3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2AY0A 2CPGA 1IRQA 2K29A 2K9IA 3VW4A 2HZVA 1EA4A 3LGHA 3OD2A 2BJ8A 2BJ9A 1BDVA 2RBFA 1ARQA 2JXGA 2GPEA 2K6LA 1B28A 2H1OE 1NLAA 2BNWA 1MYKA 3GXQA 2KELA 3H87C 1X93A 3QOQA 2BJ1A 2BJ3A 1MYLA 2CAXA 2CAJA 1Q5VA 2JXIA 3VEBA 2WVDA 2BNZA 1P94A 1BAZA 2HZAA 2WVBA 2WVEA 4HV0A 1MNTA 3VEAA 4D8JA 2CADA 1B01A 1PARA 2CA9A 2BA3A 1U9PA 2JXHA 2K5JA 1ARRA 2K1OA 2WVCA 2BSQE 3FT7A 4ME7E 3FMTA 1QTGA 4FXEA 2WVFA 1BDTA 2BJ7A
chains in the Genus database with same CATH superfamily
4R5JA 2CPGA 4F01A 3KAVA 2YI8A 3ZEDA 4AZ5A 2F7RA 4EZVA 1DKZA 2OW6A 2X3XA 3LMFA 2LM0A 3DX3A 1W9MA 3VEBA 4EZQA 2WVEA 2GF4A 1SIWA 1QX1A 2BA3A 1TQUA 4O4RA 1YWMA 4EZYA 2ZXQA 4F00A 4AZBA 2OO2A 2K9IA 2BJ8A 2Z8YA 3CZNA 2BNWA 3GXQA 4JWIA 1SH3A 3DX4A 3RV0A 3EJUA 4JLCA 5KBPA 2CA9A 3BVWA 3QNIA 4R5LA 4JWDA 1DKYA 4FZSA 2KHOA 2RT6A 2FICA 2JXGA 2GAFD 3CVRA 4AZHA 3G9GA 2WVDA 4EZRA 3UITA 2MI7A 4EZWA 1U00A 1ZYLA 3HAIA 4FXEA 3NAIA 1OG7A 1MJGA 2AY0A 3QWEA 2WK4A 3ACOA 3QE6A 3BVTA 4I1QA 3F7WA 1NLAA 3H5YA 4AVMA 1MYKA 2JNSA 3H87C 1OAOA 4IM2A 4EZNA 3UQSA 1SU6A 1B01A 3VEAA 2WVCA 2K1OA 1E2UA 4AZ7A 3ABHA 4NQIA 4R5IA 2QXLA 1BDTA 1IRQA 2F7OA 3BLBA 2QKWA 3PLTA 2EWFA 2YL8A 2AN7A 1ARQA 3QNJA 2GPEA 1B28A 1HXKA 1I49A 3SOGA 4H8SA 3IR7A 4WPEA 4DCNC 3RPMA 2X3VA 2Q2KA 1PARA 3G5OA 4R5KA 4LRVA 3I01A 2YLAA 4QPXA 3DX0A 3DPOA 1SUFA 4E3CA 4HR1A 3I39X 4IWOA 2BJ9A 4UDXX 3Q84A 1GN9A 1I4DA 4EZUA 2YL9A 3DPQA 3D51A 2F18A 1R34A 2LXYA 3UR0A 1Q16A 2CADA 2Q13A 4AZ6A 2YIBA 4EZOA 4M0MA 4ATMA 2UUTA 3D2FA 2KOEA 1E1DA 3D4ZA 3QIDA 3LLLA 2HZVA 1TQTA 2RBFA 4NSWA 2F7PA 2K6LA 5C5BB 3DDFA 4AAIA 3H5XA 4JWEA 4EZTA 3QOQA 1I4LA 2JNKA 4FM3A 3KDRA 4JN4A 3EJTA 2EFLA 2YIVX 3SFUA 1MNTA 2CAXA 2JXHA 3UPFA 3FT7A 1JQKA 3BUPA 3T48A 3D52A 1SH0A 1DKXA 4E81A 1SH2A 4JWCA 4AZCA 3FD9A 3DYTA 3SYVA 2H3AA 2ND1A 2PY6A 2YI9A 4LQ3A 3NAHA 2ND0A 3VKHA 2A2BA 3CZSA 1Y2OA 2HZAA 3BVVA 4HV0A 1HTYA 2YLLA 1U9PA 3D50A 4ME7E 1GNLA 1OHNA 4HY9A 2YL5A 1EA4A 2EX3B 3D2EA 1X93A 3T49A 3C7NA 3BUQA 3B53X 3EJRA 2K5JA 1SU7A 4PO2A 2EFKA 1WDZA 2WYHA 1QTGA 3DX1A 3B51X 5FIGA 4AZCB 3T4AG 1TQVA 2C08A 3BUDA 2ALWA 2UUWA 1ZWWA 4WPCA 4AKVA 2KELA 3LVTA 2V0OA 1HWWA 3HAHA 1I4TA 3QA8A 3OWGA 1GNTA 1OA1A 2WYIA 2N3KA 3CAZA 2BSQE 3D4YA 4B9QA 3OK8A 3OHXM 4G6QA 1BDVA 4KIKA 3EJPA 3Q0KA 2F1AA 2OZNB 3T47A 2CAJA 3BVUA 1Q5VA 3BSOA 2WVBA 3VW4A 3LJPA 2KKEA 2FYVA 3M3WA 1QWNA 5E84A 3FMTA 2GA9D 2RAJA 2WVFA 3KAWA 2BJ7A 4IM0A 3BUIA 4DYLA 3I2WA 1R5EA 3O3NB 3LGHA 3SFGA 2ELBA 2PMRA 3BVXA 4LQ9A 2BJ1A 1SU8A 2F7QA 4JNEA 3EJSA 4IW0A 2BNZA 4UDYX 4HR1B 1UPXA 1ARRA 3I04A 4EZXA 4HYBA 1TQSA 2QFFA 2D1LA 3NO7A 4KIKB 2K29A 5FLEX 2RAKA 2B43A 4EZZA 2WINM 1TQWA 2BJ3A 3ER9B 2JXIA 2JBVA 2H1OE 3ERCC 3DX2A 4NRTA 5C5BA 4JNFA 2Z0NA 3CV5A 3T46A 1PS3A 2X5CA 3BSNA 1X03A 4NPHA 4BNEA 3DPPA 4R5GA 1X04A 4IWQA 3RV1A 2F1BA 3GI7A 4MJWA 3ER8C 4NRUA 1P94A 2YL6A 3L3OM 2OW7A 4JL9A 2OBMA 1O7DC 2YKTA 2CKWA 3OD2A 3B52X 2O0I1 2Z0VA 4EZPA 3CKDA 4FZOA 4EZSA 3DDGA 4D8JA 1URUA 2YIAA 3A98A 5TKYA 2D4CA 3EJQA 2NCZA 2Z0OA 4H6IA 2RAIA 3L3PA 1LQ7A 4IWPA 1E9VA 3O3OB 1O7DB 2ADLA 4AZGA 3NNEA 3HAJA 1R33A 4H6HA 1QWUA 1MYLA 2X3WA 2OBLA 1BAZA 3O3MB 4FZPA 2Q12A 1OA0A 3BUBA 4AZIA 4IM3A
chains in the Genus database with same CATH topology
4R5JA 2CPGA 1GNLA 5FLEX 4KIKB 1IRQA 2K29A 2YI8A 3KAVA 3ZEDA 4HY9A 2EWFA 1ARQA 1EA4A 3QNJA 4EZVA 2GPEA 2EX3B 1B28A 3D2EA 4EZZA 2WINM 1X93A 2BJ3A 1DKZA 3LMFA 3T49A 3ER9B 2JXIA 2LM0A 3C7NA 1W9MA 3VEBA 4EZQA 2H1OE 2WVEA 1PARA 3B53X 3ERCC 2BA3A 1SU7A 2K5JA 4PO2A 4R5KA 3I01A 1QTGA 4EZYA 4F00A 3B51X 3DPOA 5FIGA 1SUFA 4E3CA 4HR1A 3T4AG 2K9IA 3I39X 4JNFA 3T46A 4IWOA 2X5CA 2BJ8A 2BJ9A 4UDXX 2Z8YA 1GN9A 4EZUA 2BNWA 3GXQA 3DPQA 2KELA 4JWIA 4NPHA 3DPPA 4R5GA 4IWQA 3RV1A 3QA8A 3GI7A 3OWGA 3RV0A 3ER8C 1P94A 1GNTA 1OA1A 2N3KA 2CADA 2BSQE 4JLCA 4B9QA 2YIBA 4EZOA 3OHXM 4M0MA 2CA9A 3L3OM 4JL9A 3D2FA 4R5LA 2OBMA 4JWDA 1DKYA 4G6QA 1E1DA 2KHOA 2HZVA 3OD2A 1BDVA 2RT6A 3B52X 2RBFA 4KIKA 2JXGA 2GAFD 2K6LA 4EZPA 4JWEA 4EZTA 3QOQA 4FM3A 3T47A 3KDRA 2CAJA 1Q5VA 4JN4A 4EZSA 2YIVX 2WVDA 4D8JA 2WVBA 4EZRA 2YIAA 3A98A 1MNTA 3UITA 4EZWA 3VW4A 2CAXA 5TKYA 2JXHA 1U00A 3FT7A 1JQKA 5E84A 2NCZA 3FMTA 1ZYLA 2GA9D 4FXEA 2WVFA 3KAWA 2BJ7A 1MJGA 4H6IA 4IM0A 3T48A 2AY0A 4IWPA 1E9VA 1DKXA 3O3OB 4F01A 4E81A 3O3NB 3LGHA 4JWCA 3FD9A 3F7WA 1NLAA 2ND1A 1MYKA 4H6HA 2JNSA 3H87C 2PY6A 2BJ1A 2YI9A 1MYLA 1OAOA 1SU8A 4JNEA 4IM2A 2ND0A 4IW0A 3VKHA 2OBLA 4EZNA 2BNZA 1SU6A 1BAZA 2HZAA 4UDYX 4HV0A 1B01A 3VEAA 3O3MB 4HR1B 1UPXA 1U9PA 2WVCA 1ARRA 2K1OA 1OA0A 3I04A 1E2UA 4ME7E 4HYBA 4EZXA 4R5IA 2QFFA 2QXLA 4IM3A 1BDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY0 A;  2CPG A;  1IRQ A;  2K29 A;  2K9I A;  3VW4 A;  2HZV A;  1EA4 A;  3LGH A;  3OD2 A;  2BJ8 A;  2BJ9 A;  1BDV A;  2RBF A;  1ARQ A;  2JXG A;  2GPE A;  2K6L A;  1B28 A;  2H1O E;  1NLA A;  2BNW A;  1MYK A;  3GXQ A;  2KEL A;  3H87 C;  1X93 A;  3QOQ A;  2BJ1 A;  2BJ3 A;  1MYL A;  2CAX A;  2CAJ A;  1Q5V A;  2JXI A;  3VEB A;  2WVD A;  2BNZ A;  1P94 A;  1BAZ A;  2HZA A;  2WVB A;  2WVE A;  4HV0 A;  1MNT A;  3VEA A;  4D8J A;  2CAD A;  1B01 A;  1PAR A;  2CA9 A;  2BA3 A;  1U9P A;  2JXH A;  2K5J A;  1ARR A;  2K1O A;  2WVC A;  2BSQ E;  3FT7 A;  4ME7 E;  3FMT A;  1QTG A;  4FXE A;  2WVF A;  1BDT A;  2BJ7 A; 
#chains in the Genus database with same CATH topology
 4R5J A;  2CPG A;  4F01 A;  3KAV A;  2YI8 A;  3ZED A;  4AZ5 A;  2F7R A;  4EZV A;  1DKZ A;  2OW6 A;  2X3X A;  3LMF A;  2LM0 A;  3DX3 A;  1W9M A;  3VEB A;  4EZQ A;  2WVE A;  2GF4 A;  1SIW A;  1QX1 A;  2BA3 A;  1TQU A;  4O4R A;  1YWM A;  4EZY A;  2ZXQ A;  4F00 A;  4AZB A;  2OO2 A;  2K9I A;  2BJ8 A;  2Z8Y A;  3CZN A;  2BNW A;  3GXQ A;  4JWI A;  1SH3 A;  3DX4 A;  3RV0 A;  3EJU A;  4JLC A;  5KBP A;  2CA9 A;  3BVW A;  3QNI A;  4R5L A;  4JWD A;  1DKY A;  4FZS A;  2KHO A;  2RT6 A;  2FIC A;  2JXG A;  2GAF D;  3CVR A;  4AZH A;  3G9G A;  2WVD A;  4EZR A;  3UIT A;  2MI7 A;  4EZW A;  1U00 A;  1ZYL A;  3HAI A;  4FXE A;  3NAI A;  1OG7 A;  1MJG A;  2AY0 A;  3QWE A;  2WK4 A;  3ACO A;  3QE6 A;  3BVT A;  4I1Q A;  3F7W A;  1NLA A;  3H5Y A;  4AVM A;  1MYK A;  2JNS A;  3H87 C;  1OAO A;  4IM2 A;  4EZN A;  3UQS A;  1SU6 A;  1B01 A;  3VEA A;  2WVC A;  2K1O A;  1E2U A;  4AZ7 A;  3ABH A;  4NQI A;  4R5I A;  2QXL A;  1BDT A;  1IRQ A;  2F7O A;  3BLB A;  2QKW A;  3PLT A;  2EWF A;  2YL8 A;  2AN7 A;  1ARQ A;  3QNJ A;  2GPE A;  1B28 A;  1HXK A;  1I49 A;  3SOG A;  4H8S A;  3IR7 A;  4WPE A;  4DCN C;  3RPM A;  2X3V A;  2Q2K A;  1PAR A;  3G5O A;  4R5K A;  4LRV A;  3I01 A;  2YLA A;  4QPX A;  3DX0 A;  3DPO A;  1SUF A;  4E3C A;  4HR1 A;  3I39 X;  4IWO A;  2BJ9 A;  4UDX X;  3Q84 A;  1GN9 A;  1I4D A;  4EZU A;  2YL9 A;  3DPQ A;  3D51 A;  2F18 A;  1R34 A;  2LXY A;  3UR0 A;  1Q16 A;  2CAD A;  2Q13 A;  4AZ6 A;  2YIB A;  4EZO A;  4M0M A;  4ATM A;  2UUT A;  3D2F A;  2KOE A;  1E1D A;  3D4Z A;  3QID A;  3LLL A;  2HZV A;  1TQT A;  2RBF A;  4NSW A;  2F7P A;  2K6L A;  5C5B B;  3DDF A;  4AAI A;  3H5X A;  4JWE A;  4EZT A;  3QOQ A;  1I4L A;  2JNK A;  4FM3 A;  3KDR A;  4JN4 A;  3EJT A;  2EFL A;  2YIV X;  3SFU A;  1MNT A;  2CAX A;  2JXH A;  3UPF A;  3FT7 A;  1JQK A;  3BUP A;  3T48 A;  3D52 A;  1SH0 A;  1DKX A;  4E81 A;  1SH2 A;  4JWC A;  4AZC A;  3FD9 A;  3DYT A;  3SYV A;  2H3A A;  2ND1 A;  2PY6 A;  2YI9 A;  4LQ3 A;  3NAH A;  2ND0 A;  3VKH A;  2A2B A;  3CZS A;  1Y2O A;  2HZA A;  3BVV A;  4HV0 A;  1HTY A;  2YLL A;  1U9P A;  3D50 A;  4ME7 E;  1GNL A;  1OHN A;  4HY9 A;  2YL5 A;  1EA4 A;  2EX3 B;  3D2E A;  1X93 A;  3T49 A;  3C7N A;  3BUQ A;  3B53 X;  3EJR A;  2K5J A;  1SU7 A;  4PO2 A;  2EFK A;  1WDZ A;  2WYH A;  1QTG A;  3DX1 A;  3B51 X;  5FIG A;  4AZC B;  3T4A G;  1TQV A;  2C08 A;  3BUD A;  2ALW A;  2UUW A;  1ZWW A;  4WPC A;  4AKV A;  2KEL A;  3LVT A;  2V0O A;  1HWW A;  3HAH A;  1I4T A;  3QA8 A;  3OWG A;  1GNT A;  1OA1 A;  2WYI A;  2N3K A;  3CAZ A;  2BSQ E;  3D4Y A;  4B9Q A;  3OK8 A;  3OHX M;  4G6Q A;  1BDV A;  4KIK A;  3EJP A;  3Q0K A;  2F1A A;  2OZN B;  3T47 A;  2CAJ A;  3BVU A;  1Q5V A;  3BSO A;  2WVB A;  3VW4 A;  3LJP A;  2KKE A;  2FYV A;  3M3W A;  1QWN A;  5E84 A;  3FMT A;  2GA9 D;  2RAJ A;  2WVF A;  3KAW A;  2BJ7 A;  4IM0 A;  3BUI A;  4DYL A;  3I2W A;  1R5E A;  3O3N B;  3LGH A;  3SFG A;  2ELB A;  2PMR A;  3BVX A;  4LQ9 A;  2BJ1 A;  1SU8 A;  2F7Q A;  4JNE A;  3EJS A;  4IW0 A;  2BNZ A;  4UDY X;  4HR1 B;  1UPX A;  1ARR A;  3I04 A;  4EZX A;  4HYB A;  1TQS A;  2QFF A;  2D1L A;  3NO7 A;  4KIK B;  2K29 A;  5FLE X;  2RAK A;  2B43 A;  4EZZ A;  2WIN M;  1TQW A;  2BJ3 A;  3ER9 B;  2JXI A;  2JBV A;  2H1O E;  3ERC C;  3DX2 A;  4NRT A;  5C5B A;  4JNF A;  2Z0N A;  3CV5 A;  3T46 A;  1PS3 A;  2X5C A;  3BSN A;  1X03 A;  4NPH A;  4BNE A;  3DPP A;  4R5G A;  1X04 A;  4IWQ A;  3RV1 A;  2F1B A;  3GI7 A;  4MJW A;  3ER8 C;  4NRU A;  1P94 A;  2YL6 A;  3L3O M;  2OW7 A;  4JL9 A;  2OBM A;  1O7D C;  2YKT A;  2CKW A;  3OD2 A;  3B52 X;  2O0I 1;  2Z0V A;  4EZP A;  3CKD A;  4FZO A;  4EZS A;  3DDG A;  4D8J A;  1URU A;  2YIA A;  3A98 A;  5TKY A;  2D4C A;  3EJQ A;  2NCZ A;  2Z0O A;  4H6I A;  2RAI A;  3L3P A;  1LQ7 A;  4IWP A;  1E9V A;  3O3O B;  1O7D B;  2ADL A;  4AZG A;  3NNE A;  3HAJ A;  1R33 A;  4H6H A;  1QWU A;  1MYL A;  2X3W A;  2OBL A;  1BAZ A;  3O3M B;  4FZP A;  2Q12 A;  1OA0 A;  3BUB A;  4AZI A;  4IM3 A; 
#chains in the Genus database with same CATH homology
 4R5J A;  2CPG A;  1GNL A;  5FLE X;  4KIK B;  1IRQ A;  2K29 A;  2YI8 A;  3KAV A;  3ZED A;  4HY9 A;  2EWF A;  1ARQ A;  1EA4 A;  3QNJ A;  4EZV A;  2GPE A;  2EX3 B;  1B28 A;  3D2E A;  4EZZ A;  2WIN M;  1X93 A;  2BJ3 A;  1DKZ A;  3LMF A;  3T49 A;  3ER9 B;  2JXI A;  2LM0 A;  3C7N A;  1W9M A;  3VEB A;  4EZQ A;  2H1O E;  2WVE A;  1PAR A;  3B53 X;  3ERC C;  2BA3 A;  1SU7 A;  2K5J A;  4PO2 A;  4R5K A;  3I01 A;  1QTG A;  4EZY A;  4F00 A;  3B51 X;  3DPO A;  5FIG A;  1SUF A;  4E3C A;  4HR1 A;  3T4A G;  2K9I A;  3I39 X;  4JNF A;  3T46 A;  4IWO A;  2X5C A;  2BJ8 A;  2BJ9 A;  4UDX X;  2Z8Y A;  1GN9 A;  4EZU A;  2BNW A;  3GXQ A;  3DPQ A;  2KEL A;  4JWI A;  4NPH A;  3DPP A;  4R5G A;  4IWQ A;  3RV1 A;  3QA8 A;  3GI7 A;  3OWG A;  3RV0 A;  3ER8 C;  1P94 A;  1GNT A;  1OA1 A;  2N3K A;  2CAD A;  2BSQ E;  4JLC A;  4B9Q A;  2YIB A;  4EZO A;  3OHX M;  4M0M A;  2CA9 A;  3L3O M;  4JL9 A;  3D2F A;  4R5L A;  2OBM A;  4JWD A;  1DKY A;  4G6Q A;  1E1D A;  2KHO A;  2HZV A;  3OD2 A;  1BDV A;  2RT6 A;  3B52 X;  2RBF A;  4KIK A;  2JXG A;  2GAF D;  2K6L A;  4EZP A;  4JWE A;  4EZT A;  3QOQ A;  4FM3 A;  3T47 A;  3KDR A;  2CAJ A;  1Q5V A;  4JN4 A;  4EZS A;  2YIV X;  2WVD A;  4D8J A;  2WVB A;  4EZR A;  2YIA A;  3A98 A;  1MNT A;  3UIT A;  4EZW A;  3VW4 A;  2CAX A;  5TKY A;  2JXH A;  1U00 A;  3FT7 A;  1JQK A;  5E84 A;  2NCZ A;  3FMT A;  1ZYL A;  2GA9 D;  4FXE A;  2WVF A;  3KAW A;  2BJ7 A;  1MJG A;  4H6I A;  4IM0 A;  3T48 A;  2AY0 A;  4IWP A;  1E9V A;  1DKX A;  3O3O B;  4F01 A;  4E81 A;  3O3N B;  3LGH A;  4JWC A;  3FD9 A;  3F7W A;  1NLA A;  2ND1 A;  1MYK A;  4H6H A;  2JNS A;  3H87 C;  2PY6 A;  2BJ1 A;  2YI9 A;  1MYL A;  1OAO A;  1SU8 A;  4JNE A;  4IM2 A;  2ND0 A;  4IW0 A;  3VKH A;  2OBL A;  4EZN A;  2BNZ A;  1SU6 A;  1BAZ A;  2HZA A;  4UDY X;  4HV0 A;  1B01 A;  3VEA A;  3O3M B;  4HR1 B;  1UPX A;  1U9P A;  2WVC A;  1ARR A;  2K1O A;  1OA0 A;  3I04 A;  1E2U A;  4ME7 E;  4HYB A;  4EZX A;  4R5I A;  2QFF A;  2QXL A;  4IM3 A;  1BDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...