3B9P A;  4DV1 M;  2G5G X;  4GIT A;  1WGL A;  4NRV A;  1SXJ B;  2L2D A;  3IHP A;  5E26 A;  2LEO A;  3UJN A;  4HGU A;  3U5Z A;  1YSY A;  4B6D A;  5IT9 S;  2R62 A;  1TDZ A;  1N77 A;  2WSF F;  4I8O A;  2M5X A;  2MH8 A;  1OQY A;  2VRW B;  4UXH A;  3U6D A;  1F4I A;  2JZM A;  1G3I A;  2QHO B;  1TH2 A;  1NHG C;  3D8B A;  5IWA M;  2OZU A;  4IBD A;  2LTU A;  4IBF A;  2JA1 A;  1IBK M;  3JAM S;  1L2C A;  2Y21 A;  1H6U A;  5H37 D;  2JXD A;  1BUS A;  3GRR A;  4Z8X A;  1GAB A;  3FTD A;  3L2A A;  3SAU A;  2C9O A;  2JNH A;  5F3W A;  4X66 M;  3EIH A;  4GMQ A;  2KNA A;  5EP4 A;  4DR7 M;  1C7Y A;  1NVM A;  1K82 A;  4LZZ A;  2XH9 A;  7CAT A;  3J2P B;  3FRI A;  2B8T A;  4DUZ M;  1EIJ A;  1H0Z A;  2L09 A;  1X4S A;  1PJJ A;  1M8B A;  1HPT A;  2R4E A;  2X49 A;  2R18 A;  3HU1 A;  4GHA A;  4B3T M;  4HEO A;  2JUJ A;  3C58 A;  1OTR A;  1HR0 M;  2NU2 I;  1ZMV A;  2M5Z A;  1ULK A;  3IEC A;  1N34 M;  2L7X A;  1Y8F A;  1YE9 A;  1NXU A;  4KLN A;  2W0T A;  2J9R A;  4LGY A;  3R5C A;  7WGA A;  4NSO B;  3K2L A;  3H4M A;  4RF1 A;  2JY6 B;  3SMP A;  4SGB I;  3KS8 A;  1XHB A;  2A20 A;  1XX6 A;  4AZF A;  3GLI A;  3M6A A;  3OL0 A;  4G6Z A;  1DV0 A;  1R79 A;  1HNX M;  1HEV A;  4RKU F;  1DGB A;  3UK6 A;  1OIZ A;  4EE1 A;  2N71 A;  4QNR A;  2C96 A;  2LBC A;  1CT4 I;  3PDN A;  4L78 A;  5HQ8 A;  3TWK A;  4MH0 E;  1W3S A;  1DO2 A;  4DV0 M;  5ITX A;  3TE6 A;  3CF0 A;  2G3Q A;  2F5Q A;  4DV7 M;  2J7O A;  2HCB A;  5BR8 M;  2R4J A;  3HZJ A;  3W68 A;  2DZL A;  1OMT A;  4DV6 M;  1P9G A;  2YQZ A;  1NV9 A;  8CAT A;  4JN6 A;  4LJ7 A;  4IBI A;  1Y1C A;  3W67 A;  2R65 A;  3I4V A;  4K0K M;  1PJI A;  1ULN A;  4CGY B;  1PJQ A;  2JY7 A;  5ITR A;  3KP0 E;  1PCE A;  2CV2 A;  5C18 A;  3LQR A;  1LV7 A;  4JCV E;  1XXH E;  3UEY A;  2LVQ D;  1VG5 A;  2OPF A;  1OAI A;  2GKT I;  4L6V 6;  4PDI A;  2C98 A;  2FFJ A;  1OYV I;  2KW0 A;  5DAE A;  5JHW C;  1QZE A;  1IW4 A;  2UXC M;  5FUW A;  1NY5 A;  5EXP A;  4GI3 C;  2CHV A;  3KVW A;  5EXT A;  3SGQ I;  4F2L A;  1P3Q Q;  2F4V M;  1N13 A;  5E6J A;  3R5A A;  1IBM M;  2OO9 A;  1T3T A;  2YFQ A;  2BWE A;  3E59 A;  1AUA A;  3RFW A;  1D2N A;  2LHG A;  2LWX A;  3E9S A;  1IY6 A;  2OQ4 A;  1PPF I;  2DWL A;  2Y0T A;  3CXL A;  1XWI A;  4XK8 F;  3GO8 A;  2QSF X;  1BVS A;  1I4W A;  5C1B A;  3RGP A;  4KHP M;  1L2D A;  2QBY A;  1NJF A;  2ZAM A;  1IXZ A;  1HJA I;  4LY6 A;  4FKD A;  1AN1 I;  1GL7 A;  1M8C A;  3BOS A;  1QAN A;  3AJI B;  2Z7J A;  1S3S A;  5J8C A;  3QYB A;  1IN7 A;  2MR9 A;  3GOX A;  1TGU A;  4GHL A;  1VDL A;  3HGI A;  4OVZ B;  1UM8 A;  2XSZ A;  3KOY E;  1HNW M;  1XXH B;  5IRE B;  3KFU G;  2CHG A;  3PVS A;  1JR3 E;  3GLH A;  1WXQ A;  2GKV A;  3J27 B;  4E1P A;  1WR1 B;  4B7G A;  2KRU A;  4IJE A;  4FWH A;  4IBJ A;  1OAO C;  3C9P A;  5FTM A;  1IBL M;  1PJS A;  4UXI A;  4F1I A;  4A3V B;  2ARP F;  4IBC A;  3L27 A;  1FYB A;  3SAV A;  1W5T A;  2NU1 I;  3F92 A;  3GQ4 A;  4EDR A;  2K6B A;  4YHH M;  1SGQ I;  1IY2 A;  3UOE A;  2N1A B;  3L28 A;  1WGN A;  1OMU A;  4EIW A;  2FS1 A;  1SXJ A;  1HNZ M;  3U6S A;  1SGR I;  4NXN M;  3T6P A;  2LH0 A;  3ZCB B;  1SGP I;  1PRB A;  1ZMW A;  1K3W A;  1R0R I;  1CGJ I;  2LUY A;  1SGD I;  4I5S A;  1DGH A;  3MK6 A;  1TBO A;  3QWP A;  3KOW E;  1LR9 A;  3WHL A;  1JQJ C;  2Z8Y M;  2Q2E B;  4KT0 F;  4LFB M;  4P17 A;  3HU2 A;  2F5S A;  5LMN M;  2ZTD A;  3QWL A;  3A98 B;  1Q3C A;  3IG8 A;  1NUB A;  1G41 A;  1TTE A;  2DAM A;  3E21 A;  2ERC A;  1XNQ M;  3SHG B;  3T1H M;  1WJ7 A;  3KDS E;  4WP4 A;  1TF0 B;  3BJI A;  5FTN A;  2XZU A;  3SAS A;  2AHM A;  1ZQ9 A;  1G4A E;  4OX9 M;  2V1C C;  3AV0 A;  3J7B A;  3GPP A;  1Z59 A;  1UHA A;  4QHT A;  3Q8X A;  4XGI A;  4RF0 A;  2J5Y A;  4L15 A;  3U6P A;  2KEB A;  2G8L A;  3HU3 A;  2YR0 A;  3MEK A;  4NSR A;  4NRW A;  1ZV1 A;  2VF7 A;  3HJS A;  4LG2 A;  1W5S A;  2C9C A;  1DS2 I;  1TUR A;  3FC3 A;  2QPA A;  1QZM A;  3OXF A;  1WKX A;  2R46 A;  2DKL A;  4Y28 F;  2AU3 A;  4M9S A;  2KMQ A;  4GC9 A;  1Z5C A;  3UGJ A;  4MGI E;  3GQ3 A;  1R2Y A;  3SEK C;  4LJ4 A;  1UFZ A;  2CJS C;  4E2K A;  3TJQ A;  4G3O A;  4JI0 M;  2ZAO A;  3U6Q A;  3FYC A;  4II7 A;  1QDT A;  1R5L A;  5A2Q S;  1XNR M;  5HI7 A;  4D80 A;  3GQ5 A;  1U5K A;  4IBB A;  4OW0 A;  3FSX A;  4Z6Y A;  3AL0 C;  3OVO A;  2SGE I;  2DIP A;  2QCU A;  3GRY A;  4NC6 A;  1IY0 A;  4L16 A;  2ENZ A;  1A5T A;  2K47 A;  4IJF A;  5EP2 A;  1YU6 C;  2P6A C;  3KP1 E;  3HH2 C;  4I81 A;  3LCU A;  3PXG A;  3TQS A;  2VQF M;  3JR5 A;  1PGY A;  5EP3 A;  2JA2 A;  2LVO C;  2L7H A;  4NXM M;  2ZBK B;  1OIP A;  3TOB A;  3KW6 A;  4G4Q A;  2SGP I;  3QAH A;  1N78 A;  1GJS A;  2LVN C;  1TBQ R;  2XZF A;  1FJG M;  3MJ5 A;  3GLF A;  1DO0 A;  4GC5 A;  1EFU B;  3SAR A;  2GVI A;  3CF2 A;  1XB2 B;  4LF8 M;  4DNC A;  5KPT A;  2UUB M;  2QQC A;  4DR5 M;  1YUB A;  2DWM A;  2W82 A;  3FUV A;  4LRT A;  4DR2 M;  1OKS A;  1W4R A;  5GUJ A;  3T15 A;  1BMO A;  2DAG A;  4LF7 M;  4B7H A;  2O01 F;  5FUY A;  1MJG M;  3M7G A;  4FCT A;  1QUS A;  4X65 M;  3LW5 F;  3TWL A;  3QYE A;  2MGW A;  5EX0 A;  4YY3 M;  2X3T A;  1L1Z A;  2FE8 A;  3LQQ A;  1TH4 A;  3R9X B;  4LF5 M;  2KNV A;  3C3D A;  5KQD A;  5EJC A;  1IQP A;  2B0U C;  1I94 M;  3DOA A;  1JR3 D;  4ITQ A;  4LJ8 A;  1PTQ A;  1PM5 A;  1G8P A;  1Q39 A;  1SGN I;  3TPZ A;  1GO5 A;  2SGD I;  3B74 A;  1MJ9 A;  1Z5B A;  2ELI A;  4OU7 A;  1WIV A;  3M0E A;  3GLI E;  1TBR R;  2EUC A;  3GLG A;  3E4R A;  1MJB A;  2XFS A;  1K7V A;  2SGF I;  3FUU A;  3E2I A;  2HAK A;  1TGS I;  3LVV A;  5FUX A;  4JI6 M;  4AML A;  5JI3 E;  5LMU M;  2V1U A;  3L29 A;  2MJ5 B;  2UUC M;  3CGW A;  5FTL A;  2UXB M;  1IN6 A;  2E5L M;  1YLA A;  2HL7 A;  4JI7 M;  4WUR A;  5EP1 A;  4AKH A;  1GVN A;  4MGK E;  3FRH A;  4NOO B;  1QAM A;  3I4Y A;  3GP1 A;  2BUS A;  3AFH A;  3GPY A;  2QQD A;  2R44 A;  2JP7 A;  2KXE A;  1XC8 A;  2LVP C;  4FWD A;  3HWS A;  4OVO A;  1V34 A;  2WZJ A;  4S12 A;  3K9P A;  4JI5 M;  4JCV A;  3C3E A;  4LJA A;  1MJA A;  1HQY E;  4ZPX A;  4FVM A;  4CIZ A;  2ZM6 M;  4M9Z A;  3HY5 A;  3HHZ A;  3DA1 A;  5E3P A;  2OOB A;  1T6O A;  3U61 A;  4FW9 A;  1R6B X;  3WHK A;  1S20 A;  1X37 A;  2X8A A;  2Y0Q A;  3I01 M;  1QYR A;  1CHO I;  4DV5 M;  4TUW A;  1IXS A;  1QDR A;  4XBO A;  2PQ8 A;  2ROW A;  1D0L A;  2I5R A;  3KXE C;  2LHC A;  3HKP A;  3GLI B;  1QUT A;  2X4A A;  2QEN A;  3SMS A;  1Z2I A;  4GKK M;  2KMP A;  4PCZ A;  3JR4 A;  2DEN A;  9WGA A;  3NBX X;  1NJG A;  2KDL A;  3R8F A;  3ZQJ A;  1R7R A;  1NNJ A;  2APL A;  2SGQ I;  1CT0 I;  1DGF A;  4LZJ A;  3UEJ A;  2D7G A;  2JWS A;  1RFH A;  1G59 A;  5CCL A;  1QAO A;  3J7A S;  2DWZ B;  1EE8 A;  3U60 A;  2LXE A;  1CSO I;  2CP8 A;  2FCJ A;  3AOE C;  5DYG A;  4P16 A;  1FAR A;  3GRV A;  4LFC M;  2KA6 B;  2CWG A;  2CV1 A;  2C99 A;  4R71 A;  1P9Z A;  2Z4R A;  2CWF A;  4L9M A;  4W5W A;  2V1C A;  2N17 A;  4AKI A;  4LF6 M;  1JB0 F;  4AG6 A;  4WP2 A;  3OTO M;  2R0I A;  4B08 A;  4JV5 M;  3BXW A;  3HJ8 A;  3VDU A;  4M0D A;  1Y1B A;  1IY1 A;  4HLQ A;  2EO2 A;  5ITY A;  4MGH A;  4FCW A;  4M0W A;  5FLX S;  4UXJ A;  1OFH A;  4HL4 A;  1IN8 A;  3CF6 E;  1E94 E;  2UUA M;  4LJ5 A;  1CT2 I;  2JYY A;  3SAT A;  3L25 A;  3KSJ A;  2CFO A;  1VQ1 A;  2JZ0 A;  3FUW A;  3FSY A;  5EX3 A;  1IY5 A;  3U6C A;  4EDV A;  1KYI A;  4D82 A;  2X52 A;  4LF9 M;  3PNV A;  2GQF A;  1FAQ A;  5DYI A;  3B89 A;  5FUV A;  4X64 M;  1CUK A;  2DWN A;  3MMP A;  2OOA A;  1L8Q A;  3HX3 A;  2CE7 A;  3TO7 A;  3R5D A;  1IXR C;  2FNA A;  1NV8 A;  1LTM A;  3VKG A;  2Z3X A;  2RKO A;  3BBZ A;  3E46 A;  3KOX E;  4L8R C;  2C5R A;  1RU3 A;  4BLC A;  3U6L A;  4REZ A;  2QQE A;  5J8F A;  4JYA M;  3SHF A;  2KMO A;  1CGI I;  3QAU A;  2ORW A;  2QBY B;  1Z5A A;  3ILK A;  4LF4 M;  3SAW A;  4GRI A;  1KSF X;  2F5O A;  4B3M M;  1D3Y A;  4BBA A;  1VEG A;  2UZ3 A;  1XMO M;  2RC4 A;  3UGL A;  1HJP A;  3B4V C;  1N36 M;  2KNZ A;  2LB7 A;  2CV0 A;  4MGZ E;  3K8Z A;  4DV2 M;  2CEA A;  2WSC F;  3KSX A;  1N32 M;  4G4R A;  1MN3 A;  2M60 A;  2NU4 I;  2L6O A;  1TDH A;  4DUY M;  1V33 A;  3ZC7 B;  2EJS A;  1AIP C;  5EXX A;  1IM2 A;  2JY5 A;  4DV3 M;  1R2Z A;  2H1R A;  4GKJ M;  1R4G A;  4Q7J A;  5DFL A;  2L8E A;  3B39 A;  2DAK A;  3B7Z A;  1XA6 A;  5EQT A;  5FTK A;  1L2B A;  1PJU A;  2DHR A;  5IZ7 D;  1K7T A;  3HJQ A;  4IBG A;  1NHW C;  1TBN A;  2DB6 A;  4G4N A;  2DAE A;  1Z6T A;  1DGH B;  2F5P A;  2XF3 A;  3UZU A;  3OXG A;  3RE8 A;  2DVW B;  1NO1 A;  1HQC A;  2RRU A;  2KCX A;  4DR1 M;  1FNN A;  2RIJ A;  1Z7K B;  2BJV A;  3RU0 A;  3FYD A;  3D00 A;  1QVR A;  4JI1 M;  1LR7 A;  1DD9 A;  2D7E A;  1PTR A;  3UFF A;  3U6O A;  3V76 A;  1OFI A;  4RNA A;  4AKG A;  1Q9B A;  2XLJ A;  1WHC A;  3SFZ A;  3A45 A;  3SYL A;  4BB9 A;  3GLF E;  2YQP A;  1HDL A;  2WVJ A;  1N33 M;  3T38 A;  2ODD A;  4FD2 A;  2BWB A;  2XRC A;  4DR6 M;  2BNK A;  5JI2 E;  2Z4S A;  4LGM A;  2JW6 A;  1K3X A;  4AW4 A;  4X62 M;  2HHH M;  2FOI C;  3D8L A;  3J80 S;  4GIP A;  2O25 A;  1D0K A;  5EXS A;  2OVO A;  2XSZ D;  3TO6 A;  2BJW A;  2E5R A;  1WGT A;  3K92 A;  3FUT A;  5KPZ A;  2K0B X;  4LCB A;  3J81 S;  2K9D A;  3U5Z B;  2DXI A;  2KHH A;  2ENN A;  4QOS A;  3VKH A;  5FSW A;  1VEJ A;  2R6F A;  4MGY E;  1KMA A;  4UN2 B;  2NQ8 C;  3GLG E;  1MX0 A;  4DV4 M;  4QNM A;  4R3D A;  2GIV A;  3FD9 A;  3VE5 A;  2YNM D;  4E1R A;  1SXJ D;  4DR3 M;  5ITX E;  3NWL A;  3W0F A;  5KO3 A;  3I51 A;  3VDP A;  3CTW B;  2WSE F;  3OXL A;  3SBJ A;  4OVZ A;  1Q3B A;  2OU2 A;  2HWJ A;  1G71 A;  4GH9 A;  2N52 A;  1E32 A;  1J5E M;  2VDB B;  1V1H A;  1KFV A;  2RGH A;  4I4L A;  2KRK A;  5E3R A;  1HT1 E;  3GPU A;  1VDD A;  4B3R M;  4MM3 B;  2DI0 A;  3AOE A;  3GLF B;  4LJ6 A;  1XXH A;  2KZU A;  3FTF A;  4LFA M;  1TUS A;  3DFZ A;  1UVF A;  3VLF B;  2B3T A;  2H5X A;  1SGE I;  2HKJ A;  4CJ6 A;  2DHY A;  1XBT A;  3R5B A;  1KBF A;  1IFY A;  2L4F A;  3FTC A;  2K9H A;  2UXD M;  2XEP A;  4QHS A;  2CUZ A;  1V1I A;  3KS4 A;  4GEW A;  1Y8G A;  4O6P B;  1IN5 A;  4JI3 M;  3ZH9 B;  3LCV B;  2LNH C;  1FY7 A;  3GPX A;  2KMR A;  3EIE A;  3H4J A;  5CCM A;  2P5T A;  3SYK A;  4AQY M;  2KZS A;  1ORY B;  1X74 A;  2EKK A;  3B7N A;  2E73 A;  5ITU A;  5E3Q A;  3HHY A;  1T43 A;  5ITQ A;  1C1K A;  4DBG B;  2Q2E A;  3FKE A;  2EKF A;  1E9R A;  3GLG B;  2JXN A;  4LRS A;  2GNO A;  2I7N A;  2I7P A;  3KOZ E;  2ZTC A;  1LR8 A;  3Q8G A;  5KQ8 A;  4LJ9 A;  4NL4 H;  2LVA A;  2A5Y B;  1Q02 A;  4M9X A;  1EQN A;  2XFT A;  3TL4 X;  1UUC A;  2QP9 X;  1KBE A;  4D81 A;  3GRU A;  4MB7 A;  3QTL D;  2DNA A;  1ULM A;  2QPO A;  2Y0M A;  1NY6 A;  3T1Y M;  3K9O A;  4CHT B;  4MPI A;  3VK8 A;  1T6T 1;  2CRU A;  4B3S M;  3TOA A;  1IN4 A;  2QQ0 A;  1TR8 A;  1JR3 A;  1WGC A;  2FH0 A;  2QZ4 A;  4R7G A;  3SGB I;  3GLH E;  1NNU C;  3PFI A;  4JI8 M;  2V53 A;  1MU5 A;  2FNF X;  1GL6 A;  2WCY A;  4AG5 A;  4EDG A;  4QOZ C;  2O5R A;  1L1T A;  3UGD A;  2Y20 A;  3W0L B;  2NU0 I;  1QQW A;  1E9S A;  1NSF A;  3SC3 A;  2OD1 A;  1ZMU A;  2J7N A;  5KPR A;  1HT2 E;  4ANR A;  3U61 B;  2L4E A;  4CIS A;  3AKZ A;  1SXJ E;  2UVO A;  3I04 M;  1D0M A;  4JXJ A;  4EDT A;  1GLN A;  2UU9 M;  2EA0 A; 
#chains in the Genus database with same CATH homology
 1QAQ A;  2YFQ A;  2F5N A;  2SGD I;  3UGI A;  3E59 A;  5EQT A;  1UVG A;  1Z5B A;  5FTK A;  4O6O A;  2ELI A;  1L2B A;  1PJU A;  3RFW A;  4OU7 A;  1D2N A;  1IXS B;  2DHR A;  5IZ7 D;  2YUU A;  3HJQ A;  3M0E A;  4IBG A;  1NHW C;  3E9S A;  2LWX A;  1TBN A;  1IY6 A;  2DB6 A;  1TBR R;  2OQ4 A;  1TIH A;  4G4N A;  4AI6 A;  1XMQ M;  2V6Z M;  1PPF I;  2EUC A;  4G4O A;  2ZAN A;  3GLG A;  3E4R A;  4IBE A;  1GKI A;  2DWL A;  3HHX A;  2Y0T A;  2XFS A;  5DNY A;  1Z6T A;  1DGH B;  3THG A;  2F5P A;  2SGF I;  2NU3 I;  3FUU A;  3E2I A;  2XF3 A;  3UZU A;  3CXL A;  3OXG A;  3RE8 A;  1SGN I;  1XWI A;  2DVW B;  4JI4 M;  3IG5 A;  2L7I A;  4IBK A;  1HQC A;  3GO8 A;  2KCX A;  1TGS I;  3LVV A;  4DR1 M;  5FUX A;  1FNN A;  4JI6 M;  2VII A;  5JI3 E;  2ZBK A;  4WW0 A;  4EDK A;  3L26 A;  1I4W A;  5LMU M;  2V1U A;  2ERW A;  3L29 A;  5C1B A;  3RGP A;  4KHP M;  1L2D A;  1Z7K B;  2BJV A;  3RU0 A;  3AOG A;  1NJF A;  2QBY A;  2ZAM A;  1IXZ A;  2UUC M;  4DR4 M;  1HJA I;  4LY6 A;  4PDG A;  3FYD A;  5FTL A;  2UXB M;  4FKD A;  3D00 A;  3VFD A;  2R45 A;  1AN1 I;  1GL7 A;  1QVR A;  2D7H A;  1IN6 A;  1TH3 A;  3BOS A;  1QAN A;  1M8C A;  3AJI B;  4JI1 M;  1LR7 A;  4JI2 M;  1DD9 A;  3K1J A;  2E5L M;  2D7E A;  1PTR A;  3UFF A;  4KOD A;  2Z7J A;  3LVW A;  1S3S A;  2HL7 A;  5FTJ A;  4JI7 M;  3U6O A;  1IN7 A;  4WUR A;  5EP1 A;  5ITT A;  4AKH A;  3GOX A;  1GVN A;  4B7F A;  4MGK E;  2J87 A;  1OFI A;  1TGU A;  3U6E A;  4GHL A;  1OJL A;  4NOO B;  1QAM A;  5BPV A;  4PD2 A;  1MT1 A;  3I4Y A;  1J09 A;  4L4U A;  3HGI A;  4OVZ B;  3GP1 A;  3U60 B;  1N75 A;  4RNA A;  4AKG A;  2BUS A;  3AFH A;  4FCV A;  2XLJ A;  3GPY A;  2QQD A;  2KXE A;  3SFZ A;  3A45 A;  4IIW A;  3SYL A;  3PNY A;  4BB9 A;  2GKR I;  4PT5 A;  2VQE M;  2YQP A;  1XC8 A;  3KY9 A;  1HDL A;  4A24 A;  1UM8 A;  5GKN A;  3UMM A;  4FWD A;  1ZAE A;  3HWS A;  3FTE A;  4OVO A;  2XSZ A;  3KOY E;  3VK7 A;  3U6M A;  3FUX A;  2WVJ A;  4S12 A;  1N33 M;  3T38 A;  2ODD A;  4JI5 M;  4JCV A;  1DGG A;  4FD2 A;  1HNW M;  1XXH B;  4KO8 A;  5IRE B;  2DZO B;  3KFU G;  3LMM A;  2CHG A;  4LJA A;  2XRC A;  3PVS A;  1HQY E;  3A42 A;  3GLH A;  2CHQ A;  4DR6 M;  2BNK A;  4ZPX A;  1WXQ A;  3GLH B;  5JI2 E;  2XGN A;  3TWM A;  1OVO A;  4FVM A;  2Z4S A;  2GKV A;  4LGM A;  2JW6 A;  3J27 B;  4E1P A;  4B7G A;  2KRU A;  4IJE A;  4FWH A;  4IBJ A;  1K3X A;  2ZM6 M;  4M9Z A;  4FWG A;  4AW4 A;  3DA1 A;  3HHZ A;  4X62 M;  2HHH M;  2FOI C;  2RGO A;  1CE3 A;  3D8L A;  5FTM A;  1IBL M;  3J80 S;  1TOT A;  1YTP A;  4GIP A;  4UXI A;  2DZN B;  3NBI A;  1SXJ C;  4A3V B;  2ARP F;  4IBC A;  3U61 A;  2F3C I;  4FW9 A;  1J7K A;  3L27 A;  3A46 A;  1DS3 I;  3DZD A;  1R6B X;  1DDE A;  5EXS A;  3WHK A;  1FYB A;  3SAV A;  1W5T A;  3MHV C;  2NU1 I;  3RGS A;  1X37 A;  3GQ4 A;  1SGY I;  2X8A A;  2Y0Q A;  4EDR A;  3HHW A;  4YHH M;  2OVO A;  1SGQ I;  2ORV A;  2XSZ D;  3B9P A;  4DV1 M;  1IY2 A;  1QYR A;  2N1A B;  2G5G X;  3L28 A;  4GIT A;  1OMU A;  4EIW A;  2BJW A;  1SXJ A;  4NRV A;  1HNZ M;  1CHO I;  3U6S A;  2E5R A;  1SXJ B;  4DV5 M;  1SGR I;  5E26 A;  2LEO A;  3UJN A;  3K92 A;  4NXN M;  3ZCB B;  2LH0 A;  4TUW A;  1SGP I;  4XBO A;  3FUT A;  5KPZ A;  4HGU A;  1K3W A;  3U5Z A;  1YSY A;  4B6D A;  4LCB A;  3J81 S;  5IT9 S;  3U5Z B;  2DXI A;  2ROW A;  2R62 A;  1TDZ A;  1R0R I;  1CGJ I;  2ENN A;  2LUY A;  1N77 A;  4I5S A;  1SGD I;  4I8O A;  2M5X A;  1DGH A;  3MK6 A;  4QOS A;  2VRW B;  3KXE C;  3HKP A;  1TBO A;  3VKH A;  5FSW A;  3GLI B;  2X4A A;  2QEN A;  3SMS A;  3QWP A;  4UXH A;  4GKK M;  3KOW E;  2KMP A;  3U6D A;  4MGY E;  1KMA A;  4PCZ A;  1LR9 A;  3WHL A;  2NQ8 C;  3JR4 A;  1JQJ C;  1MX0 A;  4DV4 M;  2JZM A;  4QNM A;  2Q2E B;  4R3D A;  1G3I A;  4LFB M;  1TH2 A;  1NHG C;  1NJG A;  3FD9 A;  3HU2 A;  3R8F A;  2YNM D;  2F5S A;  5LMN M;  3VE5 A;  3D8B A;  5IWA M;  4E1R A;  4IBD A;  4IBF A;  3QWL A;  3A98 B;  1Q3C A;  1R7R A;  2JA1 A;  1IBK M;  3IG8 A;  1NNJ A;  3JAM S;  1SXJ D;  1L2C A;  4DR3 M;  2SGQ I;  5ITX E;  1CT0 I;  3NWL A;  1G41 A;  1NUB A;  2Y21 A;  1DGF A;  4LZJ A;  1H6U A;  3W0F A;  3UEJ A;  5KO3 A;  3I51 A;  2D7G A;  3VDP A;  5H37 D;  2JXD A;  1BUS A;  3GRR A;  4Z8X A;  3CTW B;  2ERC A;  1XNQ M;  3FTD A;  1G59 A;  3SHG B;  3L2A A;  1RFH A;  3SAU A;  5CCL A;  2C9O A;  3T1H M;  1QAO A;  3OXL A;  3J7A S;  3SBJ A;  2DWZ B;  1EE8 A;  3U60 A;  2LXE A;  4OVZ A;  1CSO I;  1Q3B A;  5F3W A;  4X66 M;  3KDS E;  3BJI A;  3AOE C;  5DYG A;  5FTN A;  4GH9 A;  4P16 A;  2N52 A;  3EIH A;  1E32 A;  2XZU A;  1J5E M;  3SAS A;  1FAR A;  1V1H A;  2AHM A;  1KFV A;  1ZQ9 A;  3GRV A;  4GMQ A;  1G4A E;  4OX9 M;  2V1C C;  2RGH A;  5EP4 A;  3AV0 A;  3J7B A;  4I4L A;  4DR7 M;  4LFC M;  3GPP A;  1Z59 A;  2KRK A;  1HT1 E;  1NVM A;  2KA6 B;  4QHT A;  3Q8X A;  3GPU A;  1K82 A;  1VDD A;  2CV1 A;  4LZZ A;  2XH9 A;  7CAT A;  2C99 A;  4B3R M;  3J2P B;  2Z4R A;  4MM3 B;  3AOE A;  3GLF B;  4LJ6 A;  2B8T A;  4DUZ M;  1XXH A;  4XGI A;  2KZU A;  4RF0 A;  3FTF A;  4L9M A;  4LFA M;  4L15 A;  1H0Z A;  2L09 A;  4W5W A;  3U6P A;  2KEB A;  1TUS A;  1X4S A;  2V1C A;  1PJJ A;  2N17 A;  3DFZ A;  4AKI A;  2G8L A;  4LF6 M;  1M8B A;  1UVF A;  3HU3 A;  1HPT A;  2R4E A;  4AG6 A;  3VLF B;  2X49 A;  2R18 A;  3HU1 A;  2YR0 A;  4GHA A;  1SGE I;  3MEK A;  3OTO M;  4NSR A;  4NRW A;  4B08 A;  4JV5 M;  4B3T M;  3HJ8 A;  3VDU A;  4M0D A;  1Y1B A;  1IY1 A;  2HKJ A;  1XBT A;  4HLQ A;  3HJS A;  2EO2 A;  5ITY A;  3C58 A;  4LG2 A;  1KBF A;  4MGH A;  4FCW A;  4M0W A;  3FTC A;  1W5S A;  2C9C A;  5FLX S;  1HR0 M;  2UXD M;  2K9H A;  2NU2 I;  1DS2 I;  2XEP A;  4QHS A;  1TUR A;  4UXJ A;  3FC3 A;  2QPA A;  1QZM A;  1OFH A;  2CUZ A;  1V1I A;  4HL4 A;  3OXF A;  3KS4 A;  2M5Z A;  2R46 A;  1IN8 A;  4O6P B;  1IN5 A;  3CF6 E;  1N34 M;  2L7X A;  2AU3 A;  4JI3 M;  1E94 E;  2UUA M;  4M9S A;  1Y8F A;  2KMQ A;  3ZH9 B;  4GC9 A;  1YE9 A;  1Z5C A;  3UGJ A;  2LNH C;  4LJ5 A;  4MGI E;  3GQ3 A;  3GPX A;  1CT2 I;  2JYY A;  3SAT A;  2KMR A;  3EIE A;  3L25 A;  1R2Y A;  3SEK C;  3KSJ A;  4KLN A;  5CCM A;  4LJ4 A;  2CJS C;  2CFO A;  2P5T A;  2W0T A;  4E2K A;  3TJQ A;  2J9R A;  4LGY A;  3SYK A;  3FUW A;  4AQY M;  4NSO B;  5EX3 A;  3K2L A;  1IY5 A;  3U6C A;  3H4M A;  4RF1 A;  3SMP A;  4JI0 M;  2ZAO A;  3U6Q A;  2KZS A;  3FYC A;  4EDV A;  1ORY B;  4II7 A;  4SGB I;  3KS8 A;  1KYI A;  4D82 A;  1XHB A;  2A20 A;  1XX6 A;  4AZF A;  3GLI A;  5A2Q S;  1X74 A;  4LF9 M;  3PNV A;  1XNR M;  2E73 A;  5HI7 A;  3M6A A;  4D80 A;  3OL0 A;  3GQ5 A;  4G6Z A;  5ITU A;  1FAQ A;  5DYI A;  3HHY A;  1R79 A;  5FUV A;  5ITQ A;  4X64 M;  1U5K A;  1C1K A;  4IBB A;  1HNX M;  4OW0 A;  2DWN A;  2Q2E A;  3FKE A;  4Z6Y A;  1L8Q A;  3AL0 C;  1DGB A;  3UK6 A;  2CE7 A;  3OVO A;  2SGE I;  2DIP A;  4EE1 A;  2QCU A;  3GRY A;  1IXR C;  2N71 A;  4QNR A;  1E9R A;  2C96 A;  2FNA A;  1CT4 I;  3PDN A;  4L78 A;  3GLG B;  1IY0 A;  4L16 A;  2ENZ A;  2K47 A;  4IJF A;  3VKG A;  5EP2 A;  1YU6 C;  2Z3X A;  2P6A C;  4LRS A;  5HQ8 A;  2RKO A;  3KP1 E;  3TWK A;  3HH2 C;  4I81 A;  3PXG A;  4MH0 E;  3KOX E;  2I7N A;  2I7P A;  3TQS A;  4L8R C;  1W3S A;  2C5R A;  1DO2 A;  3KOZ E;  2VQF M;  4DV0 M;  4BLC A;  3U6L A;  3JR5 A;  5ITX A;  3TE6 A;  4REZ A;  2QQE A;  3CF0 A;  5EP3 A;  1LR8 A;  2JA2 A;  5KQ8 A;  2L7H A;  4LJ9 A;  4NL4 H;  2ZBK B;  4NXM M;  4JYA M;  3SHF A;  2KMO A;  3KW6 A;  1CGI I;  3QAU A;  4G4Q A;  2ORW A;  2F5Q A;  2A5Y B;  2SGP I;  4M9X A;  1EQN A;  4DV7 M;  2QBY B;  2XFT A;  1Z5A A;  2J7O A;  3ILK A;  4LF4 M;  2HCB A;  5BR8 M;  1N78 A;  2R4J A;  3TL4 X;  1UUC A;  2QP9 X;  1KBE A;  4D81 A;  3GRU A;  3SAW A;  1OMT A;  4GRI A;  4MB7 A;  1TBQ R;  1KSF X;  4DV6 M;  2YQZ A;  2XZF A;  2F5O A;  8CAT A;  3QTL D;  1FJG M;  4JN6 A;  2QPO A;  4LJ7 A;  3MJ5 A;  1NY6 A;  4IBI A;  4BBA A;  3T1Y M;  4B3M M;  1Y1C A;  1D3Y A;  3GLF A;  2UZ3 A;  4CHT B;  2R65 A;  3I4V A;  3VK8 A;  1T6T 1;  1DO0 A;  4GC5 A;  1XMO M;  4B3S M;  3UGL A;  4K0K M;  3SAR A;  1PJI A;  2GVI A;  1N36 M;  3B4V C;  3CF2 A;  1IN4 A;  4CGY B;  5ITR A;  4LF8 M;  3KP0 E;  2QQ0 A;  1PCE A;  5KPT A;  2CV2 A;  5C18 A;  3LQR A;  2CV0 A;  2UUB M;  1LV7 A;  2QQC A;  4JCV E;  4DR5 M;  1YUB A;  4MGZ E;  2DWM A;  3UEY A;  1JR3 A;  3K8Z A;  4DV2 M;  2CEA A;  2QZ4 A;  2W82 A;  3FUV A;  4R7G A;  2OPF A;  3SGB I;  4LRT A;  4DR2 M;  1W4R A;  5GUJ A;  3T15 A;  1NNU C;  3KSX A;  1N32 M;  1BMO A;  4G4R A;  3PFI A;  4LF7 M;  4B7H A;  2GKT I;  4PDI A;  4JI8 M;  5FUY A;  2C98 A;  2FFJ A;  2V53 A;  1MU5 A;  2FNF X;  3M7G A;  2M60 A;  2NU4 I;  4FCT A;  2L6O A;  1TDH A;  1OYV I;  1GL6 A;  2KW0 A;  2WCY A;  4X65 M;  5DAE A;  3TWL A;  4AG5 A;  4DUY M;  4EDG A;  4QOZ C;  5EX0 A;  2O5R A;  5JHW C;  3ZC7 B;  4YY3 M;  1IW4 A;  5EXX A;  2UXC M;  1L1T A;  3UGD A;  1L1Z A;  2FE8 A;  2Y20 A;  1IM2 A;  3W0L B;  3LQQ A;  1TH4 A;  2NU0 I;  3R9X B;  4DV3 M;  1R2Z A;  1QQW A;  5FUW A;  1E9S A;  1NSF A;  1NY5 A;  2H1R A;  3SC3 A;  4LF5 M;  2OD1 A;  5EXP A;  4GI3 C;  2J7N A;  5KQD A;  5KPR A;  2CHV A;  3KVW A;  1HT2 E;  5EXT A;  3SGQ I;  5EJC A;  4GKJ M;  1IQP A;  2B0U C;  2F4V M;  3U61 B;  1I94 M;  4CIS A;  1N13 A;  3AKZ A;  3DOA A;  5E6J A;  1JR3 D;  1SXJ E;  4ITQ A;  4LJ8 A;  1PTQ A;  2L8E A;  4JXJ A;  1PM5 A;  1IBM M;  4EDT A;  1GLN A;  1T3T A;  2UU9 M;  3B39 A;  1G8P A;  2EA0 A;  1XA6 A;  1Q39 A;  3TPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...