3VI5A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
molecule keywords Hematopoietic prostaglandin D synthase
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
total genus 68
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi5A01
1QFNA 5A5KA 1XCCA 3CRUA 4TXOB 2FUG2 3FKFA 1PQNA 1JZOA 5G1KA 4KDXA 5CRHA 2HSMA 5GAPD 1T00A 3F6FA 5F0GA 2B3SA 1ZGNA 4WBRD 3A2VA 4WBJA 4KCEA 1QQ2A 2AB6A 2PWJA 1AXDA 5IPGA 5G31A 2FD3A 5IMAA 3E0UA 4ID0A 10GSA 5EVOA 1VF2A 3DD3A 1SD8A 3DRNA 3P8WA 3QAGA 2NPBA 3RAZA 4K0GA 5E59A 3UAPA 3V1WA 1OE8A 2C4JA 2B7KA 4MPGA 2H19A 3GIXA 1BJXA 4RQXA 1GWCA 5ECLB 3NOFA 4TR4A 4ZB6A 5DBQA 4J56E 4YAPA 1R5PA 2RLIA 2PVQA 1TRVA 3LFLA 4D73A 3IA1A 2I9HA 5J3RA 2PVOC 1WIKA 3KGKA 3GX8A 4MF5A 1NW2A 1KTEA 4XS4B 1NM3A 4N0VA 1FG4A 2HSNB 3GA4A 4HZ4A 4PNGA 4E8EA 2X8HA 4GF0A 1GLQA 2YZHA 4EC0A 3CSJA 2G0FA 3LGCA 1V98A 4AJ8A 2LKUA 2VCXA 1PL2A 2AHEA 4EKZA 3QD9A 2JL4A 5HFIA 1JFUA 5HR0A 2A2SA 5GZZB 2CA8A 6GSXA 5J5NA 2FWEA 4OWYA 3GMFA 2GVPA 3BJ5A 2VLUA 4KNDA 1A2MA 3R3EA 4I5QA 1X5DA 1XW9A 4DSSA 4V2LA 2LEGA 1AQXA 3IBHA 2RUFA 2GSTA 1GULA 5IMZA 3ZITA 4FQUA 4PURA 3O76A 4ZL7A 2B1KA 3VPTA 2CV4A 1AW9A 1K0MA 3QAVA 1WJKA 4N0ZA 1A8LA 1JLVA 1G7EA 3ZFLA 3MAKA 5JCUA 1U88A 4L0WA 3OR5A 1JZDA 5B6MA 2O7KA 4BWQA 4BVYA 3P7XA 3W6GA 1GTUA 1I9DA 2LS5A 1FB0A 1XWKA 4YQUA 1CQGA 4YQMA 3BBYA 1QMVA 3KXOA 3FZ4A 5ID2A 4F0BA 1TRSA 4KA0A 5E4WA 2LRNA 1GSUA 1FW1A 3TKQA 4ZB9A 4KH7A 4KX4A 3TKSA 3RHBA 1K3YA 3O3TA 1BYEA 4YH2A 3GV1A 1N2AA 2PN8A 2R3XA 2V2GA 2H01A 4MH3A 1K0DA 2REMA 4HU7A 2L4CA 3MWHA 1GRXA 1I5GA 2LV3A 3KZQA 4PXOA 2IN3A 1GSEA 5FWGA 2WS2A 1M2AA 3F3QA 5KEJA 3IDVA 2NVLA 2XPEA 4ZXGA 3GNJA 2MBSA 4JU5A 1Z9HA 4ZILA 3GFKA 1G0TA 3CTFA 4EXJA 1TJDA 2F51A 2H76A 2NBSA 3J7Yk 4MMMA 4P3YB 3MSZA 3ZMLA 2H0IA 3BCIA 4X0XA 1FVJA 2IJYA 1BEDA 3LWAA 1B9XC 4HS1A 5KN1A 3WT1A 4MH2A 2ES7A 6GSWA 5COHA 4GQFA 4LMVA 4IW9A 4POBA 2CZ2A 5F07A 4FYUA 2PMTA 2L5OA 4H86A 3DWVA 3M1GA 3HXSA 5FT3A 2KLXA 4KW6A 2PU9C 2CQ9A 2MMOA 3FW2A 4KDUA 3C7MA 4EO3A 3F8UA 4BWSA 2PERA 3WGDA 1ERWA 1GSSA 1U3IA 3L0HA 2LRTA 2YWIA 2MBTA 2DJJA 5IMFA 3ERFA 3HA9A 5J9BA 2A4VA 1UVZA 2DLXA 3FR3A 2GSRA 2QC7A 2LRCA 1K0AA 1MTCA 2OE3A 1U3AA 2BTOT 7GSSA 3DYRA 3SWLA 2PUKC 1EP8A 1XFLA 5H5RA 4TW5A 3CBUA 5C04A 3C1RA 4RI6A 3GH9A 2VOCA 3DIEA 3FK8A 4WEYA 5C00A 2MMZA 2HRAA 3EC3A 4HQSA 1USBA 2HT9A 4HEA2 4YQVA 3G7JA 2P0GA 1SYXA 3QFBC 3UVHA 1Q4JA 1J08A 1X9WB 3P90A 1FOVA 1SK2A 3KM6A 2I1UA 3HJPA 1H75A 2K18A 5G30A 3FHKA 3ZIJA 3CYNA 4J2FA 2AAWA 4IKHA 4NHZA 3GKMA 1IYIA 3EE2A 4LA1A 2DJKA 5ECOB 5ENUA 5D93A 2EIOA 2YZUA 1B9YC 1K0BA 5B7CA 4KSOA 1GLPA 2R4VA 3NZNA 1B48A 3IC4A 3ERWA 4EF0A 5ECHB 3DGQA 5DJMA 2V6KA 4TR3A 1A0FA 1UN2A 3EYTA 1WRYA 2TIRA 1LU4A 2VLTA 2CAIA 4HOJA 1S3AA 1K0CA 4QL9A 3DVXA 2JSZA 3TKPA 5GAND 1WE0A 1ON4A 1Y25A 1ABAA 1C72A 4PNFA 5HR2A 2I81A 3W8JA 1GUHA 5D96A 3ZTLA 1M2BA 2IFQA 2RM6A 2H70A 4JRRA 5ECRB 3APOA 8GSSA 3HKRA 4PTSA 1BQ7A 3GTUA 1X9MB 4V1Ap 3D5JA 1GSYA 4ECIA 1F37A 3C73A 3WT2A 1FAAA 1ILOA 4MZWA 5DALB 1XVQA 1QK8A 1HNBA 4OCEA 1B4QA 2WFCA 1THXA 3GURA 2GSQA 2H1BA 1TI1A 2LTKA 2EIRA 2VLVA 4BL7A 1KNGA 1SKSB 3HJMA 2WGRA 1PL1A 2C1YA 3C1SA 1PX6A 1PD21 4TN8A 1NHYA 2YOIA 3BD2A 3KEBA 1TRUA 3FYGA 5ELAA 4HZ2A 1OC9B 2L6CA 5CO3A 2R2JA 2GQMA 2XHFA 5DDLA 3UMAA 3D0ZA 4MF6A 3KMNA 3PH9A 2VIMA 3VWWA 2C0GA 2GT6A 1MDJA 4MCUA 4TOPA 1Z7PA 2ZNMA 3PR8A 1QXHA 5D9VA 4ECJA 3RHCA 3QPMA 2WZ9A 1XXUA 3F0IA 2LSTA 3TJGA 2FA4A 20GSA 3KIJA 4OFTA 5AIXA 2HRKA 2VCZA 4IQ1A 4GSNA 4KE3A 4JEDA 2H0GA 2MMAA 5EY6A 5IIZA 4I8BA 3ZLPA 5LNKe 1F2EA 5ECMB 4LMWA 2CAQA 3FRCA 5EL8A 4WR4A 1NSWA 2OBIA 3EMPA 2I3YA 4FYBA 2WB9A 9GSSA 4G9HA 16GSA 1R7HA 2X64A 1TI3A 2D2ZA 3I6AA 3WYWA 3US3A 4IJ3A 4BPYA 1OC8A 4Q5FA 2GZYA 1KBNA 3L9UA 2HRKB 2GQKA 4IS0A 3TJKA 2A2RA 3DKSA 1ST9A 1G6YA 1TK8B 3APQA 5ECPB 1B8XA 3HZ8A 2OBKA 2L59A 2C3TA 1X5CA 4I2UA 2VCWA 3GSTA 3QAWA 2DMMA 4USSA 4IJIA 2H6XA 1SL1B 2LJKA 2YNXA 4ECCA 2CX4A 2L4QA 3EVIA 5IMCA 1XWCA 1GTIA 2HSMB 4KF9A 5CRWA 1RW1A 1YEPA 2HRFA 3I69A 3TUEA 4BA7A 3G7YA 3J7Yb 4JR4A 1E2YA 2F3MA 3UARA 3F3RA 4EL1A 2GTUA 5G2ZA 1RQMA 4EE0A 2OACA 2OE0A 2OKAA 2N5AA 2O87A 1DUGA 1EV4A 1SYRA 3KTBA 4YAVA 3M8NA 3TOTA 3VPQA 1XPVA 4D73B 2K8VA 4L5LA 5KN3A 2F9SA 3KD0A 1E6BA 2AYTA 2IIYA 1XBSA 1TU8A 2PPTA 2F8FA 1EGRA 1AIUA 2CVDA 1MD3A 4G0LA 4RI7A 3TCOA 4NPBA 5G1LA 5IMVA 1PN9A 5B6NA 5BMUA 4AJ7A 2VD0A 2N5FA 4HJMA 3VK9A 13GSA 3WD6A 2ZUPA 1XOAA 4IQAA 1LBKA 2YWMA 2K9FA 2K8SA 1ACVA 4XHMA 2DJ0A 3UEMA 1F6MC 4Q5RA 4AF2A 3ZFBA 4K0NA 2DBCA 2RM5A 4ML1A 1SK0A 3P2AA 4X43A 1EV9A 2VL2C 5IMDA 4Z7XA 5AIVA 4XCSA 2HQTA 4K7IA 3ZYWA 4TR1A 5HQPA 1O73A 2ON7A 3VWXA 4DSSB 3ZVJA 3FZ5A 3TJFA 1UA5A 2XBQA 1T4ZA 1O7UA 4KUNA 3TKRA 1O8WA 4BVXA 2B5EA 2AJQB 5ECIB 4F0CA 1YZXA 4RUVA 2JZRA 5G5FA 4MA9A 1XW5A 4BVYB 2L5LA 2V1MA 4NHWA 5AISA 2EC4A 2L6DA 1GUKA 1SKWB 3PINA 1EZKA 2IPAA 1R26A 4NAXA 1YJ6A 3GRXA 1MEKA 2H72A 1V9WA 1GP1A 2DC5A 1S3DA 5A4VA 3M9JA 2YWNA 5ID2B 6GSUA 4O92A 3KCMA 1PKZA 4IHUA 1DE1A 2N5BA 1F9MA 4I6XA 4FYCA 4XS1A 1W4VA 2IMDA 2RUEA 6GSTA 2H73A 1V57A 2FWFA 1G7OA 1O6JA 1CQHA 4JBBA 4ZIJA 3GH6A 3LYPA 2HZFA 2FY6A 1XW6A 1GTAA 1A23A 3KTLA 17GSA 3FEUA 3FY7A 5J4UA 1HYUA 5IO0A 1TK0B 3A2WA 5HFKA 5DJLA 4HDEA 22GSA 2GT5A 1A2LA 1TW9A 2HZEA 1SL0B 3F9UA 3FR9A 3GHAA 4Q5NA 6GSVA 4KGIA 2DIYA 4L5OA 1GUMA 3ME7A 4HI7A 5ELGA 3IHQA 2DJ1A 4GSSA 2NDOA 4POLA 2CVBA 1Z5YE 4IGJA 2WRTA 3F4SA 3HDCA 3CTGA 2WULA 4K7OA 3G9BA 2GDRA 4I2TA 2HNLA 5D9XA 2DJ2A 4DEJA 4JR6A 4ZL9A 1URMA 4LL1B 3IXRA 3M0FA 5IOXA 3ZVJD 1EGOA 1XOBA 2P31A 3F4TA 4TKYA 3ZRDA 2B1LA 12GSA 2IWTA 2LJAA 2WCIA 3L78A 2IMIA 4K8MA 1SKRB 11GSA 1SD9A 3EINA 3EMXA 2LJRA 1FVKA 3A5WA 2GZZA 4I97A 4WR5A 3H79A 2JADA 4IBPA 1O81A 2FLSA 5GSSA 3HHVA 1ZZYA 1TOFA 1ZOFA 3VWVA 5LCZA 2H8LA 4O7HA 5F05A 3D4TA 3S9FA 2E2MA 4MJBA 3N5OA 4G10A 2EIQA 5G5EA 1VRSD 2YV9A 3O6TA 2AV4A 4MABA 4OD7A 3LXZA 1O8XA 5H5SA 2L57A 2YJHA 3EWLA 5JCWA 3ME8A 2GS3A 4MJAA 3UOMA 2LQOA 2VL2A 1SK1A 2QGVA 4MJCA 1AQVA 3GUSA 5AN1A 5CAXA 1FHEA 1OVNA 2KP1A 3NIVA 5JWRB 1GSQA 4KDYA 2VO4A 2G2QA 1IYHA 4GTUA 3GKKA 4AGSA 2R6KA 2JU5A 3N9JA 3TRXA 2JSYA 2OA7A 1SENA 3APSA 4N10A 3LYKA 4ZBDA 3GL3A 3F6DA 3HD5A 2R37A 1M99A 2FNOA 4OFMA 1DSBA 3MNGA 2KUCA 4Q5QA 2C3QA 2E7PA 2V41A 4MZCA 3UBKA 5EPFA 3PGTA 5ECNB 1XVWA 3KP9A 1YKCA 2IMKA 1PGTA 3D22A 1TRWA 2IL3A 3KH7A 6GSSA 1A2JA 3CMIA 3VURA 2HYXA 3VI5A 1F3BA 1PSQA 1TXXA 2VL3A 2E0QA 3GYKA 2AUVA 1XWGA 1YQ1A 3VWUA 4DSRA 4PX1A 4GCIA 3DVWA 1DE2A 4G2EA 4EUYA 1PMTA 4MDCA 1W89A 4L0UA 2I4AA 1YKAA 3L9SA 5JWQB 3LJRA 1Z7RA 2VL9A 1ZMAA 2H1AA 3LORA 4TR0A 5A4UA 2HRNA 1V40A 4XRAA 2IFQB 2ON5A 2P5QA 4GWRA 3QDNA 4N11A 1T4YA 3U6VA 3GTUB 1A0RP 1ZYQB 5CREA 3EU4A 3TOUA 1PRXA 2CVKA 4TRXA 5HFGA 1DBYA 3H4KA 1O85A 2OJLA 4FH8A 3WGXA 2X8GA 4HQZA 2GZPA 4MPFA 4FIWA 1YF0A 1TP9A 2B5XA 4TXOA 1F3AA 1OE7A 4BL7B 1VF1A 3EU3A 1EOGA 3TGZA 2DJ3A 3GL5A 2YP6A 1V58A 3LQ7A 4G19A 2XBIA 2GGTA 2VD1A 2QKEA 3KMOA 4ZBBA 2R5GA 2K6VA 4V2MA 4N30A 5AGYA 3IRAA 5JWOB 3KH9A 2X99A 19GSA 1PKWA 3TJJA 3ZIVA 2YJ7A 1KEBA 4G0KA 1SJZA 3QMXA 1OKDA 3ZL5A 2DMLA 4NXIA 2C3NA 2B7JA 4HU9A 1TK5B 2XC2A 3IR4A 1SU9A 6GSYA 3HCZA 3F63A 2H1DA 2VM1A 1VGLA 2H71A 3UBLA 2WDUA 4XS4A 4CW9A 2H66A 1FO5A 1GTBA 4NMUA 4K2DA 3ED3A 3VLNA 5IO2A 2CX3A 1V2AA 5KN0A 1MDIA 5J9CA 5A4WA 2YPMA 3JCML 3LEFA 1YY7A 4LLRA 1M0UA 1Z3EA 4OCFA 1JLWA 4ZBAA 3RBTA 4PGTA 4PUFC 2RIIA 3W8SA 2VM2A 1Q98A 2H6YA 2IMEA 4TXVA 5CNWA 3Q19A 2BMXA 1Z6NA 1ZL9A 3Q6OA 4K1FA 4XTSA 3ZREA 1YF1A 2VCVA 4OO5A 1NHOA 2M72A 4ILFA 2HE3A 3VFIA 2FA8A 3VI7A 3QFAC 3GSSA 3LG6A 1S3CA 4QQ7A 3F4RA 1G6WA 3G7IA 2YWOA 3H93A 5JCGA 2KP2A 1AUCA 4GRFA 2UZ8A 3TDGA 4KCAA 3HVSA 3FR6A 4ECBA 3R2QA 2B6MA 3GKXA 3IC8A 3SBCA 1MD4A 4MJEA 5HR3A 5LD0A 3TKSE 3CSHA 1A24A 1TDIA 2OE1A 1ERVA 1GNWA 3WGEA 3A2XA 1JZRA 1WP0A 4O5RA 2M80A 1XWBA 4PQ1A 4G0IA 4POMA 14GSA 1M9AA 3I43A 4MZBA 2J23A 2LUSA 3HZ4A 3RPNA 1XWAA 4GQCA 3UVTA 5CP1A 5IM9A 3DXBA 2YV7A 3CSIA 4JZQA 2VCQA 3CRTA 2CZ3A 4DVCA 4K9ZA 4WXTA 2C8UA 5CYYA 5D73A 1EP7A 2HFDA 1YEXA 3Q18A 5IOWA 2O85A 4L8EA 3IE3A 1VF4A 1AAZA 1TTZA 5J41A 1GSFA 4V1Ag 2E2GA 3DEXA 5F06A 2PBJA 5F8BA 1VF3A 3E9JB 2GSSA 5IPHA 2HSYA 2MYGA 2LNTA 4MF7A 1WPIA 1LJRA 3ZZXA 5DAKA 1XZOA 2TRCP 5DCHA 5D9TA 2P5RA 1EOHA 2OADA 3C71A 2PGTA 1ZCPA 4TR1B 2B5YA 1BG5A 3L9VA 3EURA 2JACA 1RK4A 1U87A 1GNEA 5CRDA 3HVVA 2TRXA 1WMJA 2HXKA 2J9HA 1K0NA 4BVXB 3FZAA 4ZL8A 4KAEA 4POKA 1AQWA 4MP4A 1EEMA 2VUPA 2BJXA 4EDZA 5GSTA 5DAKB 1OC3A 4XS6A 4EDYA 4K6XA 2HLSA 4ZB8A 1FB6A 5HR1A 5DVBA 3H1NA 4QL7A 2V6OA 1T7PB 1PA3A 5ECQB 2XPDA 2HI7A 3TJBA 2FWGA 1ZYEA 4OFNA 4KB3A 5DQYA 3RDWA 5B8AA 1SL2B 3KP8A 2DIZA 2CT6A 3D4MA 2V32A 4IP1A 5L71A 2JZSA 1T3BA 2LNSA 3UJ1A 3H8QA 4WF4A 4EVMA 2KHPA 1GL8A 1TU7A 3IAS2 4F2IA 1X5EA 2DSAA 4J57E 2HZEB 4GSTA 4ACSA 1HNAA 2H1GA 2QSIA 3UL3A 3PPUA 4MLYA 3QCPA 3AY8A 3KJYA 2IMFA 1JHBA 3HJOA 3UIWA 4LL4B 1T8EB 4V2NA 2H30A 3IK7A 3MDKA 1SJIA 1GSDA 4O32A 1Y6EA 3ZMKA 4ISDA 3IPZA 4KSMA 2YCDA 1R5AA 4IELA 4ML6A 3IAM2 4DSQA 1ERTA 1M9BA 5ABRA 2YANA 1A8YA 4XRDA 3BOAA 4PUAA 3LXTA 3CXGA 3DMLA 18GSA 1HD2A 4TVEA 4CDOA 4HUAA 5D9WA 1BX9A 2MMNA 2GLRA 1M2DA 5DQSA 2C0FA 2FCHA 4X1UA 3K8NA 4NV2A 1GH2A 1X9SB 4F82A 4GXZA 4NWYA 2JZTA 3M3MA 1JZWA 3TRPA 4K7NA 3E3EA 1R4WA 4PQIA 4JE1A 1TKDB 5DALA 1HQOA 2ZCTA 3LSZA 2C80A 5ECKB 2C0EA 1X0RA 2HSHA 2C0DA 1XIYA 3A3TA 5ECSA 4FO5A 4WF5A 4IN0A 4GLTA 3ISOA 1ML6A 1WWJA 4PQHA 2NTOA 1SJ6A 1OYJA 3HY2A 4NV5A 4F9ZA 1ERUA 2WJUA 2X8CA 1UC7A 2H75A 1OC9A 1Z6MA 3D6IA 4CHSA 3FZ9A 1MDKA 3C8EA 3HVXA 4OMVA 3IOSA 4MK3A 1T1VA 3GKNA 1HNCA 1J0FA 3L4NA 1PX7A 3U5RE 4RQRA 2H74A 2KOKA 3GN3A 1B4PA 4HJ2A 5DCGA 1BAYA 4IP6A 1J9BA 1THOA 2FGXA 1M7TA 3I9V2 1K3OA 2YN1A 3IV4A 2FHEA 1OAZA 5IQYA 2M46A 5D8IA 5FHIA 2Z9SA 3GX0A 4E8HA 5B8BA 3ERGA 1QUWA 1N8JA 2GQLA 1U6TA 2O89A 5KN2A 1K0OA 1EWXA 2VCTA 1K3LA 3QR6A 3RPPA 4WKWA 1WOUA 3BCKA 2ALBA 3Q74A 2H6ZA 3M9KA 2F8AA 4IVFA 3HYPA 2VAFA 5INYA 1EEJA 1AC1A 2FWHA 3QOUA 1YDKA 2H0HA 5CRGA 2LQQA 5H5QA 3TKSC 3IK9A 4WETA 1OKTA 2O8VB 3D21A 2MZCA 4XIHA 4F03A 3TRQA 1H4OA 3TB2A 1QGVA 4AJ6A 4ULXA 4OO4A
chains in the Genus database with same CATH superfamily
1QFNA 2R0CA 5A5KA 4CY8A 1XCCA 3CRUA 4TXOB 2FUG2 3FKFA 1PQNA 1JZOA 5G1KA 4KDXA 5CRHA 2HSMA 5GAPD 1T00A 3F6FA 5F0GA 2B3SA 1ZGNA 4WBRD 3A2VA 4WBJA 2WVYA 4KCEA 1QQ2A 2AB6A 2PWJA 1AXDA 5IPGA 5G31A 2FD3A 5IMAA 3E0UA 4ID0A 10GSA 5EVOA 1VF2A 5A34B 3DD3A 1SD8A 3DRNA 3P8WA 3QAGA 2NPBA 3RAZA 4K0GA 5E59A 3UAPA 3V1WA 1OE8A 2C4JA 2B7KA 4MPGA 2H19A 3GIXA 1BJXA 4RQXA 1GWCA 5ECLB 3NOFA 4TR4A 4ZB6A 3MYDA 5DBQA 4J56E 4YAPA 1R5PA 2RLIA 2PVQA 1TRVA 3LFLA 4D73A 3IA1A 2I9HA 5J3RA 2PVOC 1WIKA 3KGKA 3GX8A 4MF5A 1NW2A 1KTEA 4XS4B 1NM3A 4N0VA 1FG4A 2HSNB 3GA4A 4HZ4A 4PNGA 4E8EA 2X8HA 4GF0A 1GLQA 2YZHA 4EC0A 3CSJA 2WVZA 2G0FA 3LGCA 1V98A 4AJ8A 2LKUA 2VCXA 1PL2A 2AHEA 4EKZA 3QD9A 2JL4A 5HFIA 1JFUA 5HR0A 2A2SA 5GZZB 2CA8A 6GSXA 5J5NA 2FWEA 4OWYA 3GMFA 2GVPA 3BJ5A 2VLUA 4KNDA 1A2MA 3R3EA 4I5QA 1X5DA 1XW9A 4DSSA 4V2LA 2LEGA 1AQXA 3IBHA 2RUFA 2GSTA 1GULA 5IMZA 3ZITA 4FQUA 4PURA 3O76A 4ZL7A 2B1KA 3VPTA 2CV4A 1AW9A 1K0MA 3QAVA 1WJKA 4N0ZA 1A8LA 1JLVA 1G7EA 3ZFLA 3MAKA 5JCUA 1U88A 4L0WA 3OR5A 1JZDA 5B6MA 2O7KA 4BWQA 4BVYA 3P7XA 3RFRC 4BIKA 3W6GA 1GTUA 1I9DA 2LS5A 1FB0A 1XWKA 4YQUA 1CQGA 4YQMA 3BBYA 1QMVA 3KXOA 3FZ4A 5ID2A 4F0BA 1TRSA 4KA0A 5A1NB 5E4WA 2LRNA 1GSUA 1FW1A 3TU3B 3TKQA 4ZB9A 4KH7A 4KX4A 4K2XA 3TKSA 3RHBA 1K3YA 3O3TA 1BYEA 1ZYPA 4YH2A 3GV1A 1N2AA 2PN8A 2R3XA 2V2GA 2H01A 4MH3A 1K0DA 2REMA 4HU7A 2L4CA 3MWHA 1GRXA 1I5GA 2LV3A 3KZQA 4PXOA 2IN3A 1GSEA 5FWGA 2WS2A 1M2AA 3F3QA 5KEJA 3IDVA 2NVLA 2XPEA 4ZXGA 3GNJA 2MBSA 4JU5A 1I1IP 1Z9HA 4ZILA 3GFKA 1G0TA 3CTFA 4EXJA 1TJDA 2F51A 2H76A 2NBSA 3J7Yk 4MMMA 4P3YB 1S4BP 3MSZA 3ZMLA 2H0IA 3BCIA 4X0XA 1FVJA 2IJYA 1BEDA 3LWAA 1B9XC 4HS1A 5KN1A 3WT1A 4MH2A 2ES7A 6GSWA 5COHA 4GQFA 4LMVA 4IW9A 4POBA 2CZ2A 5F07A 4FYUA 2PMTA 2L5OA 4H86A 3DWVA 3M1GA 5A5HB 3HXSA 5FT3A 2KLXA 4KW6A 2PU9C 2CQ9A 2MMOA 3FW2A 4KDUA 3C7MA 4EO3A 3F8UA 4BWSA 2PERA 3WGDA 1ERWA 1GSSA 1U3IA 3L0HA 2LRTA 2YWIA 2MBTA 2DJJA 5IMFA 3ERFA 3HA9A 5J9BA 2A4VA 1UVZA 2DLXA 3FR3A 2GSRA 2QC7A 2LRCA 1K0AA 1MTCA 2OE3A 1U3AA 2EFEA 2BTOT 7GSSA 3DYRA 3SWLA 2PUKC 1EP8A 1XFLA 5H5RA 4TW5A 3CBUA 2DKHA 5C04A 3C1RA 4RI6A 3GH9A 2VOCA 3DIEA 3FK8A 4WEYA 5C00A 2MMZA 2HRAA 3EC3A 4HQSA 1USBA 2HT9A 4HEA2 4YQVA 3G7JA 2P0GA 1SYXA 2A4HA 3UVHA 1Q4JA 1J08A 3QFBC 1X9WB 3P90A 1FOVA 1SK2A 3KM6A 3RGBC 3EPTA 2I1UA 3HJPA 1H75A 2K18A 5G30A 3FHKA 3ZIJA 3CYNA 4J2FA 2AAWA 4IKHA 4NHZA 4ICYA 3GKMA 1IYIA 4PHZC 3EE2A 4LA1A 2DJKA 5ECOB 5ENUA 5D93A 2EIOA 2YZUA 1B9YC 1K0BA 5B7CA 4KSOA 1GLPA 2R4VA 3NZNA 1B48A 3IC4A 3ERWA 4EF0A 5ECHB 3DGQA 5DJMA 4E68A 2V6KA 4TR3A 1A0FA 1UN2A 3EYTA 1WRYA 2TIRA 1LU4A 2VLTA 2CAIA 4HOJA 1S3AA 1K0CA 4QL9A 2EFDA 1PN0A 3DVXA 3CWGA 2JSZA 3TKPA 5GAND 1WE0A 1ON4A 1Y25A 1ABAA 1C72A 4PNFA 5HR2A 2I81A 3W8JA 1GUHA 5D96A 3ZTLA 1M2BA 2IFQA 2RM6A 1XG8A 2H70A 4JRRA 5ECRB 3APOA 8GSSA 3HKRA 4PTSA 1BQ7A 3GTUA 1X9MB 4V1Ap 3D5JA 1GSYA 4ECIA 1F37A 3C73A 3WT2A 3HVNA 1FAAA 1ILOA 4MZWA 4AKXB 5DALB 1XVQA 1QK8A 1HNBA 4OCEA 1B4QA 2WFCA 1THXA 3GURA 2GSQA 2H1BA 4GDFA 1TI1A 2LTKA 2EIRA 2VLVA 4BL7A 1KNGA 1SKSB 3HJMA 2WGRA 1PL1A 2C1YA 3C1SA 1PX6A 1PD21 4TN8A 1NHYA 2O36A 2YOIA 3BD2A 3KEBA 1TRUA 3FYGA 5ELAA 4HZ2A 1OC9B 2L6CA 5CO3A 2R2JA 2GQMA 2XHFA 5DDLA 3UMAA 3D0ZA 4MF6A 3KMNA 3PH9A 2VIMA 3VWWA 2C0GA 2GT6A 1MDJA 4MCUA 4TOPA 1Z7PA 2ZNMA 3PR8A 5J4YA 1QXHA 5D9VA 4ECJA 3RHCA 3QPMA 2WZ9A 1XXUA 4G01A 3F0IA 2LSTA 3TJGA 2FA4A 20GSA 3KIJA 4OFTA 5AIXA 2HRKA 2VCZA 4IQ1A 4GSNA 4KE3A 4JEDA 2H0GA 2MMAA 5EY6A 5IIZA 4I8BA 3ZLPA 5LNKe 1F2EA 5ECMB 4LMWA 2WW1A 4FXYP 2CAQA 3FRCA 5EL8A 4WR4A 1NSWA 2OBIA 3EMPA 2I3YA 4FYBA 2WB9A 9GSSA 4G9HA 16GSA 1R7HA 2X64A 1TI3A 2D2ZA 3I6AA 3WYWA 3US3A 4IJ3A 4BPYA 1OC8A 4Q5FA 2GZYA 1KBNA 2QA2A 3L9UA 2HRKB 2GQKA 4IS0A 3TJKA 2A2RA 3DKSA 1ZYNA 2WW2A 1ST9A 1G6YA 3HMJG 1TK8B 3APQA 5ECPB 1B8XA 3HZ8A 2OBKA 2L59A 2C3TA 1X5CA 4I2UA 2VCWA 2VKZG 3LW9A 3GSTA 3QAWA 2DMMA 4USSA 4IJIA 2H6XA 1SL1B 2LJKA 2YNXA 4ECCA 2CX4A 2L4QA 3EVIA 5IMCA 1XWCA 1GTIA 2HSMB 4KF9A 5CRWA 1RW1A 1YEPA 2HRFA 3I69A 3TUEA 4BA7A 3G7YA 3J7Yb 4JR4A 1E2YA 2O5VA 2F3MA 3UARA 3F3RA 4EL1A 2GTUA 5G2ZA 1RQMA 4EE0A 2OACA 2OE0A 2OKAA 2N5AA 2O87A 4O5QA 1DUGA 1EV4A 1SYRA 3KTBA 4YAVA 3M8NA 3TOTA 3VPQA 1XPVA 4D73B 2K8VA 4L5LA 5KN3A 2F9SA 3KD0A 1E6BA 2AYTA 2IIYA 1XBSA 1TU8A 2X4AA 2PPTA 2F8FA 1BG1A 1EGRA 1AIUA 2CVDA 1MD3A 4G0LA 4RI7A 4X4JA 3TCOA 4NPBA 5G1LA 5IMVA 1PN9A 5B6NA 4CY6A 5BMUA 4AJ7A 2VD0A 2N5FA 4HJMA 3VK9A 13GSA 3A5IA 3WD6A 2ZUPA 1XOAA 4IQAA 1LBKA 2YWMA 2K9FA 1SVLA 2K8SA 1ACVA 4XHMA 2DJ0A 3UEMA 1F6MC 4Q5RA 4AF2A 3ZFBA 4K0NA 2DBCA 2RM5A 4ML1A 1SK0A 4YKFA 3P2AA 4X43A 1EV9A 2VL2C 5IMDA 4Z7XA 5AIVA 4XCSA 2HQTA 4K7IA 3ZYWA 4TR1A 5HQPA 1O73A 2ON7A 3VWXA 4DSSB 3ZVJA 3FZ5A 3TJFA 1UA5A 2XBQA 1T4ZA 4N3ZA 1O7UA 4KUNA 3TKRA 1O8WA 4BVXA 2B5EA 2AJQB 1M3JA 5ECIB 4F0CA 1YZXA 4RUVA 2JZRA 5G5FA 4MA9A 1XW5A 4BVYB 2L5LA 2V1MA 4NHWA 5AISA 2EC4A 2L6DA 4O5UA 1GUKA 1SKWB 3PINA 1EZKA 2IPAA 1R26A 4NAXA 1YJ6A 3GRXA 2H72A 1MEKA 1V9WA 1GP1A 2DC5A 1S3DA 5A4VA 3M9JA 2YWNA 5ID2B 6GSUA 4O92A 3KCMA 1PKZA 4K5SA 4IHUA 1DE1A 2N5BA 1F9MA 4I6XA 4FYCA 4XS1A 4YKGA 1W4VA 4Z2UA 2IMDA 2RUEA 6GSTA 2H73A 1V57A 2FWFA 1G7OA 1O6JA 1CQHA 4JBBA 4ZIJA 3GH6A 3LYPA 2HZFA 2FY6A 1SVMA 1XW6A 1GTAA 1A23A 3KTLA 17GSA 3FEUA 3FY7A 5J4UA 1HYUA 5IO0A 1TK0B 3A2WA 5HFKA 5DJLA 4HDEA 22GSA 2GT5A 1A2LA 1TW9A 2HZEA 1SL0B 3F9UA 2WVXA 3FR9A 3GHAA 4Q5NA 6GSVA 1TXUA 4KGIA 4HSCX 2DIYA 4L5OA 1GUMA 3ME7A 4HI7A 5ELGA 3IHQA 2DJ1A 4GSSA 2NDOA 4POLA 2CVBA 1Z5YE 4IGJA 2WRTA 3F4SA 3HDCA 3CTGA 2WULA 4K7OA 4Z2RA 3G9BA 2GDRA 4I2TA 2HNLA 5D9XA 2DJ2A 4DEJA 4JR6A 4ZL9A 1URMA 4LL1B 3IXRA 3M0FA 5IOXA 3ZVJD 1EGOA 1XOBA 2P31A 3F4TA 4TKYA 3ZRDA 2B1LA 12GSA 2IWTA 2LJAA 2WCIA 3L78A 2IMIA 4K8MA 1SKRB 11GSA 1SD9A 3EINA 3EMXA 2LJRA 1FVKA 3A5WA 2GZZA 4I97A 4WR5A 3H79A 2JADA 4IBPA 1O81A 2FLSA 5GSSA 3HHVA 1ZZYA 1TOFA 1ZOFA 3VWVA 5LCZA 2H8LA 4O7HA 5F05A 3D4TA 3S9FA 2E2MA 4MJBA 3N5OA 4G10A 2EIQA 5G5EA 1VRSD 2YV9A 3O6TA 2AV4A 4MABA 4OD7A 3LXZA 1O8XA 5H5SA 2L57A 2YJHA 3EWLA 5JCWA 3ME8A 2GS3A 4MJAA 3UOMA 2LQOA 2VL2A 1SK1A 2QGVA 4MJCA 1AQVA 3FMWA 3GUSA 5AN1A 5CAXA 1FHEA 1OVNA 2KP1A 3NIVA 5JWRB 1GSQA 4KDYA 2VO4A 2G2QA 1IYHA 4GTUA 3GKKA 4AGSA 2R6KA 2JU5A 3N9JA 3TRXA 2JSYA 2OA7A 1SENA 3APSA 4N10A 3LYKA 4ZBDA 3GL3A 2WZSA 3F6DA 3HD5A 2R37A 1M99A 1PFOA 2FNOA 4OFMA 1DSBA 3MNGA 2KUCA 4Q5QA 2C3QA 2E7PA 2V41A 4MZCA 3UBKA 5EPFA 3PGTA 5ECNB 1XVWA 3KP9A 1YKCA 2IMKA 1PGTA 3D22A 1TRWA 2IL3A 3KH7A 6GSSA 1A2JA 3CMIA 3VURA 1S3RA 2HYXA 3VI5A 1F3BA 1PSQA 1TXXA 2VL3A 2E0QA 2WW0A 3GYKA 2AUVA 1XWGA 1YQ1A 3VWUA 4DSRA 4EIPA 4PX1A 3IHGA 4GCIA 3DVWA 1DE2A 4G2EA 4EUYA 1PMTA 4MDCA 1W89A 3CQFA 2DKIA 4L0UA 2I4AA 1YKAA 3L9SA 5JWQB 3LJRA 1Z7RA 2VL9A 1ZMAA 2H1AA 3LORA 4TR0A 5A4UA 2HRNA 1V40A 4XRAA 2IFQB 2ON5A 2P5QA 4EIQA 4GWRA 3QDNA 4N11A 1T4YA 3U6VA 3GTUB 1A0RP 1ZYQB 5CREA 3EU4A 3TOUA 5KOXA 1PRXA 2CVKA 4TRXA 4PI0C 5HFGA 1DBYA 4W66A 3H4KA 1O85A 2OJLA 4FH8A 3WGXA 2A2PA 2X8GA 4HQZA 2R0PA 5J40A 2GZPA 4MPFA 4FIWA 1YF0A 1TP9A 2B5XA 4TXOA 1F3AA 1OE7A 4BL7B 1VF1A 3EU3A 1EOGA 3TGZA 2DJ3A 3GL5A 2YP6A 1V58A 3LQ7A 4G19A 2XBIA 2GGTA 2VD1A 2QKEA 3KMOA 4Z2TA 4ZBBA 5A34A 2R5GA 2K6VA 4A5PA 4V2MA 4N30A 5AGYA 3IRAA 4AKHA 4QMKA 5JWOB 3KH9A 2X99A 19GSA 1PKWA 3TJJA 3ZIVA 4PI2C 2YJ7A 1KEBA 4G0KA 1SJZA 3QMXA 1OKDA 3ZL5A 2DMLA 4NXIA 2C3NA 2B7JA 4HU9A 1TK5B 2XC2A 3IR4A 1SU9A 6GSYA 3HCZA 3F63A 2H1DA 2VM1A 1VGLA 5KOWA 2H71A 3UBLA 2WDUA 4XS4A 4CW9A 2H66A 1FO5A 1GTBA 4NMUA 4K2DA 3ED3A 2HSNA 3VLNA 5IO2A 2CX3A 1V2AA 5KN0A 1MDIA 5J9CA 5A4WA 2YPMA 3JCML 3LEFA 1YY7A 4LLRA 1M0UA 1Z3EA 5J47A 4OCFA 1JLWA 4ZBAA 3RBTA 4PGTA 4PUFC 3CHXC 2RIIA 3W8SA 2VM2A 1Q98A 2H6YA 2IMEA 4TXVA 5CNWA 3Q19A 2BMXA 1Z6NA 1ZL9A 1BF5A 3Q6OA 4K1FA 4XTSA 3ZREA 1YF1A 2VCVA 4OO5A 1NHOA 2M72A 4ILFA 2HE3A 3VFIA 2FA8A 3VI7A 3QFAC 3GSSA 3LG6A 1S3CA 4QQ7A 3F4RA 1G6WA 3G7IA 2YWOA 3H93A 5JCGA 2KP2A 1AUCA 4GRFA 2UZ8A 3TDGA 4KCAA 3HVSA 3FR6A 4ECBA 1SVOA 3R2QA 2B6MA 3GKXA 3IC8A 3SBCA 1MD4A 4MJEA 5HR3A 2EFHA 5LD0A 3CSHA 3TKSE 1A24A 1TDIA 2OE1A 1ERVA 1GNWA 3WGEA 3A2XA 1JZRA 1WP0A 4O5RA 2M80A 1YVLA 1XWBA 4PQ1A 5A1NA 4G0IA 4POMA 14GSA 2UV8G 1M9AA 3I43A 4MZBA 2J23A 2LUSA 3HZ4A 3RPNA 1XWAA 4GQCA 3UVTA 5CP1A 5IM9A 3DXBA 2YV7A 3CSIA 4JZQA 2VCQA 3CRTA 2OT3A 2H1LA 2CZ3A 4DVCA 4K9ZA 4WXTA 2C8UA 5CYYA 2EFCA 5D73A 1EP7A 2HFDA 1YEXA 3Q18A 5IOWA 2O85A 4L8EA 3IE3A 5BRTA 1VF4A 5BMUB 1AAZA 1TTZA 5J41A 1GSFA 4V1Ag 2E2GA 3DEXA 5F06A 2PBJA 5F8BA 1VF3A 3E9JB 2GSSA 5IPHA 2HSYA 2MYGA 2LNTA 4MF7A 1WPIA 1LJRA 3ZZXA 5DAKA 1XZOA 2TRCP 5DCHA 5D9TA 2P5RA 1EOHA 2OADA 3C71A 2PGTA 1ZCPA 4TR1B 2B5YA 1BG5A 3L9VA 3EURA 1M3IA 2JACA 5A5HA 1RK4A 1U87A 1GNEA 5CRDA 3HVVA 2TRXA 1WMJA 2HXKA 2J9HA 1K0NA 4BVXB 3FZAA 4ZL8A 4KAEA 4POKA 1AQWA 4MP4A 3MIXA 1EEMA 2VUPA 2BJXA 4ZB7A 4EDZA 5GSTA 4AI6A 5DAKB 1N25A 1OC3A 4XS6A 4EDYA 4K6XA 2HLSA 4ZB8A 1FB6A 5HR1A 2O3EA 5DVBA 3H1NA 4QL7A 2V6OA 1T7PB 4AKIA 1PA3A 5ECQB 2XPDA 2HI7A 3TJBA 2FWGA 1ZYEA 4OFNA 4KB3A 4K5RA 5DQYA 3RDWA 5B8AA 1SL2B 3KP8A 2DIZA 2CT6A 3D4MA 2V32A 4IP1A 5L71A 2JZSA 1T3BA 2LNSA 3UJ1A 3H8QA 4WF4A 4EVMA 2KHPA 1GL8A 1TU7A 3IAS2 4F2IA 1X5EA 2DSAA 4J57E 2HZEB 4GSTA 4ACSA 1HNAA 2H1GA 2QSIA 2WVXB 3UL3A 3PPUA 4MLYA 3QCPA 3AY8A 3KJYA 2IMFA 1JHBA 3HJOA 1FOHA 3UIWA 4LL4B 1T8EB 4V2NA 2H30A 3IK7A 3MDKA 1SJIA 1GSDA 4O32A 1Y6EA 3ZMKA 4ISDA 4AKGA 3IPZA 4KSMA 2YCDA 1R5AA 4IELA 4ML6A 3IAM2 4DSQA 1ERTA 1M9BA 5ABRA 2YANA 1A8YA 4XRDA 3BOAA 4PUAA 3LXTA 3CXGA 3DMLA 18GSA 1HD2A 4TVEA 4CDOA 4HUAA 5D9WA 1BX9A 2QA1A 2MMNA 2GLRA 1M2DA 5DQSA 2C0FA 2FCHA 4X1UA 3K8NA 4NV2A 1GH2A 1X9SB 4F82A 4GXZA 4NWYA 2R0GA 2JZTA 3M3MA 1JZWA 3TRPA 4K7NA 3E3EA 1R4WA 4PQIA 4JE1A 1TKDB 5DALA 1HQOA 4MNNA 2ZCTA 3LSZA 2C80A 5ECKB 2C0EA 1X0RA 2HSHA 2C0DA 1XIYA 3A3TA 5ECSA 4FO5A 4WF5A 4IN0A 4GLTA 3ISOA 5J4VA 1ML6A 1WWJA 4PQHA 2NTOA 1SJ6A 1OYJA 3HY2A 1Y1UA 4NV5A 4F9ZA 1ERUA 2WJUA 2X8CA 1UC7A 2H75A 1OC9A 1Z6MA 3D6IA 4CHSA 3FZ9A 1MDKA 3C8EA 3HVXA 4OMVA 3IOSA 4MK3A 1T1VA 3GKNA 1HNCA 1J0FA 3L4NA 1PX7A 3U5RE 4RQRA 2H74A 2KOKA 3GN3A 1B4PA 4HJ2A 5DCGA 1BAYA 4IP6A 1J9BA 1THOA 2FGXA 1M7TA 3I9V2 1K3OA 2YN1A 3IV4A 2FHEA 1OAZA 5IQYA 2M46A 5D8IA 5FHIA 2Z9SA 3GX0A 4E8HA 2WW3A 5B8BA 3ERGA 1YEWC 1QUWA 1N8JA 2GQLA 1U6TA 2O89A 5KN2A 1K0OA 1EWXA 2VCTA 1K3LA 3QR6A 3RPPA 4WKWA 1WOUA 3BCKA 2ALBA 3Q74A 2H6ZA 3M9KA 2F8AA 4IVFA 3HYPA 2VAFA 5INYA 1EEJA 1AC1A 2FWHA 3QOUA 1YDKA 2H0HA 5CRGA 2LQQA 5H5QA 3TKSC 3IK9A 4WETA 1OKTA 2O8VB 3D21A 2MZCA 4XIHA 2X49A 4F03A 3TRQA 1H4OA 3TB2A 1QGVA 4AJ6A 4ULXA 4OO4A
chains in the Genus database with same CATH topology
1QFNA 2R0CA 5A5KA 4CY8A 1XCCA 3CRUA 4TXOB 2FUG2 3FKFA 1PQNA 1JZOA 5G1KA 4KDXA 5CRHA 2HSMA 5GAPD 1T00A 3F6FA 5F0GA 2B3SA 1ZGNA 4WBRD 3A2VA 4WBJA 4KCEA 1QQ2A 2AB6A 2PWJA 1AXDA 5IPGA 5G31A 2FD3A 5IMAA 3E0UA 4ID0A 10GSA 5EVOA 1VF2A 5A34B 3DD3A 1SD8A 3DRNA 3P8WA 3QAGA 2NPBA 3RAZA 4K0GA 5E59A 3UAPA 3V1WA 1OE8A 2C4JA 2B7KA 4MPGA 2H19A 3GIXA 1BJXA 4RQXA 1GWCA 5ECLB 3NOFA 4TR4A 4ZB6A 3MYDA 5DBQA 4J56E 4YAPA 1R5PA 2RLIA 2PVQA 1TRVA 3LFLA 4D73A 3IA1A 2I9HA 5J3RA 2PVOC 1WIKA 3KGKA 3GX8A 4MF5A 1NW2A 1KTEA 4XS4B 1NM3A 4N0VA 1FG4A 2HSNB 3GA4A 4HZ4A 4PNGA 4E8EA 2X8HA 4GF0A 1GLQA 2YZHA 4EC0A 3CSJA 2G0FA 3LGCA 1V98A 4AJ8A 2LKUA 2VCXA 1PL2A 2AHEA 4EKZA 3QD9A 2JL4A 5HFIA 1JFUA 5HR0A 2A2SA 5GZZB 2CA8A 6GSXA 5J5NA 2FWEA 4OWYA 3GMFA 2GVPA 3BJ5A 2VLUA 4KNDA 1A2MA 3R3EA 4I5QA 1X5DA 1XW9A 4DSSA 4V2LA 2LEGA 1AQXA 3IBHA 2RUFA 2GSTA 1GULA 5IMZA 3ZITA 4FQUA 4PURA 3O76A 4ZL7A 2B1KA 3VPTA 2CV4A 1AW9A 1K0MA 3QAVA 1WJKA 4N0ZA 1A8LA 1JLVA 1G7EA 3ZFLA 3MAKA 5JCUA 1U88A 4L0WA 3OR5A 1JZDA 5B6MA 2O7KA 4BWQA 4BVYA 3P7XA 3W6GA 1GTUA 1I9DA 2LS5A 1FB0A 1XWKA 4YQUA 1CQGA 4YQMA 3BBYA 1QMVA 3KXOA 3FZ4A 5ID2A 4F0BA 1TRSA 4KA0A 5A1NB 5E4WA 2LRNA 1GSUA 1FW1A 3TU3B 3TKQA 4ZB9A 4KH7A 4KX4A 4K2XA 3TKSA 3RHBA 3O3TA 1K3YA 1BYEA 1ZYPA 4YH2A 3GV1A 1N2AA 2PN8A 2R3XA 2V2GA 2H01A 4MH3A 1K0DA 2REMA 4HU7A 2L4CA 3MWHA 1GRXA 1I5GA 2LV3A 3KZQA 4PXOA 2IN3A 1GSEA 5FWGA 2WS2A 1M2AA 3F3QA 5KEJA 3IDVA 2NVLA 2XPEA 4ZXGA 3GNJA 2MBSA 4JU5A 1Z9HA 4ZILA 3GFKA 1G0TA 3CTFA 4EXJA 1TJDA 2F51A 2H76A 2NBSA 3J7Yk 4MMMA 4P3YB 3MSZA 3ZMLA 2H0IA 3BCIA 4X0XA 1FVJA 2IJYA 1BEDA 3LWAA 1B9XC 4HS1A 5KN1A 3WT1A 4MH2A 2ES7A 6GSWA 5COHA 4GQFA 4LMVA 4IW9A 4POBA 2CZ2A 5F07A 4FYUA 2PMTA 2L5OA 4H86A 3DWVA 3M1GA 5A5HB 3HXSA 5FT3A 2KLXA 4KW6A 2PU9C 2CQ9A 2MMOA 3FW2A 4KDUA 3C7MA 4EO3A 3F8UA 4BWSA 2PERA 3WGDA 1ERWA 1GSSA 1U3IA 3L0HA 2LRTA 2YWIA 2MBTA 2DJJA 5IMFA 3ERFA 3HA9A 5J9BA 2A4VA 1UVZA 2DLXA 3FR3A 2GSRA 2QC7A 2LRCA 1K0AA 1MTCA 2OE3A 1U3AA 2EFEA 2BTOT 7GSSA 3DYRA 3SWLA 2PUKC 1EP8A 1XFLA 5H5RA 4TW5A 3CBUA 2DKHA 5C04A 3C1RA 4RI6A 3GH9A 2VOCA 3DIEA 3FK8A 4WEYA 5C00A 2MMZA 2HRAA 3EC3A 4HQSA 1USBA 2HT9A 4HEA2 4YQVA 3G7JA 2P0GA 1SYXA 2A4HA 3UVHA 1Q4JA 1J08A 3QFBC 1X9WB 3P90A 1FOVA 1SK2A 3KM6A 3EPTA 2I1UA 3HJPA 1H75A 2K18A 5G30A 3FHKA 3ZIJA 3CYNA 4J2FA 2AAWA 4IKHA 4NHZA 4ICYA 3GKMA 1IYIA 3EE2A 4LA1A 2DJKA 5ECOB 5ENUA 5D93A 2EIOA 2YZUA 1B9YC 1K0BA 5B7CA 4KSOA 1GLPA 2R4VA 3NZNA 1B48A 3IC4A 3ERWA 4EF0A 5ECHB 3DGQA 5DJMA 4E68A 2V6KA 4TR3A 1A0FA 1UN2A 3EYTA 1WRYA 2TIRA 1LU4A 2VLTA 2CAIA 4HOJA 1S3AA 1K0CA 4QL9A 2EFDA 1PN0A 3DVXA 3CWGA 2JSZA 3TKPA 5GAND 1WE0A 1ON4A 1Y25A 1ABAA 1C72A 4PNFA 5HR2A 2I81A 3W8JA 1GUHA 5D96A 3ZTLA 1M2BA 2IFQA 2RM6A 2H70A 4JRRA 5ECRB 3APOA 8GSSA 3HKRA 4PTSA 1BQ7A 3GTUA 1X9MB 4V1Ap 3D5JA 1GSYA 4ECIA 1F37A 3C73A 3WT2A 1FAAA 1ILOA 4MZWA 4AKXB 5DALB 1XVQA 1QK8A 1HNBA 4OCEA 1B4QA 2WFCA 1THXA 3GURA 2GSQA 2H1BA 4GDFA 1TI1A 2LTKA 2EIRA 2VLVA 4BL7A 1KNGA 1SKSB 3HJMA 2WGRA 1PL1A 2C1YA 3C1SA 1PX6A 1PD21 4TN8A 1NHYA 2YOIA 3BD2A 3KEBA 1TRUA 3FYGA 5ELAA 4HZ2A 1OC9B 2L6CA 5CO3A 2R2JA 2GQMA 2XHFA 5DDLA 3UMAA 3D0ZA 4MF6A 3KMNA 3PH9A 2VIMA 3VWWA 2C0GA 2GT6A 1MDJA 4MCUA 4TOPA 1Z7PA 2ZNMA 3PR8A 5J4YA 1QXHA 5D9VA 4ECJA 3RHCA 3QPMA 2WZ9A 1XXUA 4G01A 3F0IA 2LSTA 3TJGA 2FA4A 20GSA 3KIJA 4OFTA 5AIXA 2HRKA 2VCZA 4IQ1A 4GSNA 4KE3A 4JEDA 2H0GA 2MMAA 5EY6A 5IIZA 4I8BA 3ZLPA 5LNKe 1F2EA 5ECMB 4LMWA 2CAQA 3FRCA 5EL8A 4WR4A 1NSWA 2OBIA 3EMPA 2I3YA 4FYBA 2WB9A 9GSSA 4G9HA 16GSA 1R7HA 2X64A 1TI3A 2D2ZA 3I6AA 3WYWA 3US3A 4IJ3A 4BPYA 1OC8A 4Q5FA 2GZYA 1KBNA 2QA2A 3L9UA 2HRKB 2GQKA 4IS0A 3TJKA 2A2RA 3DKSA 1ZYNA 1ST9A 1G6YA 3HMJG 1TK8B 3APQA 5ECPB 1B8XA 3HZ8A 2OBKA 2L59A 2C3TA 1X5CA 4I2UA 2VCWA 2VKZG 3LW9A 3GSTA 3QAWA 2DMMA 4USSA 4IJIA 2H6XA 1SL1B 2LJKA 2YNXA 4ECCA 2CX4A 2L4QA 3EVIA 5IMCA 1XWCA 1GTIA 2HSMB 4KF9A 5CRWA 1RW1A 1YEPA 2HRFA 3I69A 3TUEA 4BA7A 3G7YA 3J7Yb 4JR4A 1E2YA 2O5VA 2F3MA 3UARA 3F3RA 4EL1A 2GTUA 5G2ZA 1RQMA 4EE0A 2OACA 2OE0A 2OKAA 2N5AA 2O87A 4O5QA 1DUGA 1EV4A 1SYRA 3KTBA 4YAVA 3M8NA 3TOTA 3VPQA 1XPVA 4D73B 2K8VA 4L5LA 5KN3A 2F9SA 3KD0A 1E6BA 2AYTA 2IIYA 1XBSA 1TU8A 2X4AA 2PPTA 2F8FA 1BG1A 1EGRA 1AIUA 2CVDA 1MD3A 4G0LA 4RI7A 4X4JA 3TCOA 4NPBA 5G1LA 5IMVA 1PN9A 5B6NA 4CY6A 5BMUA 4AJ7A 2VD0A 2N5FA 4HJMA 3VK9A 13GSA 3A5IA 3WD6A 2ZUPA 1XOAA 4IQAA 1LBKA 2YWMA 2K9FA 1SVLA 2K8SA 1ACVA 4XHMA 2DJ0A 3UEMA 1F6MC 4Q5RA 4AF2A 3ZFBA 4K0NA 2DBCA 2RM5A 4ML1A 1SK0A 4YKFA 3P2AA 4X43A 1EV9A 2VL2C 5IMDA 4Z7XA 5AIVA 4XCSA 2HQTA 4K7IA 3ZYWA 4TR1A 5HQPA 1O73A 2ON7A 3VWXA 4DSSB 3ZVJA 3FZ5A 3TJFA 1UA5A 2XBQA 1T4ZA 4N3ZA 1O7UA 4KUNA 3TKRA 1O8WA 4BVXA 2B5EA 2AJQB 5ECIB 4F0CA 1YZXA 4RUVA 2JZRA 5G5FA 4MA9A 1XW5A 4BVYB 2L5LA 2V1MA 4NHWA 5AISA 2EC4A 2L6DA 4O5UA 1GUKA 1SKWB 3PINA 1EZKA 2IPAA 1R26A 4NAXA 1YJ6A 3GRXA 2H72A 1MEKA 1V9WA 1GP1A 2DC5A 1S3DA 5A4VA 3M9JA 2YWNA 5ID2B 6GSUA 4O92A 3KCMA 1PKZA 4K5SA 4IHUA 1DE1A 2N5BA 1F9MA 4I6XA 4FYCA 4XS1A 4YKGA 1W4VA 4Z2UA 2IMDA 2RUEA 6GSTA 2H73A 1V57A 2FWFA 1G7OA 1O6JA 1CQHA 4JBBA 4ZIJA 3GH6A 3LYPA 2HZFA 2FY6A 1SVMA 1XW6A 1GTAA 1A23A 3KTLA 17GSA 3FEUA 3FY7A 5J4UA 1HYUA 5IO0A 1TK0B 3A2WA 5HFKA 5DJLA 4HDEA 22GSA 2GT5A 1A2LA 1TW9A 2HZEA 1SL0B 3F9UA 3FR9A 3GHAA 4Q5NA 6GSVA 1TXUA 4KGIA 2DIYA 4L5OA 1GUMA 3ME7A 4HI7A 5ELGA 3IHQA 2DJ1A 4GSSA 2NDOA 4POLA 2CVBA 1Z5YE 4IGJA 2WRTA 3F4SA 3HDCA 3CTGA 2WULA 4K7OA 4Z2RA 3G9BA 2GDRA 4I2TA 2HNLA 5D9XA 2DJ2A 4DEJA 4JR6A 4ZL9A 1URMA 4LL1B 3IXRA 3M0FA 5IOXA 3ZVJD 1EGOA 1XOBA 2P31A 3F4TA 4TKYA 3ZRDA 2B1LA 12GSA 2IWTA 2LJAA 2WCIA 3L78A 2IMIA 4K8MA 1SKRB 11GSA 1SD9A 3EINA 3EMXA 2LJRA 1FVKA 3A5WA 2GZZA 4I97A 4WR5A 3H79A 2JADA 4IBPA 1O81A 2FLSA 5GSSA 3HHVA 1ZZYA 1TOFA 1ZOFA 3VWVA 5LCZA 2H8LA 4O7HA 5F05A 3D4TA 3S9FA 2E2MA 4MJBA 3N5OA 4G10A 2EIQA 5G5EA 1VRSD 2YV9A 3O6TA 2AV4A 4MABA 4OD7A 3LXZA 1O8XA 5H5SA 2L57A 2YJHA 3EWLA 5JCWA 3ME8A 2GS3A 4MJAA 3UOMA 2LQOA 2VL2A 1SK1A 2QGVA 4MJCA 1AQVA 3FMWA 3GUSA 5AN1A 5CAXA 1FHEA 1OVNA 2KP1A 3NIVA 5JWRB 1GSQA 4KDYA 2VO4A 2G2QA 1IYHA 4GTUA 3GKKA 4AGSA 2R6KA 2JU5A 3N9JA 3TRXA 2JSYA 2OA7A 1SENA 3APSA 4N10A 3LYKA 4ZBDA 3GL3A 3F6DA 3HD5A 2R37A 1M99A 2FNOA 4OFMA 1DSBA 3MNGA 2KUCA 4Q5QA 2C3QA 2E7PA 2V41A 4MZCA 3UBKA 5EPFA 3PGTA 5ECNB 1XVWA 3KP9A 1YKCA 2IMKA 1PGTA 3D22A 1TRWA 2IL3A 3KH7A 6GSSA 1A2JA 3CMIA 3VURA 2HYXA 3VI5A 1F3BA 1PSQA 1TXXA 2VL3A 2E0QA 3GYKA 2AUVA 1XWGA 1YQ1A 3VWUA 4DSRA 4EIPA 4PX1A 3IHGA 4GCIA 3DVWA 1DE2A 4G2EA 4EUYA 1PMTA 4MDCA 1W89A 2DKIA 4L0UA 2I4AA 1YKAA 3L9SA 5JWQB 3LJRA 1Z7RA 2VL9A 1ZMAA 2H1AA 3LORA 4TR0A 5A4UA 2HRNA 1V40A 4XRAA 2IFQB 2ON5A 2P5QA 4EIQA 4GWRA 3QDNA 4N11A 1T4YA 3U6VA 3GTUB 1A0RP 1ZYQB 5CREA 3EU4A 3TOUA 5KOXA 1PRXA 2CVKA 4TRXA 5HFGA 1DBYA 4W66A 3H4KA 1O85A 2OJLA 4FH8A 3WGXA 2A2PA 2X8GA 4HQZA 2R0PA 5J40A 2GZPA 4MPFA 4FIWA 1YF0A 1TP9A 2B5XA 4TXOA 1F3AA 1OE7A 4BL7B 1VF1A 3EU3A 1EOGA 3TGZA 2DJ3A 3GL5A 2YP6A 1V58A 3LQ7A 4G19A 2XBIA 2GGTA 2VD1A 2QKEA 3KMOA 4Z2TA 4ZBBA 5A34A 2R5GA 2K6VA 4A5PA 4V2MA 4N30A 5AGYA 3IRAA 4AKHA 4QMKA 5JWOB 3KH9A 2X99A 19GSA 1PKWA 3TJJA 3ZIVA 2YJ7A 1KEBA 4G0KA 1SJZA 3QMXA 1OKDA 3ZL5A 2DMLA 4NXIA 2C3NA 2B7JA 4HU9A 1TK5B 2XC2A 3IR4A 1SU9A 6GSYA 3HCZA 3F63A 2H1DA 2VM1A 1VGLA 5KOWA 2H71A 3UBLA 2WDUA 4XS4A 4CW9A 2H66A 1FO5A 1GTBA 4NMUA 4K2DA 3ED3A 2HSNA 3VLNA 5IO2A 2CX3A 1V2AA 5KN0A 1MDIA 5J9CA 5A4WA 2YPMA 3JCML 3LEFA 1YY7A 4LLRA 1M0UA 1Z3EA 5J47A 4OCFA 1JLWA 4ZBAA 3RBTA 4PGTA 4PUFC 2RIIA 3W8SA 2VM2A 1Q98A 2H6YA 2IMEA 4TXVA 5CNWA 3Q19A 2BMXA 1Z6NA 1ZL9A 1BF5A 3Q6OA 4K1FA 4XTSA 3ZREA 1YF1A 2VCVA 4OO5A 1NHOA 2M72A 4ILFA 2HE3A 3VFIA 2FA8A 3VI7A 3QFAC 3GSSA 3LG6A 1S3CA 4QQ7A 3F4RA 1G6WA 3G7IA 2YWOA 3H93A 5JCGA 2KP2A 1AUCA 4GRFA 2UZ8A 3TDGA 4KCAA 3HVSA 3FR6A 4ECBA 1SVOA 3R2QA 2B6MA 3GKXA 3IC8A 3SBCA 1MD4A 4MJEA 5HR3A 2EFHA 5LD0A 3CSHA 3TKSE 1A24A 1TDIA 2OE1A 1ERVA 1GNWA 3WGEA 3A2XA 1JZRA 1WP0A 4O5RA 2M80A 1YVLA 1XWBA 4PQ1A 5A1NA 4G0IA 4POMA 14GSA 2UV8G 1M9AA 3I43A 4MZBA 2J23A 2LUSA 3HZ4A 3RPNA 1XWAA 4GQCA 3UVTA 5CP1A 5IM9A 3DXBA 2YV7A 3CSIA 4JZQA 2VCQA 3CRTA 2OT3A 2H1LA 2CZ3A 4DVCA 4K9ZA 4WXTA 2C8UA 5CYYA 2EFCA 5D73A 1EP7A 2HFDA 1YEXA 3Q18A 5IOWA 2O85A 4L8EA 3IE3A 5BRTA 1VF4A 5BMUB 1AAZA 1TTZA 5J41A 1GSFA 4V1Ag 2E2GA 3DEXA 5F06A 2PBJA 5F8BA 1VF3A 3E9JB 2GSSA 5IPHA 2HSYA 2MYGA 2LNTA 4MF7A 1WPIA 1LJRA 3ZZXA 5DAKA 1XZOA 2TRCP 5DCHA 5D9TA 2P5RA 1EOHA 2OADA 3C71A 2PGTA 1ZCPA 4TR1B 2B5YA 1BG5A 3L9VA 3EURA 2JACA 5A5HA 1RK4A 1U87A 1GNEA 5CRDA 3HVVA 2TRXA 1WMJA 2HXKA 2J9HA 1K0NA 4BVXB 3FZAA 4ZL8A 4KAEA 4POKA 1AQWA 4MP4A 3MIXA 1EEMA 2VUPA 2BJXA 4ZB7A 4EDZA 5GSTA 4AI6A 5DAKB 1N25A 1OC3A 4XS6A 4EDYA 4K6XA 2HLSA 4ZB8A 1FB6A 5HR1A 5DVBA 3H1NA 4QL7A 2V6OA 1T7PB 4AKIA 1PA3A 5ECQB 2XPDA 2HI7A 3TJBA 2FWGA 1ZYEA 4OFNA 4KB3A 4K5RA 5DQYA 3RDWA 5B8AA 1SL2B 3KP8A 2DIZA 2CT6A 3D4MA 2V32A 4IP1A 5L71A 2JZSA 1T3BA 2LNSA 3UJ1A 3H8QA 4WF4A 4EVMA 2KHPA 1GL8A 1TU7A 3IAS2 4F2IA 1X5EA 2DSAA 4J57E 2HZEB 4GSTA 4ACSA 1HNAA 2H1GA 2QSIA 3UL3A 3PPUA 4MLYA 3QCPA 3AY8A 3KJYA 2IMFA 1JHBA 3HJOA 1FOHA 3UIWA 4LL4B 1T8EB 4V2NA 2H30A 3IK7A 3MDKA 1SJIA 1GSDA 4O32A 1Y6EA 3ZMKA 4ISDA 4AKGA 3IPZA 4KSMA 2YCDA 1R5AA 4IELA 4ML6A 3IAM2 4DSQA 1ERTA 1M9BA 5ABRA 2YANA 1A8YA 4XRDA 3BOAA 4PUAA 3LXTA 3CXGA 3DMLA 18GSA 1HD2A 4TVEA 4CDOA 4HUAA 5D9WA 1BX9A 2QA1A 2MMNA 2GLRA 1M2DA 5DQSA 2C0FA 2FCHA 4X1UA 3K8NA 4NV2A 1GH2A 1X9SB 4F82A 4GXZA 4NWYA 2R0GA 2JZTA 3M3MA 1JZWA 3TRPA 4K7NA 3E3EA 1R4WA 4PQIA 4JE1A 1TKDB 5DALA 1HQOA 4MNNA 2ZCTA 3LSZA 2C80A 5ECKB 2C0EA 1X0RA 2HSHA 2C0DA 1XIYA 3A3TA 5ECSA 4FO5A 4WF5A 4IN0A 4GLTA 3ISOA 5J4VA 1ML6A 1WWJA 4PQHA 2NTOA 1SJ6A 1OYJA 3HY2A 1Y1UA 4NV5A 4F9ZA 1ERUA 2WJUA 2X8CA 1UC7A 2H75A 1OC9A 1Z6MA 3D6IA 4CHSA 3FZ9A 1MDKA 3C8EA 3HVXA 4OMVA 3IOSA 4MK3A 1T1VA 3GKNA 1HNCA 1J0FA 3L4NA 1PX7A 3U5RE 4RQRA 2H74A 2KOKA 3GN3A 1B4PA 4HJ2A 5DCGA 1BAYA 4IP6A 1J9BA 1THOA 2FGXA 1M7TA 3I9V2 1K3OA 2YN1A 3IV4A 2FHEA 1OAZA 5IQYA 2M46A 5D8IA 5FHIA 2Z9SA 3GX0A 4E8HA 5B8BA 3ERGA 1QUWA 1N8JA 2GQLA 1U6TA 2O89A 5KN2A 1K0OA 1EWXA 2VCTA 1K3LA 3QR6A 3RPPA 4WKWA 1WOUA 3BCKA 2ALBA 3Q74A 2H6ZA 3M9KA 2F8AA 4IVFA 3HYPA 2VAFA 5INYA 1EEJA 1AC1A 2FWHA 3QOUA 1YDKA 2H0HA 5CRGA 2LQQA 5H5QA 3TKSC 3IK9A 4WETA 1OKTA 2O8VB 3D21A 2MZCA 4XIHA 2X49A 4F03A 3TRQA 1H4OA 3TB2A 1QGVA 4AJ6A 4ULXA 4OO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFN A;  5A5K A;  1XCC A;  3CRU A;  4TXO B;  2FUG 2;  3FKF A;  1PQN A;  1JZO A;  5G1K A;  4KDX A;  5CRH A;  2HSM A;  5GAP D;  1T00 A;  3F6F A;  5F0G A;  2B3S A;  1ZGN A;  4WBR D;  3A2V A;  4WBJ A;  4KCE A;  1QQ2 A;  2AB6 A;  2PWJ A;  1AXD A;  5IPG A;  5G31 A;  2FD3 A;  5IMA A;  3E0U A;  4ID0 A;  10GS A;  5EVO A;  1VF2 A;  3DD3 A;  1SD8 A;  3DRN A;  3P8W A;  3QAG A;  2NPB A;  3RAZ A;  4K0G A;  5E59 A;  3UAP A;  3V1W A;  1OE8 A;  2C4J A;  2B7K A;  4MPG A;  2H19 A;  3GIX A;  1BJX A;  4RQX A;  1GWC A;  5ECL B;  3NOF A;  4TR4 A;  4ZB6 A;  5DBQ A;  4J56 E;  4YAP A;  1R5P A;  2RLI A;  2PVQ A;  1TRV A;  3LFL A;  4D73 A;  3IA1 A;  2I9H A;  5J3R A;  2PVO C;  1WIK A;  3KGK A;  3GX8 A;  4MF5 A;  1NW2 A;  1KTE A;  4XS4 B;  1NM3 A;  4N0V A;  1FG4 A;  2HSN B;  3GA4 A;  4HZ4 A;  4PNG A;  4E8E A;  2X8H A;  4GF0 A;  1GLQ A;  2YZH A;  4EC0 A;  3CSJ A;  2G0F A;  3LGC A;  1V98 A;  4AJ8 A;  2LKU A;  2VCX A;  1PL2 A;  2AHE A;  4EKZ A;  3QD9 A;  2JL4 A;  5HFI A;  1JFU A;  5HR0 A;  2A2S A;  5GZZ B;  2CA8 A;  6GSX A;  5J5N A;  2FWE A;  4OWY A;  3GMF A;  2GVP A;  3BJ5 A;  2VLU A;  4KND A;  1A2M A;  3R3E A;  4I5Q A;  1X5D A;  1XW9 A;  4DSS A;  4V2L A;  2LEG A;  1AQX A;  3IBH A;  2RUF A;  2GST A;  1GUL A;  5IMZ A;  3ZIT A;  4FQU A;  4PUR A;  3O76 A;  4ZL7 A;  2B1K A;  3VPT A;  2CV4 A;  1AW9 A;  1K0M A;  3QAV A;  1WJK A;  4N0Z A;  1A8L A;  1JLV A;  1G7E A;  3ZFL A;  3MAK A;  5JCU A;  1U88 A;  4L0W A;  3OR5 A;  1JZD A;  5B6M A;  2O7K A;  4BWQ A;  4BVY A;  3P7X A;  3W6G A;  1GTU A;  1I9D A;  2LS5 A;  1FB0 A;  1XWK A;  4YQU A;  1CQG A;  4YQM A;  3BBY A;  1QMV A;  3KXO A;  3FZ4 A;  5ID2 A;  4F0B A;  1TRS A;  4KA0 A;  5E4W A;  2LRN A;  1GSU A;  1FW1 A;  3TKQ A;  4ZB9 A;  4KH7 A;  4KX4 A;  3TKS A;  3RHB A;  1K3Y A;  3O3T A;  1BYE A;  4YH2 A;  3GV1 A;  1N2A A;  2PN8 A;  2R3X A;  2V2G A;  2H01 A;  4MH3 A;  1K0D A;  2REM A;  4HU7 A;  2L4C A;  3MWH A;  1GRX A;  1I5G A;  2LV3 A;  3KZQ A;  4PXO A;  2IN3 A;  1GSE A;  5FWG A;  2WS2 A;  1M2A A;  3F3Q A;  5KEJ A;  3IDV A;  2NVL A;  2XPE A;  4ZXG A;  3GNJ A;  2MBS A;  4JU5 A;  1Z9H A;  4ZIL A;  3GFK A;  1G0T A;  3CTF A;  4EXJ A;  1TJD A;  2F51 A;  2H76 A;  2NBS A;  3J7Y k;  4MMM A;  4P3Y B;  3MSZ A;  3ZML A;  2H0I A;  3BCI A;  4X0X A;  1FVJ A;  2IJY A;  1BED A;  3LWA A;  1B9X C;  4HS1 A;  5KN1 A;  3WT1 A;  4MH2 A;  2ES7 A;  6GSW A;  5COH A;  4GQF A;  4LMV A;  4IW9 A;  4POB A;  2CZ2 A;  5F07 A;  4FYU A;  2PMT A;  2L5O A;  4H86 A;  3DWV A;  3M1G A;  3HXS A;  5FT3 A;  2KLX A;  4KW6 A;  2PU9 C;  2CQ9 A;  2MMO A;  3FW2 A;  4KDU A;  3C7M A;  4EO3 A;  3F8U A;  4BWS A;  2PER A;  3WGD A;  1ERW A;  1GSS A;  1U3I A;  3L0H A;  2LRT A;  2YWI A;  2MBT A;  2DJJ A;  5IMF A;  3ERF A;  3HA9 A;  5J9B A;  2A4V A;  1UVZ A;  2DLX A;  3FR3 A;  2GSR A;  2QC7 A;  2LRC A;  1K0A A;  1MTC A;  2OE3 A;  1U3A A;  2BTO T;  7GSS A;  3DYR A;  3SWL A;  2PUK C;  1EP8 A;  1XFL A;  5H5R A;  4TW5 A;  3CBU A;  5C04 A;  3C1R A;  4RI6 A;  3GH9 A;  2VOC A;  3DIE A;  3FK8 A;  4WEY A;  5C00 A;  2MMZ A;  2HRA A;  3EC3 A;  4HQS A;  1USB A;  2HT9 A;  4HEA 2;  4YQV A;  3G7J A;  2P0G A;  1SYX A;  3QFB C;  3UVH A;  1Q4J A;  1J08 A;  1X9W B;  3P90 A;  1FOV A;  1SK2 A;  3KM6 A;  2I1U A;  3HJP A;  1H75 A;  2K18 A;  5G30 A;  3FHK A;  3ZIJ A;  3CYN A;  4J2F A;  2AAW A;  4IKH A;  4NHZ A;  3GKM A;  1IYI A;  3EE2 A;  4LA1 A;  2DJK A;  5ECO B;  5ENU A;  5D93 A;  2EIO A;  2YZU A;  1B9Y C;  1K0B A;  5B7C A;  4KSO A;  1GLP A;  2R4V A;  3NZN A;  1B48 A;  3IC4 A;  3ERW A;  4EF0 A;  5ECH B;  3DGQ A;  5DJM A;  2V6K A;  4TR3 A;  1A0F A;  1UN2 A;  3EYT A;  1WRY A;  2TIR A;  1LU4 A;  2VLT A;  2CAI A;  4HOJ A;  1S3A A;  1K0C A;  4QL9 A;  3DVX A;  2JSZ A;  3TKP A;  5GAN D;  1WE0 A;  1ON4 A;  1Y25 A;  1ABA A;  1C72 A;  4PNF A;  5HR2 A;  2I81 A;  3W8J A;  1GUH A;  5D96 A;  3ZTL A;  1M2B A;  2IFQ A;  2RM6 A;  2H70 A;  4JRR A;  5ECR B;  3APO A;  8GSS A;  3HKR A;  4PTS A;  1BQ7 A;  3GTU A;  1X9M B;  4V1A p;  3D5J A;  1GSY A;  4ECI A;  1F37 A;  3C73 A;  3WT2 A;  1FAA A;  1ILO A;  4MZW A;  5DAL B;  1XVQ A;  1QK8 A;  1HNB A;  4OCE A;  1B4Q A;  2WFC A;  1THX A;  3GUR A;  2GSQ A;  2H1B A;  1TI1 A;  2LTK A;  2EIR A;  2VLV A;  4BL7 A;  1KNG A;  1SKS B;  3HJM A;  2WGR A;  1PL1 A;  2C1Y A;  3C1S A;  1PX6 A;  1PD2 1;  4TN8 A;  1NHY A;  2YOI A;  3BD2 A;  3KEB A;  1TRU A;  3FYG A;  5ELA A;  4HZ2 A;  1OC9 B;  2L6C A;  5CO3 A;  2R2J A;  2GQM A;  2XHF A;  5DDL A;  3UMA A;  3D0Z A;  4MF6 A;  3KMN A;  3PH9 A;  2VIM A;  3VWW A;  2C0G A;  2GT6 A;  1MDJ A;  4MCU A;  4TOP A;  1Z7P A;  2ZNM A;  3PR8 A;  1QXH A;  5D9V A;  4ECJ A;  3RHC A;  3QPM A;  2WZ9 A;  1XXU A;  3F0I A;  2LST A;  3TJG A;  2FA4 A;  20GS A;  3KIJ A;  4OFT A;  5AIX A;  2HRK A;  2VCZ A;  4IQ1 A;  4GSN A;  4KE3 A;  4JED A;  2H0G A;  2MMA A;  5EY6 A;  5IIZ A;  4I8B A;  3ZLP A;  5LNK e;  1F2E A;  5ECM B;  4LMW A;  2CAQ A;  3FRC A;  5EL8 A;  4WR4 A;  1NSW A;  2OBI A;  3EMP A;  2I3Y A;  4FYB A;  2WB9 A;  9GSS A;  4G9H A;  16GS A;  1R7H A;  2X64 A;  1TI3 A;  2D2Z A;  3I6A A;  3WYW A;  3US3 A;  4IJ3 A;  4BPY A;  1OC8 A;  4Q5F A;  2GZY A;  1KBN A;  3L9U A;  2HRK B;  2GQK A;  4IS0 A;  3TJK A;  2A2R A;  3DKS A;  1ST9 A;  1G6Y A;  1TK8 B;  3APQ A;  5ECP B;  1B8X A;  3HZ8 A;  2OBK A;  2L59 A;  2C3T A;  1X5C A;  4I2U A;  2VCW A;  3GST A;  3QAW A;  2DMM A;  4USS A;  4IJI A;  2H6X A;  1SL1 B;  2LJK A;  2YNX A;  4ECC A;  2CX4 A;  2L4Q A;  3EVI A;  5IMC A;  1XWC A;  1GTI A;  2HSM B;  4KF9 A;  5CRW A;  1RW1 A;  1YEP A;  2HRF A;  3I69 A;  3TUE A;  4BA7 A;  3G7Y A;  3J7Y b;  4JR4 A;  1E2Y A;  2F3M A;  3UAR A;  3F3R A;  4EL1 A;  2GTU A;  5G2Z A;  1RQM A;  4EE0 A;  2OAC A;  2OE0 A;  2OKA A;  2N5A A;  2O87 A;  1DUG A;  1EV4 A;  1SYR A;  3KTB A;  4YAV A;  3M8N A;  3TOT A;  3VPQ A;  1XPV A;  4D73 B;  2K8V A;  4L5L A;  5KN3 A;  2F9S A;  3KD0 A;  1E6B A;  2AYT A;  2IIY A;  1XBS A;  1TU8 A;  2PPT A;  2F8F A;  1EGR A;  1AIU A;  2CVD A;  1MD3 A;  4G0L A;  4RI7 A;  3TCO A;  4NPB A;  5G1L A;  5IMV A;  1PN9 A;  5B6N A;  5BMU A;  4AJ7 A;  2VD0 A;  2N5F A;  4HJM A;  3VK9 A;  13GS A;  3WD6 A;  2ZUP A;  1XOA A;  4IQA A;  1LBK A;  2YWM A;  2K9F A;  2K8S A;  1ACV A;  4XHM A;  2DJ0 A;  3UEM A;  1F6M C;  4Q5R A;  4AF2 A;  3ZFB A;  4K0N A;  2DBC A;  2RM5 A;  4ML1 A;  1SK0 A;  3P2A A;  4X43 A;  1EV9 A;  2VL2 C;  5IMD A;  4Z7X A;  5AIV A;  4XCS A;  2HQT A;  4K7I A;  3ZYW A;  4TR1 A;  5HQP A;  1O73 A;  2ON7 A;  3VWX A;  4DSS B;  3ZVJ A;  3FZ5 A;  3TJF A;  1UA5 A;  2XBQ A;  1T4Z A;  1O7U A;  4KUN A;  3TKR A;  1O8W A;  4BVX A;  2B5E A;  2AJQ B;  5ECI B;  4F0C A;  1YZX A;  4RUV A;  2JZR A;  5G5F A;  4MA9 A;  1XW5 A;  4BVY B;  2L5L A;  2V1M A;  4NHW A;  5AIS A;  2EC4 A;  2L6D A;  1GUK A;  1SKW B;  3PIN A;  1EZK A;  2IPA A;  1R26 A;  4NAX A;  1YJ6 A;  3GRX A;  1MEK A;  2H72 A;  1V9W A;  1GP1 A;  2DC5 A;  1S3D A;  5A4V A;  3M9J A;  2YWN A;  5ID2 B;  6GSU A;  4O92 A;  3KCM A;  1PKZ A;  4IHU A;  1DE1 A;  2N5B A;  1F9M A;  4I6X A;  4FYC A;  4XS1 A;  1W4V A;  2IMD A;  2RUE A;  6GST A;  2H73 A;  1V57 A;  2FWF A;  1G7O A;  1O6J A;  1CQH A;  4JBB A;  4ZIJ A;  3GH6 A;  3LYP A;  2HZF A;  2FY6 A;  1XW6 A;  1GTA A;  1A23 A;  3KTL A;  17GS A;  3FEU A;  3FY7 A;  5J4U A;  1HYU A;  5IO0 A;  1TK0 B;  3A2W A;  5HFK A;  5DJL A;  4HDE A;  22GS A;  2GT5 A;  1A2L A;  1TW9 A;  2HZE A;  1SL0 B;  3F9U A;  3FR9 A;  3GHA A;  4Q5N A;  6GSV A;  4KGI A;  2DIY A;  4L5O A;  1GUM A;  3ME7 A;  4HI7 A;  5ELG A;  3IHQ A;  2DJ1 A;  4GSS A;  2NDO A;  4POL A;  2CVB A;  1Z5Y E;  4IGJ A;  2WRT A;  3F4S A;  3HDC A;  3CTG A;  2WUL A;  4K7O A;  3G9B A;  2GDR A;  4I2T A;  2HNL A;  5D9X A;  2DJ2 A;  4DEJ A;  4JR6 A;  4ZL9 A;  1URM A;  4LL1 B;  3IXR A;  3M0F A;  5IOX A;  3ZVJ D;  1EGO A;  1XOB A;  2P31 A;  3F4T A;  4TKY A;  3ZRD A;  2B1L A;  12GS A;  2IWT A;  2LJA A;  2WCI A;  3L78 A;  2IMI A;  4K8M A;  1SKR B;  11GS A;  1SD9 A;  3EIN A;  3EMX A;  2LJR A;  1FVK A;  3A5W A;  2GZZ A;  4I97 A;  4WR5 A;  3H79 A;  2JAD A;  4IBP A;  1O81 A;  2FLS A;  5GSS A;  3HHV A;  1ZZY A;  1TOF A;  1ZOF A;  3VWV A;  5LCZ A;  2H8L A;  4O7H A;  5F05 A;  3D4T A;  3S9F A;  2E2M A;  4MJB A;  3N5O A;  4G10 A;  2EIQ A;  5G5E A;  1VRS D;  2YV9 A;  3O6T A;  2AV4 A;  4MAB A;  4OD7 A;  3LXZ A;  1O8X A;  5H5S A;  2L57 A;  2YJH A;  3EWL A;  5JCW A;  3ME8 A;  2GS3 A;  4MJA A;  3UOM A;  2LQO A;  2VL2 A;  1SK1 A;  2QGV A;  4MJC A;  1AQV A;  3GUS A;  5AN1 A;  5CAX A;  1FHE A;  1OVN A;  2KP1 A;  3NIV A;  5JWR B;  1GSQ A;  4KDY A;  2VO4 A;  2G2Q A;  1IYH A;  4GTU A;  3GKK A;  4AGS A;  2R6K A;  2JU5 A;  3N9J A;  3TRX A;  2JSY A;  2OA7 A;  1SEN A;  3APS A;  4N10 A;  3LYK A;  4ZBD A;  3GL3 A;  3F6D A;  3HD5 A;  2R37 A;  1M99 A;  2FNO A;  4OFM A;  1DSB A;  3MNG A;  2KUC A;  4Q5Q A;  2C3Q A;  2E7P A;  2V41 A;  4MZC A;  3UBK A;  5EPF A;  3PGT A;  5ECN B;  1XVW A;  3KP9 A;  1YKC A;  2IMK A;  1PGT A;  3D22 A;  1TRW A;  2IL3 A;  3KH7 A;  6GSS A;  1A2J A;  3CMI A;  3VUR A;  2HYX A;  3VI5 A;  1F3B A;  1PSQ A;  1TXX A;  2VL3 A;  2E0Q A;  3GYK A;  2AUV A;  1XWG A;  1YQ1 A;  3VWU A;  4DSR A;  4PX1 A;  4GCI A;  3DVW A;  1DE2 A;  4G2E A;  4EUY A;  1PMT A;  4MDC A;  1W89 A;  4L0U A;  2I4A A;  1YKA A;  3L9S A;  5JWQ B;  3LJR A;  1Z7R A;  2VL9 A;  1ZMA A;  2H1A A;  3LOR A;  4TR0 A;  5A4U A;  2HRN A;  1V40 A;  4XRA A;  2IFQ B;  2ON5 A;  2P5Q A;  4GWR A;  3QDN A;  4N11 A;  1T4Y A;  3U6V A;  3GTU B;  1A0R P;  1ZYQ B;  5CRE A;  3EU4 A;  3TOU A;  1PRX A;  2CVK A;  4TRX A;  5HFG A;  1DBY A;  3H4K A;  1O85 A;  2OJL A;  4FH8 A;  3WGX A;  2X8G A;  4HQZ A;  2GZP A;  4MPF A;  4FIW A;  1YF0 A;  1TP9 A;  2B5X A;  4TXO A;  1F3A A;  1OE7 A;  4BL7 B;  1VF1 A;  3EU3 A;  1EOG A;  3TGZ A;  2DJ3 A;  3GL5 A;  2YP6 A;  1V58 A;  3LQ7 A;  4G19 A;  2XBI A;  2GGT A;  2VD1 A;  2QKE A;  3KMO A;  4ZBB A;  2R5G A;  2K6V A;  4V2M A;  4N30 A;  5AGY A;  3IRA A;  5JWO B;  3KH9 A;  2X99 A;  19GS A;  1PKW A;  3TJJ A;  3ZIV A;  2YJ7 A;  1KEB A;  4G0K A;  1SJZ A;  3QMX A;  1OKD A;  3ZL5 A;  2DML A;  4NXI A;  2C3N A;  2B7J A;  4HU9 A;  1TK5 B;  2XC2 A;  3IR4 A;  1SU9 A;  6GSY A;  3HCZ A;  3F63 A;  2H1D A;  2VM1 A;  1VGL A;  2H71 A;  3UBL A;  2WDU A;  4XS4 A;  4CW9 A;  2H66 A;  1FO5 A;  1GTB A;  4NMU A;  4K2D A;  3ED3 A;  3VLN A;  5IO2 A;  2CX3 A;  1V2A A;  5KN0 A;  1MDI A;  5J9C A;  5A4W A;  2YPM A;  3JCM L;  3LEF A;  1YY7 A;  4LLR A;  1M0U A;  1Z3E A;  4OCF A;  1JLW A;  4ZBA A;  3RBT A;  4PGT A;  4PUF C;  2RII A;  3W8S A;  2VM2 A;  1Q98 A;  2H6Y A;  2IME A;  4TXV A;  5CNW A;  3Q19 A;  2BMX A;  1Z6N A;  1ZL9 A;  3Q6O A;  4K1F A;  4XTS A;  3ZRE A;  1YF1 A;  2VCV A;  4OO5 A;  1NHO A;  2M72 A;  4ILF A;  2HE3 A;  3VFI A;  2FA8 A;  3VI7 A;  3QFA C;  3GSS A;  3LG6 A;  1S3C A;  4QQ7 A;  3F4R A;  1G6W A;  3G7I A;  2YWO A;  3H93 A;  5JCG A;  2KP2 A;  1AUC A;  4GRF A;  2UZ8 A;  3TDG A;  4KCA A;  3HVS A;  3FR6 A;  4ECB A;  3R2Q A;  2B6M A;  3GKX A;  3IC8 A;  3SBC A;  1MD4 A;  4MJE A;  5HR3 A;  5LD0 A;  3TKS E;  3CSH A;  1A24 A;  1TDI A;  2OE1 A;  1ERV A;  1GNW A;  3WGE A;  3A2X A;  1JZR A;  1WP0 A;  4O5R A;  2M80 A;  1XWB A;  4PQ1 A;  4G0I A;  4POM A;  14GS A;  1M9A A;  3I43 A;  4MZB A;  2J23 A;  2LUS A;  3HZ4 A;  3RPN A;  1XWA A;  4GQC A;  3UVT A;  5CP1 A;  5IM9 A;  3DXB A;  2YV7 A;  3CSI A;  4JZQ A;  2VCQ A;  3CRT A;  2CZ3 A;  4DVC A;  4K9Z A;  4WXT A;  2C8U A;  5CYY A;  5D73 A;  1EP7 A;  2HFD A;  1YEX A;  3Q18 A;  5IOW A;  2O85 A;  4L8E A;  3IE3 A;  1VF4 A;  1AAZ A;  1TTZ A;  5J41 A;  1GSF A;  4V1A g;  2E2G A;  3DEX A;  5F06 A;  2PBJ A;  5F8B A;  1VF3 A;  3E9J B;  2GSS A;  5IPH A;  2HSY A;  2MYG A;  2LNT A;  4MF7 A;  1WPI A;  1LJR A;  3ZZX A;  5DAK A;  1XZO A;  2TRC P;  5DCH A;  5D9T A;  2P5R A;  1EOH A;  2OAD A;  3C71 A;  2PGT A;  1ZCP A;  4TR1 B;  2B5Y A;  1BG5 A;  3L9V A;  3EUR A;  2JAC A;  1RK4 A;  1U87 A;  1GNE A;  5CRD A;  3HVV A;  2TRX A;  1WMJ A;  2HXK A;  2J9H A;  1K0N A;  4BVX B;  3FZA A;  4ZL8 A;  4KAE A;  4POK A;  1AQW A;  4MP4 A;  1EEM A;  2VUP A;  2BJX A;  4EDZ A;  5GST A;  5DAK B;  1OC3 A;  4XS6 A;  4EDY A;  4K6X A;  2HLS A;  4ZB8 A;  1FB6 A;  5HR1 A;  5DVB A;  3H1N A;  4QL7 A;  2V6O A;  1T7P B;  1PA3 A;  5ECQ B;  2XPD A;  2HI7 A;  3TJB A;  2FWG A;  1ZYE A;  4OFN A;  4KB3 A;  5DQY A;  3RDW A;  5B8A A;  1SL2 B;  3KP8 A;  2DIZ A;  2CT6 A;  3D4M A;  2V32 A;  4IP1 A;  5L71 A;  2JZS A;  1T3B A;  2LNS A;  3UJ1 A;  3H8Q A;  4WF4 A;  4EVM A;  2KHP A;  1GL8 A;  1TU7 A;  3IAS 2;  4F2I A;  1X5E A;  2DSA A;  4J57 E;  2HZE B;  4GST A;  4ACS A;  1HNA A;  2H1G A;  2QSI A;  3UL3 A;  3PPU A;  4MLY A;  3QCP A;  3AY8 A;  3KJY A;  2IMF A;  1JHB A;  3HJO A;  3UIW A;  4LL4 B;  1T8E B;  4V2N A;  2H30 A;  3IK7 A;  3MDK A;  1SJI A;  1GSD A;  4O32 A;  1Y6E A;  3ZMK A;  4ISD A;  3IPZ A;  4KSM A;  2YCD A;  1R5A A;  4IEL A;  4ML6 A;  3IAM 2;  4DSQ A;  1ERT A;  1M9B A;  5ABR A;  2YAN A;  1A8Y A;  4XRD A;  3BOA A;  4PUA A;  3LXT A;  3CXG A;  3DML A;  18GS A;  1HD2 A;  4TVE A;  4CDO A;  4HUA A;  5D9W A;  1BX9 A;  2MMN A;  2GLR A;  1M2D A;  5DQS A;  2C0F A;  2FCH A;  4X1U A;  3K8N A;  4NV2 A;  1GH2 A;  1X9S B;  4F82 A;  4GXZ A;  4NWY A;  2JZT A;  3M3M A;  1JZW A;  3TRP A;  4K7N A;  3E3E A;  1R4W A;  4PQI A;  4JE1 A;  1TKD B;  5DAL A;  1HQO A;  2ZCT A;  3LSZ A;  2C80 A;  5ECK B;  2C0E A;  1X0R A;  2HSH A;  2C0D A;  1XIY A;  3A3T A;  5ECS A;  4FO5 A;  4WF5 A;  4IN0 A;  4GLT A;  3ISO A;  1ML6 A;  1WWJ A;  4PQH A;  2NTO A;  1SJ6 A;  1OYJ A;  3HY2 A;  4NV5 A;  4F9Z A;  1ERU A;  2WJU A;  2X8C A;  1UC7 A;  2H75 A;  1OC9 A;  1Z6M A;  3D6I A;  4CHS A;  3FZ9 A;  1MDK A;  3C8E A;  3HVX A;  4OMV A;  3IOS A;  4MK3 A;  1T1V A;  3GKN A;  1HNC A;  1J0F A;  3L4N A;  1PX7 A;  3U5R E;  4RQR A;  2H74 A;  2KOK A;  3GN3 A;  1B4P A;  4HJ2 A;  5DCG A;  1BAY A;  4IP6 A;  1J9B A;  1THO A;  2FGX A;  1M7T A;  3I9V 2;  1K3O A;  2YN1 A;  3IV4 A;  2FHE A;  1OAZ A;  5IQY A;  2M46 A;  5D8I A;  5FHI A;  2Z9S A;  3GX0 A;  4E8H A;  5B8B A;  3ERG A;  1QUW A;  1N8J A;  2GQL A;  1U6T A;  2O89 A;  5KN2 A;  1K0O A;  1EWX A;  2VCT A;  1K3L A;  3QR6 A;  3RPP A;  4WKW A;  1WOU A;  3BCK A;  2ALB A;  3Q74 A;  2H6Z A;  3M9K A;  2F8A A;  4IVF A;  3HYP A;  2VAF A;  5INY A;  1EEJ A;  1AC1 A;  2FWH A;  3QOU A;  1YDK A;  2H0H A;  5CRG A;  2LQQ A;  5H5Q A;  3TKS C;  3IK9 A;  4WET A;  1OKT A;  2O8V B;  3D21 A;  2MZC A;  4XIH A;  4F03 A;  3TRQ A;  1H4O A;  3TB2 A;  1QGV A;  4AJ6 A;  4ULX A;  4OO4 A; 
#chains in the Genus database with same CATH topology
 1QFN A;  2R0C A;  5A5K A;  4CY8 A;  1XCC A;  3CRU A;  4TXO B;  2FUG 2;  3FKF A;  1PQN A;  1JZO A;  5G1K A;  4KDX A;  5CRH A;  2HSM A;  5GAP D;  1T00 A;  3F6F A;  5F0G A;  2B3S A;  1ZGN A;  4WBR D;  3A2V A;  4WBJ A;  2WVY A;  4KCE A;  1QQ2 A;  2AB6 A;  2PWJ A;  1AXD A;  5IPG A;  5G31 A;  2FD3 A;  5IMA A;  3E0U A;  4ID0 A;  10GS A;  5EVO A;  1VF2 A;  5A34 B;  3DD3 A;  1SD8 A;  3DRN A;  3P8W A;  3QAG A;  2NPB A;  3RAZ A;  4K0G A;  5E59 A;  3UAP A;  3V1W A;  1OE8 A;  2C4J A;  2B7K A;  4MPG A;  2H19 A;  3GIX A;  1BJX A;  4RQX A;  1GWC A;  5ECL B;  3NOF A;  4TR4 A;  4ZB6 A;  3MYD A;  5DBQ A;  4J56 E;  4YAP A;  1R5P A;  2RLI A;  2PVQ A;  1TRV A;  3LFL A;  4D73 A;  3IA1 A;  2I9H A;  5J3R A;  2PVO C;  1WIK A;  3KGK A;  3GX8 A;  4MF5 A;  1NW2 A;  1KTE A;  4XS4 B;  1NM3 A;  4N0V A;  1FG4 A;  2HSN B;  3GA4 A;  4HZ4 A;  4PNG A;  4E8E A;  2X8H A;  4GF0 A;  1GLQ A;  2YZH A;  4EC0 A;  3CSJ A;  2WVZ A;  2G0F A;  3LGC A;  1V98 A;  4AJ8 A;  2LKU A;  2VCX A;  1PL2 A;  2AHE A;  4EKZ A;  3QD9 A;  2JL4 A;  5HFI A;  1JFU A;  5HR0 A;  2A2S A;  5GZZ B;  2CA8 A;  6GSX A;  5J5N A;  2FWE A;  4OWY A;  3GMF A;  2GVP A;  3BJ5 A;  2VLU A;  4KND A;  1A2M A;  3R3E A;  4I5Q A;  1X5D A;  1XW9 A;  4DSS A;  4V2L A;  2LEG A;  1AQX A;  3IBH A;  2RUF A;  2GST A;  1GUL A;  5IMZ A;  3ZIT A;  4FQU A;  4PUR A;  3O76 A;  4ZL7 A;  2B1K A;  3VPT A;  2CV4 A;  1AW9 A;  1K0M A;  3QAV A;  1WJK A;  4N0Z A;  1A8L A;  1JLV A;  1G7E A;  3ZFL A;  3MAK A;  5JCU A;  1U88 A;  4L0W A;  3OR5 A;  1JZD A;  5B6M A;  2O7K A;  4BWQ A;  4BVY A;  3P7X A;  3RFR C;  4BIK A;  3W6G A;  1GTU A;  1I9D A;  2LS5 A;  1FB0 A;  1XWK A;  4YQU A;  1CQG A;  4YQM A;  3BBY A;  1QMV A;  3KXO A;  3FZ4 A;  5ID2 A;  4F0B A;  1TRS A;  4KA0 A;  5A1N B;  5E4W A;  2LRN A;  1GSU A;  1FW1 A;  3TU3 B;  3TKQ A;  4ZB9 A;  4KH7 A;  4KX4 A;  4K2X A;  3TKS A;  3RHB A;  1K3Y A;  3O3T A;  1BYE A;  1ZYP A;  4YH2 A;  3GV1 A;  1N2A A;  2PN8 A;  2R3X A;  2V2G A;  2H01 A;  4MH3 A;  1K0D A;  2REM A;  4HU7 A;  2L4C A;  3MWH A;  1GRX A;  1I5G A;  2LV3 A;  3KZQ A;  4PXO A;  2IN3 A;  1GSE A;  5FWG A;  2WS2 A;  1M2A A;  3F3Q A;  5KEJ A;  3IDV A;  2NVL A;  2XPE A;  4ZXG A;  3GNJ A;  2MBS A;  4JU5 A;  1I1I P;  1Z9H A;  4ZIL A;  3GFK A;  1G0T A;  3CTF A;  4EXJ A;  1TJD A;  2F51 A;  2H76 A;  2NBS A;  3J7Y k;  4MMM A;  4P3Y B;  1S4B P;  3MSZ A;  3ZML A;  2H0I A;  3BCI A;  4X0X A;  1FVJ A;  2IJY A;  1BED A;  3LWA A;  1B9X C;  4HS1 A;  5KN1 A;  3WT1 A;  4MH2 A;  2ES7 A;  6GSW A;  5COH A;  4GQF A;  4LMV A;  4IW9 A;  4POB A;  2CZ2 A;  5F07 A;  4FYU A;  2PMT A;  2L5O A;  4H86 A;  3DWV A;  3M1G A;  5A5H B;  3HXS A;  5FT3 A;  2KLX A;  4KW6 A;  2PU9 C;  2CQ9 A;  2MMO A;  3FW2 A;  4KDU A;  3C7M A;  4EO3 A;  3F8U A;  4BWS A;  2PER A;  3WGD A;  1ERW A;  1GSS A;  1U3I A;  3L0H A;  2LRT A;  2YWI A;  2MBT A;  2DJJ A;  5IMF A;  3ERF A;  3HA9 A;  5J9B A;  2A4V A;  1UVZ A;  2DLX A;  3FR3 A;  2GSR A;  2QC7 A;  2LRC A;  1K0A A;  1MTC A;  2OE3 A;  1U3A A;  2EFE A;  2BTO T;  7GSS A;  3DYR A;  3SWL A;  2PUK C;  1EP8 A;  1XFL A;  5H5R A;  4TW5 A;  3CBU A;  2DKH A;  5C04 A;  3C1R A;  4RI6 A;  3GH9 A;  2VOC A;  3DIE A;  3FK8 A;  4WEY A;  5C00 A;  2MMZ A;  2HRA A;  3EC3 A;  4HQS A;  1USB A;  2HT9 A;  4HEA 2;  4YQV A;  3G7J A;  2P0G A;  1SYX A;  2A4H A;  3UVH A;  1Q4J A;  1J08 A;  3QFB C;  1X9W B;  3P90 A;  1FOV A;  1SK2 A;  3KM6 A;  3RGB C;  3EPT A;  2I1U A;  3HJP A;  1H75 A;  2K18 A;  5G30 A;  3FHK A;  3ZIJ A;  3CYN A;  4J2F A;  2AAW A;  4IKH A;  4NHZ A;  4ICY A;  3GKM A;  1IYI A;  4PHZ C;  3EE2 A;  4LA1 A;  2DJK A;  5ECO B;  5ENU A;  5D93 A;  2EIO A;  2YZU A;  1B9Y C;  1K0B A;  5B7C A;  4KSO A;  1GLP A;  2R4V A;  3NZN A;  1B48 A;  3IC4 A;  3ERW A;  4EF0 A;  5ECH B;  3DGQ A;  5DJM A;  4E68 A;  2V6K A;  4TR3 A;  1A0F A;  1UN2 A;  3EYT A;  1WRY A;  2TIR A;  1LU4 A;  2VLT A;  2CAI A;  4HOJ A;  1S3A A;  1K0C A;  4QL9 A;  2EFD A;  1PN0 A;  3DVX A;  3CWG A;  2JSZ A;  3TKP A;  5GAN D;  1WE0 A;  1ON4 A;  1Y25 A;  1ABA A;  1C72 A;  4PNF A;  5HR2 A;  2I81 A;  3W8J A;  1GUH A;  5D96 A;  3ZTL A;  1M2B A;  2IFQ A;  2RM6 A;  1XG8 A;  2H70 A;  4JRR A;  5ECR B;  3APO A;  8GSS A;  3HKR A;  4PTS A;  1BQ7 A;  3GTU A;  1X9M B;  4V1A p;  3D5J A;  1GSY A;  4ECI A;  1F37 A;  3C73 A;  3WT2 A;  3HVN A;  1FAA A;  1ILO A;  4MZW A;  4AKX B;  5DAL B;  1XVQ A;  1QK8 A;  1HNB A;  4OCE A;  1B4Q A;  2WFC A;  1THX A;  3GUR A;  2GSQ A;  2H1B A;  4GDF A;  1TI1 A;  2LTK A;  2EIR A;  2VLV A;  4BL7 A;  1KNG A;  1SKS B;  3HJM A;  2WGR A;  1PL1 A;  2C1Y A;  3C1S A;  1PX6 A;  1PD2 1;  4TN8 A;  1NHY A;  2O36 A;  2YOI A;  3BD2 A;  3KEB A;  1TRU A;  3FYG A;  5ELA A;  4HZ2 A;  1OC9 B;  2L6C A;  5CO3 A;  2R2J A;  2GQM A;  2XHF A;  5DDL A;  3UMA A;  3D0Z A;  4MF6 A;  3KMN A;  3PH9 A;  2VIM A;  3VWW A;  2C0G A;  2GT6 A;  1MDJ A;  4MCU A;  4TOP A;  1Z7P A;  2ZNM A;  3PR8 A;  5J4Y A;  1QXH A;  5D9V A;  4ECJ A;  3RHC A;  3QPM A;  2WZ9 A;  1XXU A;  4G01 A;  3F0I A;  2LST A;  3TJG A;  2FA4 A;  20GS A;  3KIJ A;  4OFT A;  5AIX A;  2HRK A;  2VCZ A;  4IQ1 A;  4GSN A;  4KE3 A;  4JED A;  2H0G A;  2MMA A;  5EY6 A;  5IIZ A;  4I8B A;  3ZLP A;  5LNK e;  1F2E A;  5ECM B;  4LMW A;  2WW1 A;  4FXY P;  2CAQ A;  3FRC A;  5EL8 A;  4WR4 A;  1NSW A;  2OBI A;  3EMP A;  2I3Y A;  4FYB A;  2WB9 A;  9GSS A;  4G9H A;  16GS A;  1R7H A;  2X64 A;  1TI3 A;  2D2Z A;  3I6A A;  3WYW A;  3US3 A;  4IJ3 A;  4BPY A;  1OC8 A;  4Q5F A;  2GZY A;  1KBN A;  2QA2 A;  3L9U A;  2HRK B;  2GQK A;  4IS0 A;  3TJK A;  2A2R A;  3DKS A;  1ZYN A;  2WW2 A;  1ST9 A;  1G6Y A;  3HMJ G;  1TK8 B;  3APQ A;  5ECP B;  1B8X A;  3HZ8 A;  2OBK A;  2L59 A;  2C3T A;  1X5C A;  4I2U A;  2VCW A;  2VKZ G;  3LW9 A;  3GST A;  3QAW A;  2DMM A;  4USS A;  4IJI A;  2H6X A;  1SL1 B;  2LJK A;  2YNX A;  4ECC A;  2CX4 A;  2L4Q A;  3EVI A;  5IMC A;  1XWC A;  1GTI A;  2HSM B;  4KF9 A;  5CRW A;  1RW1 A;  1YEP A;  2HRF A;  3I69 A;  3TUE A;  4BA7 A;  3G7Y A;  3J7Y b;  4JR4 A;  1E2Y A;  2O5V A;  2F3M A;  3UAR A;  3F3R A;  4EL1 A;  2GTU A;  5G2Z A;  1RQM A;  4EE0 A;  2OAC A;  2OE0 A;  2OKA A;  2N5A A;  2O87 A;  4O5Q A;  1DUG A;  1EV4 A;  1SYR A;  3KTB A;  4YAV A;  3M8N A;  3TOT A;  3VPQ A;  1XPV A;  4D73 B;  2K8V A;  4L5L A;  5KN3 A;  2F9S A;  3KD0 A;  1E6B A;  2AYT A;  2IIY A;  1XBS A;  1TU8 A;  2X4A A;  2PPT A;  2F8F A;  1BG1 A;  1EGR A;  1AIU A;  2CVD A;  1MD3 A;  4G0L A;  4RI7 A;  4X4J A;  3TCO A;  4NPB A;  5G1L A;  5IMV A;  1PN9 A;  5B6N A;  4CY6 A;  5BMU A;  4AJ7 A;  2VD0 A;  2N5F A;  4HJM A;  3VK9 A;  13GS A;  3A5I A;  3WD6 A;  2ZUP A;  1XOA A;  4IQA A;  1LBK A;  2YWM A;  2K9F A;  1SVL A;  2K8S A;  1ACV A;  4XHM A;  2DJ0 A;  3UEM A;  1F6M C;  4Q5R A;  4AF2 A;  3ZFB A;  4K0N A;  2DBC A;  2RM5 A;  4ML1 A;  1SK0 A;  4YKF A;  3P2A A;  4X43 A;  1EV9 A;  2VL2 C;  5IMD A;  4Z7X A;  5AIV A;  4XCS A;  2HQT A;  4K7I A;  3ZYW A;  4TR1 A;  5HQP A;  1O73 A;  2ON7 A;  3VWX A;  4DSS B;  3ZVJ A;  3FZ5 A;  3TJF A;  1UA5 A;  2XBQ A;  1T4Z A;  4N3Z A;  1O7U A;  4KUN A;  3TKR A;  1O8W A;  4BVX A;  2B5E A;  2AJQ B;  1M3J A;  5ECI B;  4F0C A;  1YZX A;  4RUV A;  2JZR A;  5G5F A;  4MA9 A;  1XW5 A;  4BVY B;  2L5L A;  2V1M A;  4NHW A;  5AIS A;  2EC4 A;  2L6D A;  4O5U A;  1GUK A;  1SKW B;  3PIN A;  1EZK A;  2IPA A;  1R26 A;  4NAX A;  1YJ6 A;  3GRX A;  2H72 A;  1MEK A;  1V9W A;  1GP1 A;  2DC5 A;  1S3D A;  5A4V A;  3M9J A;  2YWN A;  5ID2 B;  6GSU A;  4O92 A;  3KCM A;  1PKZ A;  4K5S A;  4IHU A;  1DE1 A;  2N5B A;  1F9M A;  4I6X A;  4FYC A;  4XS1 A;  4YKG A;  1W4V A;  4Z2U A;  2IMD A;  2RUE A;  6GST A;  2H73 A;  1V57 A;  2FWF A;  1G7O A;  1O6J A;  1CQH A;  4JBB A;  4ZIJ A;  3GH6 A;  3LYP A;  2HZF A;  2FY6 A;  1SVM A;  1XW6 A;  1GTA A;  1A23 A;  3KTL A;  17GS A;  3FEU A;  3FY7 A;  5J4U A;  1HYU A;  5IO0 A;  1TK0 B;  3A2W A;  5HFK A;  5DJL A;  4HDE A;  22GS A;  2GT5 A;  1A2L A;  1TW9 A;  2HZE A;  1SL0 B;  3F9U A;  2WVX A;  3FR9 A;  3GHA A;  4Q5N A;  6GSV A;  1TXU A;  4KGI A;  4HSC X;  2DIY A;  4L5O A;  1GUM A;  3ME7 A;  4HI7 A;  5ELG A;  3IHQ A;  2DJ1 A;  4GSS A;  2NDO A;  4POL A;  2CVB A;  1Z5Y E;  4IGJ A;  2WRT A;  3F4S A;  3HDC A;  3CTG A;  2WUL A;  4K7O A;  4Z2R A;  3G9B A;  2GDR A;  4I2T A;  2HNL A;  5D9X A;  2DJ2 A;  4DEJ A;  4JR6 A;  4ZL9 A;  1URM A;  4LL1 B;  3IXR A;  3M0F A;  5IOX A;  3ZVJ D;  1EGO A;  1XOB A;  2P31 A;  3F4T A;  4TKY A;  3ZRD A;  2B1L A;  12GS A;  2IWT A;  2LJA A;  2WCI A;  3L78 A;  2IMI A;  4K8M A;  1SKR B;  11GS A;  1SD9 A;  3EIN A;  3EMX A;  2LJR A;  1FVK A;  3A5W A;  2GZZ A;  4I97 A;  4WR5 A;  3H79 A;  2JAD A;  4IBP A;  1O81 A;  2FLS A;  5GSS A;  3HHV A;  1ZZY A;  1TOF A;  1ZOF A;  3VWV A;  5LCZ A;  2H8L A;  4O7H A;  5F05 A;  3D4T A;  3S9F A;  2E2M A;  4MJB A;  3N5O A;  4G10 A;  2EIQ A;  5G5E A;  1VRS D;  2YV9 A;  3O6T A;  2AV4 A;  4MAB A;  4OD7 A;  3LXZ A;  1O8X A;  5H5S A;  2L57 A;  2YJH A;  3EWL A;  5JCW A;  3ME8 A;  2GS3 A;  4MJA A;  3UOM A;  2LQO A;  2VL2 A;  1SK1 A;  2QGV A;  4MJC A;  1AQV A;  3FMW A;  3GUS A;  5AN1 A;  5CAX A;  1FHE A;  1OVN A;  2KP1 A;  3NIV A;  5JWR B;  1GSQ A;  4KDY A;  2VO4 A;  2G2Q A;  1IYH A;  4GTU A;  3GKK A;  4AGS A;  2R6K A;  2JU5 A;  3N9J A;  3TRX A;  2JSY A;  2OA7 A;  1SEN A;  3APS A;  4N10 A;  3LYK A;  4ZBD A;  3GL3 A;  2WZS A;  3F6D A;  3HD5 A;  2R37 A;  1M99 A;  1PFO A;  2FNO A;  4OFM A;  1DSB A;  3MNG A;  2KUC A;  4Q5Q A;  2C3Q A;  2E7P A;  2V41 A;  4MZC A;  3UBK A;  5EPF A;  3PGT A;  5ECN B;  1XVW A;  3KP9 A;  1YKC A;  2IMK A;  1PGT A;  3D22 A;  1TRW A;  2IL3 A;  3KH7 A;  6GSS A;  1A2J A;  3CMI A;  3VUR A;  1S3R A;  2HYX A;  3VI5 A;  1F3B A;  1PSQ A;  1TXX A;  2VL3 A;  2E0Q A;  2WW0 A;  3GYK A;  2AUV A;  1XWG A;  1YQ1 A;  3VWU A;  4DSR A;  4EIP A;  4PX1 A;  3IHG A;  4GCI A;  3DVW A;  1DE2 A;  4G2E A;  4EUY A;  1PMT A;  4MDC A;  1W89 A;  3CQF A;  2DKI A;  4L0U A;  2I4A A;  1YKA A;  3L9S A;  5JWQ B;  3LJR A;  1Z7R A;  2VL9 A;  1ZMA A;  2H1A A;  3LOR A;  4TR0 A;  5A4U A;  2HRN A;  1V40 A;  4XRA A;  2IFQ B;  2ON5 A;  2P5Q A;  4EIQ A;  4GWR A;  3QDN A;  4N11 A;  1T4Y A;  3U6V A;  3GTU B;  1A0R P;  1ZYQ B;  5CRE A;  3EU4 A;  3TOU A;  5KOX A;  1PRX A;  2CVK A;  4TRX A;  4PI0 C;  5HFG A;  1DBY A;  4W66 A;  3H4K A;  1O85 A;  2OJL A;  4FH8 A;  3WGX A;  2A2P A;  2X8G A;  4HQZ A;  2R0P A;  5J40 A;  2GZP A;  4MPF A;  4FIW A;  1YF0 A;  1TP9 A;  2B5X A;  4TXO A;  1F3A A;  1OE7 A;  4BL7 B;  1VF1 A;  3EU3 A;  1EOG A;  3TGZ A;  2DJ3 A;  3GL5 A;  2YP6 A;  1V58 A;  3LQ7 A;  4G19 A;  2XBI A;  2GGT A;  2VD1 A;  2QKE A;  3KMO A;  4Z2T A;  4ZBB A;  5A34 A;  2R5G A;  2K6V A;  4A5P A;  4V2M A;  4N30 A;  5AGY A;  3IRA A;  4AKH A;  4QMK A;  5JWO B;  3KH9 A;  2X99 A;  19GS A;  1PKW A;  3TJJ A;  3ZIV A;  4PI2 C;  2YJ7 A;  1KEB A;  4G0K A;  1SJZ A;  3QMX A;  1OKD A;  3ZL5 A;  2DML A;  4NXI A;  2C3N A;  2B7J A;  4HU9 A;  1TK5 B;  2XC2 A;  3IR4 A;  1SU9 A;  6GSY A;  3HCZ A;  3F63 A;  2H1D A;  2VM1 A;  1VGL A;  5KOW A;  2H71 A;  3UBL A;  2WDU A;  4XS4 A;  4CW9 A;  2H66 A;  1FO5 A;  1GTB A;  4NMU A;  4K2D A;  3ED3 A;  2HSN A;  3VLN A;  5IO2 A;  2CX3 A;  1V2A A;  5KN0 A;  1MDI A;  5J9C A;  5A4W A;  2YPM A;  3JCM L;  3LEF A;  1YY7 A;  4LLR A;  1M0U A;  1Z3E A;  5J47 A;  4OCF A;  1JLW A;  4ZBA A;  3RBT A;  4PGT A;  4PUF C;  3CHX C;  2RII A;  3W8S A;  2VM2 A;  1Q98 A;  2H6Y A;  2IME A;  4TXV A;  5CNW A;  3Q19 A;  2BMX A;  1Z6N A;  1ZL9 A;  1BF5 A;  3Q6O A;  4K1F A;  4XTS A;  3ZRE A;  1YF1 A;  2VCV A;  4OO5 A;  1NHO A;  2M72 A;  4ILF A;  2HE3 A;  3VFI A;  2FA8 A;  3VI7 A;  3QFA C;  3GSS A;  3LG6 A;  1S3C A;  4QQ7 A;  3F4R A;  1G6W A;  3G7I A;  2YWO A;  3H93 A;  5JCG A;  2KP2 A;  1AUC A;  4GRF A;  2UZ8 A;  3TDG A;  4KCA A;  3HVS A;  3FR6 A;  4ECB A;  1SVO A;  3R2Q A;  2B6M A;  3GKX A;  3IC8 A;  3SBC A;  1MD4 A;  4MJE A;  5HR3 A;  2EFH A;  5LD0 A;  3CSH A;  3TKS E;  1A24 A;  1TDI A;  2OE1 A;  1ERV A;  1GNW A;  3WGE A;  3A2X A;  1JZR A;  1WP0 A;  4O5R A;  2M80 A;  1YVL A;  1XWB A;  4PQ1 A;  5A1N A;  4G0I A;  4POM A;  14GS A;  2UV8 G;  1M9A A;  3I43 A;  4MZB A;  2J23 A;  2LUS A;  3HZ4 A;  3RPN A;  1XWA A;  4GQC A;  3UVT A;  5CP1 A;  5IM9 A;  3DXB A;  2YV7 A;  3CSI A;  4JZQ A;  2VCQ A;  3CRT A;  2OT3 A;  2H1L A;  2CZ3 A;  4DVC A;  4K9Z A;  4WXT A;  2C8U A;  5CYY A;  2EFC A;  5D73 A;  1EP7 A;  2HFD A;  1YEX A;  3Q18 A;  5IOW A;  2O85 A;  4L8E A;  3IE3 A;  5BRT A;  1VF4 A;  5BMU B;  1AAZ A;  1TTZ A;  5J41 A;  1GSF A;  4V1A g;  2E2G A;  3DEX A;  5F06 A;  2PBJ A;  5F8B A;  1VF3 A;  3E9J B;  2GSS A;  5IPH A;  2HSY A;  2MYG A;  2LNT A;  4MF7 A;  1WPI A;  1LJR A;  3ZZX A;  5DAK A;  1XZO A;  2TRC P;  5DCH A;  5D9T A;  2P5R A;  1EOH A;  2OAD A;  3C71 A;  2PGT A;  1ZCP A;  4TR1 B;  2B5Y A;  1BG5 A;  3L9V A;  3EUR A;  1M3I A;  2JAC A;  5A5H A;  1RK4 A;  1U87 A;  1GNE A;  5CRD A;  3HVV A;  2TRX A;  1WMJ A;  2HXK A;  2J9H A;  1K0N A;  4BVX B;  3FZA A;  4ZL8 A;  4KAE A;  4POK A;  1AQW A;  4MP4 A;  3MIX A;  1EEM A;  2VUP A;  2BJX A;  4ZB7 A;  4EDZ A;  5GST A;  4AI6 A;  5DAK B;  1N25 A;  1OC3 A;  4XS6 A;  4EDY A;  4K6X A;  2HLS A;  4ZB8 A;  1FB6 A;  5HR1 A;  2O3E A;  5DVB A;  3H1N A;  4QL7 A;  2V6O A;  1T7P B;  4AKI A;  1PA3 A;  5ECQ B;  2XPD A;  2HI7 A;  3TJB A;  2FWG A;  1ZYE A;  4OFN A;  4KB3 A;  4K5R A;  5DQY A;  3RDW A;  5B8A A;  1SL2 B;  3KP8 A;  2DIZ A;  2CT6 A;  3D4M A;  2V32 A;  4IP1 A;  5L71 A;  2JZS A;  1T3B A;  2LNS A;  3UJ1 A;  3H8Q A;  4WF4 A;  4EVM A;  2KHP A;  1GL8 A;  1TU7 A;  3IAS 2;  4F2I A;  1X5E A;  2DSA A;  4J57 E;  2HZE B;  4GST A;  4ACS A;  1HNA A;  2H1G A;  2QSI A;  2WVX B;  3UL3 A;  3PPU A;  4MLY A;  3QCP A;  3AY8 A;  3KJY A;  2IMF A;  1JHB A;  3HJO A;  1FOH A;  3UIW A;  4LL4 B;  1T8E B;  4V2N A;  2H30 A;  3IK7 A;  3MDK A;  1SJI A;  1GSD A;  4O32 A;  1Y6E A;  3ZMK A;  4ISD A;  4AKG A;  3IPZ A;  4KSM A;  2YCD A;  1R5A A;  4IEL A;  4ML6 A;  3IAM 2;  4DSQ A;  1ERT A;  1M9B A;  5ABR A;  2YAN A;  1A8Y A;  4XRD A;  3BOA A;  4PUA A;  3LXT A;  3CXG A;  3DML A;  18GS A;  1HD2 A;  4TVE A;  4CDO A;  4HUA A;  5D9W A;  1BX9 A;  2QA1 A;  2MMN A;  2GLR A;  1M2D A;  5DQS A;  2C0F A;  2FCH A;  4X1U A;  3K8N A;  4NV2 A;  1GH2 A;  1X9S B;  4F82 A;  4GXZ A;  4NWY A;  2R0G A;  2JZT A;  3M3M A;  1JZW A;  3TRP A;  4K7N A;  3E3E A;  1R4W A;  4PQI A;  4JE1 A;  1TKD B;  5DAL A;  1HQO A;  4MNN A;  2ZCT A;  3LSZ A;  2C80 A;  5ECK B;  2C0E A;  1X0R A;  2HSH A;  2C0D A;  1XIY A;  3A3T A;  5ECS A;  4FO5 A;  4WF5 A;  4IN0 A;  4GLT A;  3ISO A;  5J4V A;  1ML6 A;  1WWJ A;  4PQH A;  2NTO A;  1SJ6 A;  1OYJ A;  3HY2 A;  1Y1U A;  4NV5 A;  4F9Z A;  1ERU A;  2WJU A;  2X8C A;  1UC7 A;  2H75 A;  1OC9 A;  1Z6M A;  3D6I A;  4CHS A;  3FZ9 A;  1MDK A;  3C8E A;  3HVX A;  4OMV A;  3IOS A;  4MK3 A;  1T1V A;  3GKN A;  1HNC A;  1J0F A;  3L4N A;  1PX7 A;  3U5R E;  4RQR A;  2H74 A;  2KOK A;  3GN3 A;  1B4P A;  4HJ2 A;  5DCG A;  1BAY A;  4IP6 A;  1J9B A;  1THO A;  2FGX A;  1M7T A;  3I9V 2;  1K3O A;  2YN1 A;  3IV4 A;  2FHE A;  1OAZ A;  5IQY A;  2M46 A;  5D8I A;  5FHI A;  2Z9S A;  3GX0 A;  4E8H A;  2WW3 A;  5B8B A;  3ERG A;  1YEW C;  1QUW A;  1N8J A;  2GQL A;  1U6T A;  2O89 A;  5KN2 A;  1K0O A;  1EWX A;  2VCT A;  1K3L A;  3QR6 A;  3RPP A;  4WKW A;  1WOU A;  3BCK A;  2ALB A;  3Q74 A;  2H6Z A;  3M9K A;  2F8A A;  4IVF A;  3HYP A;  2VAF A;  5INY A;  1EEJ A;  1AC1 A;  2FWH A;  3QOU A;  1YDK A;  2H0H A;  5CRG A;  2LQQ A;  5H5Q A;  3TKS C;  3IK9 A;  4WET A;  1OKT A;  2O8V B;  3D21 A;  2MZC A;  4XIH A;  2X49 A;  4F03 A;  3TRQ A;  1H4O A;  3TB2 A;  1QGV A;  4AJ6 A;  4ULX A;  4OO4 A; 
#chains in the Genus database with same CATH homology
 1QFN A;  2R0C A;  5A5K A;  4CY8 A;  1XCC A;  3CRU A;  4TXO B;  2FUG 2;  3FKF A;  1PQN A;  1JZO A;  5G1K A;  4KDX A;  5CRH A;  2HSM A;  5GAP D;  1T00 A;  3F6F A;  5F0G A;  2B3S A;  1ZGN A;  4WBR D;  3A2V A;  4WBJ A;  4KCE A;  1QQ2 A;  2AB6 A;  2PWJ A;  1AXD A;  5IPG A;  5G31 A;  2FD3 A;  5IMA A;  3E0U A;  4ID0 A;  10GS A;  5EVO A;  1VF2 A;  5A34 B;  3DD3 A;  1SD8 A;  3DRN A;  3P8W A;  3QAG A;  2NPB A;  3RAZ A;  4K0G A;  5E59 A;  3UAP A;  3V1W A;  1OE8 A;  2C4J A;  2B7K A;  4MPG A;  2H19 A;  3GIX A;  1BJX A;  4RQX A;  1GWC A;  5ECL B;  3NOF A;  4TR4 A;  4ZB6 A;  3MYD A;  5DBQ A;  4J56 E;  4YAP A;  1R5P A;  2RLI A;  2PVQ A;  1TRV A;  3LFL A;  4D73 A;  3IA1 A;  2I9H A;  5J3R A;  2PVO C;  1WIK A;  3KGK A;  3GX8 A;  4MF5 A;  1NW2 A;  1KTE A;  4XS4 B;  1NM3 A;  4N0V A;  1FG4 A;  2HSN B;  3GA4 A;  4HZ4 A;  4PNG A;  4E8E A;  2X8H A;  4GF0 A;  1GLQ A;  2YZH A;  4EC0 A;  3CSJ A;  2G0F A;  3LGC A;  1V98 A;  4AJ8 A;  2LKU A;  2VCX A;  1PL2 A;  2AHE A;  4EKZ A;  3QD9 A;  2JL4 A;  5HFI A;  1JFU A;  5HR0 A;  2A2S A;  5GZZ B;  2CA8 A;  6GSX A;  5J5N A;  2FWE A;  4OWY A;  3GMF A;  2GVP A;  3BJ5 A;  2VLU A;  4KND A;  1A2M A;  3R3E A;  4I5Q A;  1X5D A;  1XW9 A;  4DSS A;  4V2L A;  2LEG A;  1AQX A;  3IBH A;  2RUF A;  2GST A;  1GUL A;  5IMZ A;  3ZIT A;  4FQU A;  4PUR A;  3O76 A;  4ZL7 A;  2B1K A;  3VPT A;  2CV4 A;  1AW9 A;  1K0M A;  3QAV A;  1WJK A;  4N0Z A;  1A8L A;  1JLV A;  1G7E A;  3ZFL A;  3MAK A;  5JCU A;  1U88 A;  4L0W A;  3OR5 A;  1JZD A;  5B6M A;  2O7K A;  4BWQ A;  4BVY A;  3P7X A;  3W6G A;  1GTU A;  1I9D A;  2LS5 A;  1FB0 A;  1XWK A;  4YQU A;  1CQG A;  4YQM A;  3BBY A;  1QMV A;  3KXO A;  3FZ4 A;  5ID2 A;  4F0B A;  1TRS A;  4KA0 A;  5A1N B;  5E4W A;  2LRN A;  1GSU A;  1FW1 A;  3TU3 B;  3TKQ A;  4ZB9 A;  4KH7 A;  4KX4 A;  4K2X A;  3TKS A;  3RHB A;  3O3T A;  1K3Y A;  1BYE A;  1ZYP A;  4YH2 A;  3GV1 A;  1N2A A;  2PN8 A;  2R3X A;  2V2G A;  2H01 A;  4MH3 A;  1K0D A;  2REM A;  4HU7 A;  2L4C A;  3MWH A;  1GRX A;  1I5G A;  2LV3 A;  3KZQ A;  4PXO A;  2IN3 A;  1GSE A;  5FWG A;  2WS2 A;  1M2A A;  3F3Q A;  5KEJ A;  3IDV A;  2NVL A;  2XPE A;  4ZXG A;  3GNJ A;  2MBS A;  4JU5 A;  1Z9H A;  4ZIL A;  3GFK A;  1G0T A;  3CTF A;  4EXJ A;  1TJD A;  2F51 A;  2H76 A;  2NBS A;  3J7Y k;  4MMM A;  4P3Y B;  3MSZ A;  3ZML A;  2H0I A;  3BCI A;  4X0X A;  1FVJ A;  2IJY A;  1BED A;  3LWA A;  1B9X C;  4HS1 A;  5KN1 A;  3WT1 A;  4MH2 A;  2ES7 A;  6GSW A;  5COH A;  4GQF A;  4LMV A;  4IW9 A;  4POB A;  2CZ2 A;  5F07 A;  4FYU A;  2PMT A;  2L5O A;  4H86 A;  3DWV A;  3M1G A;  5A5H B;  3HXS A;  5FT3 A;  2KLX A;  4KW6 A;  2PU9 C;  2CQ9 A;  2MMO A;  3FW2 A;  4KDU A;  3C7M A;  4EO3 A;  3F8U A;  4BWS A;  2PER A;  3WGD A;  1ERW A;  1GSS A;  1U3I A;  3L0H A;  2LRT A;  2YWI A;  2MBT A;  2DJJ A;  5IMF A;  3ERF A;  3HA9 A;  5J9B A;  2A4V A;  1UVZ A;  2DLX A;  3FR3 A;  2GSR A;  2QC7 A;  2LRC A;  1K0A A;  1MTC A;  2OE3 A;  1U3A A;  2EFE A;  2BTO T;  7GSS A;  3DYR A;  3SWL A;  2PUK C;  1EP8 A;  1XFL A;  5H5R A;  4TW5 A;  3CBU A;  2DKH A;  5C04 A;  3C1R A;  4RI6 A;  3GH9 A;  2VOC A;  3DIE A;  3FK8 A;  4WEY A;  5C00 A;  2MMZ A;  2HRA A;  3EC3 A;  4HQS A;  1USB A;  2HT9 A;  4HEA 2;  4YQV A;  3G7J A;  2P0G A;  1SYX A;  2A4H A;  3UVH A;  1Q4J A;  1J08 A;  3QFB C;  1X9W B;  3P90 A;  1FOV A;  1SK2 A;  3KM6 A;  3EPT A;  2I1U A;  3HJP A;  1H75 A;  2K18 A;  5G30 A;  3FHK A;  3ZIJ A;  3CYN A;  4J2F A;  2AAW A;  4IKH A;  4NHZ A;  4ICY A;  3GKM A;  1IYI A;  3EE2 A;  4LA1 A;  2DJK A;  5ECO B;  5ENU A;  5D93 A;  2EIO A;  2YZU A;  1B9Y C;  1K0B A;  5B7C A;  4KSO A;  1GLP A;  2R4V A;  3NZN A;  1B48 A;  3IC4 A;  3ERW A;  4EF0 A;  5ECH B;  3DGQ A;  5DJM A;  4E68 A;  2V6K A;  4TR3 A;  1A0F A;  1UN2 A;  3EYT A;  1WRY A;  2TIR A;  1LU4 A;  2VLT A;  2CAI A;  4HOJ A;  1S3A A;  1K0C A;  4QL9 A;  2EFD A;  1PN0 A;  3DVX A;  3CWG A;  2JSZ A;  3TKP A;  5GAN D;  1WE0 A;  1ON4 A;  1Y25 A;  1ABA A;  1C72 A;  4PNF A;  5HR2 A;  2I81 A;  3W8J A;  1GUH A;  5D96 A;  3ZTL A;  1M2B A;  2IFQ A;  2RM6 A;  2H70 A;  4JRR A;  5ECR B;  3APO A;  8GSS A;  3HKR A;  4PTS A;  1BQ7 A;  3GTU A;  1X9M B;  4V1A p;  3D5J A;  1GSY A;  4ECI A;  1F37 A;  3C73 A;  3WT2 A;  1FAA A;  1ILO A;  4MZW A;  4AKX B;  5DAL B;  1XVQ A;  1QK8 A;  1HNB A;  4OCE A;  1B4Q A;  2WFC A;  1THX A;  3GUR A;  2GSQ A;  2H1B A;  4GDF A;  1TI1 A;  2LTK A;  2EIR A;  2VLV A;  4BL7 A;  1KNG A;  1SKS B;  3HJM A;  2WGR A;  1PL1 A;  2C1Y A;  3C1S A;  1PX6 A;  1PD2 1;  4TN8 A;  1NHY A;  2YOI A;  3BD2 A;  3KEB A;  1TRU A;  3FYG A;  5ELA A;  4HZ2 A;  1OC9 B;  2L6C A;  5CO3 A;  2R2J A;  2GQM A;  2XHF A;  5DDL A;  3UMA A;  3D0Z A;  4MF6 A;  3KMN A;  3PH9 A;  2VIM A;  3VWW A;  2C0G A;  2GT6 A;  1MDJ A;  4MCU A;  4TOP A;  1Z7P A;  2ZNM A;  3PR8 A;  5J4Y A;  1QXH A;  5D9V A;  4ECJ A;  3RHC A;  3QPM A;  2WZ9 A;  1XXU A;  4G01 A;  3F0I A;  2LST A;  3TJG A;  2FA4 A;  20GS A;  3KIJ A;  4OFT A;  5AIX A;  2HRK A;  2VCZ A;  4IQ1 A;  4GSN A;  4KE3 A;  4JED A;  2H0G A;  2MMA A;  5EY6 A;  5IIZ A;  4I8B A;  3ZLP A;  5LNK e;  1F2E A;  5ECM B;  4LMW A;  2CAQ A;  3FRC A;  5EL8 A;  4WR4 A;  1NSW A;  2OBI A;  3EMP A;  2I3Y A;  4FYB A;  2WB9 A;  9GSS A;  4G9H A;  16GS A;  1R7H A;  2X64 A;  1TI3 A;  2D2Z A;  3I6A A;  3WYW A;  3US3 A;  4IJ3 A;  4BPY A;  1OC8 A;  4Q5F A;  2GZY A;  1KBN A;  2QA2 A;  3L9U A;  2HRK B;  2GQK A;  4IS0 A;  3TJK A;  2A2R A;  3DKS A;  1ZYN A;  1ST9 A;  1G6Y A;  3HMJ G;  1TK8 B;  3APQ A;  5ECP B;  1B8X A;  3HZ8 A;  2OBK A;  2L59 A;  2C3T A;  1X5C A;  4I2U A;  2VCW A;  2VKZ G;  3LW9 A;  3GST A;  3QAW A;  2DMM A;  4USS A;  4IJI A;  2H6X A;  1SL1 B;  2LJK A;  2YNX A;  4ECC A;  2CX4 A;  2L4Q A;  3EVI A;  5IMC A;  1XWC A;  1GTI A;  2HSM B;  4KF9 A;  5CRW A;  1RW1 A;  1YEP A;  2HRF A;  3I69 A;  3TUE A;  4BA7 A;  3G7Y A;  3J7Y b;  4JR4 A;  1E2Y A;  2O5V A;  2F3M A;  3UAR A;  3F3R A;  4EL1 A;  2GTU A;  5G2Z A;  1RQM A;  4EE0 A;  2OAC A;  2OE0 A;  2OKA A;  2N5A A;  2O87 A;  4O5Q A;  1DUG A;  1EV4 A;  1SYR A;  3KTB A;  4YAV A;  3M8N A;  3TOT A;  3VPQ A;  1XPV A;  4D73 B;  2K8V A;  4L5L A;  5KN3 A;  2F9S A;  3KD0 A;  1E6B A;  2AYT A;  2IIY A;  1XBS A;  1TU8 A;  2X4A A;  2PPT A;  2F8F A;  1BG1 A;  1EGR A;  1AIU A;  2CVD A;  1MD3 A;  4G0L A;  4RI7 A;  4X4J A;  3TCO A;  4NPB A;  5G1L A;  5IMV A;  1PN9 A;  5B6N A;  4CY6 A;  5BMU A;  4AJ7 A;  2VD0 A;  2N5F A;  4HJM A;  3VK9 A;  13GS A;  3A5I A;  3WD6 A;  2ZUP A;  1XOA A;  4IQA A;  1LBK A;  2YWM A;  2K9F A;  1SVL A;  2K8S A;  1ACV A;  4XHM A;  2DJ0 A;  3UEM A;  1F6M C;  4Q5R A;  4AF2 A;  3ZFB A;  4K0N A;  2DBC A;  2RM5 A;  4ML1 A;  1SK0 A;  4YKF A;  3P2A A;  4X43 A;  1EV9 A;  2VL2 C;  5IMD A;  4Z7X A;  5AIV A;  4XCS A;  2HQT A;  4K7I A;  3ZYW A;  4TR1 A;  5HQP A;  1O73 A;  2ON7 A;  3VWX A;  4DSS B;  3ZVJ A;  3FZ5 A;  3TJF A;  1UA5 A;  2XBQ A;  1T4Z A;  4N3Z A;  1O7U A;  4KUN A;  3TKR A;  1O8W A;  4BVX A;  2B5E A;  2AJQ B;  5ECI B;  4F0C A;  1YZX A;  4RUV A;  2JZR A;  5G5F A;  4MA9 A;  1XW5 A;  4BVY B;  2L5L A;  2V1M A;  4NHW A;  5AIS A;  2EC4 A;  2L6D A;  4O5U A;  1GUK A;  1SKW B;  3PIN A;  1EZK A;  2IPA A;  1R26 A;  4NAX A;  1YJ6 A;  3GRX A;  2H72 A;  1MEK A;  1V9W A;  1GP1 A;  2DC5 A;  1S3D A;  5A4V A;  3M9J A;  2YWN A;  5ID2 B;  6GSU A;  4O92 A;  3KCM A;  1PKZ A;  4K5S A;  4IHU A;  1DE1 A;  2N5B A;  1F9M A;  4I6X A;  4FYC A;  4XS1 A;  4YKG A;  1W4V A;  4Z2U A;  2IMD A;  2RUE A;  6GST A;  2H73 A;  1V57 A;  2FWF A;  1G7O A;  1O6J A;  1CQH A;  4JBB A;  4ZIJ A;  3GH6 A;  3LYP A;  2HZF A;  2FY6 A;  1SVM A;  1XW6 A;  1GTA A;  1A23 A;  3KTL A;  17GS A;  3FEU A;  3FY7 A;  5J4U A;  1HYU A;  5IO0 A;  1TK0 B;  3A2W A;  5HFK A;  5DJL A;  4HDE A;  22GS A;  2GT5 A;  1A2L A;  1TW9 A;  2HZE A;  1SL0 B;  3F9U A;  3FR9 A;  3GHA A;  4Q5N A;  6GSV A;  1TXU A;  4KGI A;  2DIY A;  4L5O A;  1GUM A;  3ME7 A;  4HI7 A;  5ELG A;  3IHQ A;  2DJ1 A;  4GSS A;  2NDO A;  4POL A;  2CVB A;  1Z5Y E;  4IGJ A;  2WRT A;  3F4S A;  3HDC A;  3CTG A;  2WUL A;  4K7O A;  4Z2R A;  3G9B A;  2GDR A;  4I2T A;  2HNL A;  5D9X A;  2DJ2 A;  4DEJ A;  4JR6 A;  4ZL9 A;  1URM A;  4LL1 B;  3IXR A;  3M0F A;  5IOX A;  3ZVJ D;  1EGO A;  1XOB A;  2P31 A;  3F4T A;  4TKY A;  3ZRD A;  2B1L A;  12GS A;  2IWT A;  2LJA A;  2WCI A;  3L78 A;  2IMI A;  4K8M A;  1SKR B;  11GS A;  1SD9 A;  3EIN A;  3EMX A;  2LJR A;  1FVK A;  3A5W A;  2GZZ A;  4I97 A;  4WR5 A;  3H79 A;  2JAD A;  4IBP A;  1O81 A;  2FLS A;  5GSS A;  3HHV A;  1ZZY A;  1TOF A;  1ZOF A;  3VWV A;  5LCZ A;  2H8L A;  4O7H A;  5F05 A;  3D4T A;  3S9F A;  2E2M A;  4MJB A;  3N5O A;  4G10 A;  2EIQ A;  5G5E A;  1VRS D;  2YV9 A;  3O6T A;  2AV4 A;  4MAB A;  4OD7 A;  3LXZ A;  1O8X A;  5H5S A;  2L57 A;  2YJH A;  3EWL A;  5JCW A;  3ME8 A;  2GS3 A;  4MJA A;  3UOM A;  2LQO A;  2VL2 A;  1SK1 A;  2QGV A;  4MJC A;  1AQV A;  3FMW A;  3GUS A;  5AN1 A;  5CAX A;  1FHE A;  1OVN A;  2KP1 A;  3NIV A;  5JWR B;  1GSQ A;  4KDY A;  2VO4 A;  2G2Q A;  1IYH A;  4GTU A;  3GKK A;  4AGS A;  2R6K A;  2JU5 A;  3N9J A;  3TRX A;  2JSY A;  2OA7 A;  1SEN A;  3APS A;  4N10 A;  3LYK A;  4ZBD A;  3GL3 A;  3F6D A;  3HD5 A;  2R37 A;  1M99 A;  2FNO A;  4OFM A;  1DSB A;  3MNG A;  2KUC A;  4Q5Q A;  2C3Q A;  2E7P A;  2V41 A;  4MZC A;  3UBK A;  5EPF A;  3PGT A;  5ECN B;  1XVW A;  3KP9 A;  1YKC A;  2IMK A;  1PGT A;  3D22 A;  1TRW A;  2IL3 A;  3KH7 A;  6GSS A;  1A2J A;  3CMI A;  3VUR A;  2HYX A;  3VI5 A;  1F3B A;  1PSQ A;  1TXX A;  2VL3 A;  2E0Q A;  3GYK A;  2AUV A;  1XWG A;  1YQ1 A;  3VWU A;  4DSR A;  4EIP A;  4PX1 A;  3IHG A;  4GCI A;  3DVW A;  1DE2 A;  4G2E A;  4EUY A;  1PMT A;  4MDC A;  1W89 A;  2DKI A;  4L0U A;  2I4A A;  1YKA A;  3L9S A;  5JWQ B;  3LJR A;  1Z7R A;  2VL9 A;  1ZMA A;  2H1A A;  3LOR A;  4TR0 A;  5A4U A;  2HRN A;  1V40 A;  4XRA A;  2IFQ B;  2ON5 A;  2P5Q A;  4EIQ A;  4GWR A;  3QDN A;  4N11 A;  1T4Y A;  3U6V A;  3GTU B;  1A0R P;  1ZYQ B;  5CRE A;  3EU4 A;  3TOU A;  5KOX A;  1PRX A;  2CVK A;  4TRX A;  5HFG A;  1DBY A;  4W66 A;  3H4K A;  1O85 A;  2OJL A;  4FH8 A;  3WGX A;  2A2P A;  2X8G A;  4HQZ A;  2R0P A;  5J40 A;  2GZP A;  4MPF A;  4FIW A;  1YF0 A;  1TP9 A;  2B5X A;  4TXO A;  1F3A A;  1OE7 A;  4BL7 B;  1VF1 A;  3EU3 A;  1EOG A;  3TGZ A;  2DJ3 A;  3GL5 A;  2YP6 A;  1V58 A;  3LQ7 A;  4G19 A;  2XBI A;  2GGT A;  2VD1 A;  2QKE A;  3KMO A;  4Z2T A;  4ZBB A;  5A34 A;  2R5G A;  2K6V A;  4A5P A;  4V2M A;  4N30 A;  5AGY A;  3IRA A;  4AKH A;  4QMK A;  5JWO B;  3KH9 A;  2X99 A;  19GS A;  1PKW A;  3TJJ A;  3ZIV A;  2YJ7 A;  1KEB A;  4G0K A;  1SJZ A;  3QMX A;  1OKD A;  3ZL5 A;  2DML A;  4NXI A;  2C3N A;  2B7J A;  4HU9 A;  1TK5 B;  2XC2 A;  3IR4 A;  1SU9 A;  6GSY A;  3HCZ A;  3F63 A;  2H1D A;  2VM1 A;  1VGL A;  5KOW A;  2H71 A;  3UBL A;  2WDU A;  4XS4 A;  4CW9 A;  2H66 A;  1FO5 A;  1GTB A;  4NMU A;  4K2D A;  3ED3 A;  2HSN A;  3VLN A;  5IO2 A;  2CX3 A;  1V2A A;  5KN0 A;  1MDI A;  5J9C A;  5A4W A;  2YPM A;  3JCM L;  3LEF A;  1YY7 A;  4LLR A;  1M0U A;  1Z3E A;  5J47 A;  4OCF A;  1JLW A;  4ZBA A;  3RBT A;  4PGT A;  4PUF C;  2RII A;  3W8S A;  2VM2 A;  1Q98 A;  2H6Y A;  2IME A;  4TXV A;  5CNW A;  3Q19 A;  2BMX A;  1Z6N A;  1ZL9 A;  1BF5 A;  3Q6O A;  4K1F A;  4XTS A;  3ZRE A;  1YF1 A;  2VCV A;  4OO5 A;  1NHO A;  2M72 A;  4ILF A;  2HE3 A;  3VFI A;  2FA8 A;  3VI7 A;  3QFA C;  3GSS A;  3LG6 A;  1S3C A;  4QQ7 A;  3F4R A;  1G6W A;  3G7I A;  2YWO A;  3H93 A;  5JCG A;  2KP2 A;  1AUC A;  4GRF A;  2UZ8 A;  3TDG A;  4KCA A;  3HVS A;  3FR6 A;  4ECB A;  1SVO A;  3R2Q A;  2B6M A;  3GKX A;  3IC8 A;  3SBC A;  1MD4 A;  4MJE A;  5HR3 A;  2EFH A;  5LD0 A;  3CSH A;  3TKS E;  1A24 A;  1TDI A;  2OE1 A;  1ERV A;  1GNW A;  3WGE A;  3A2X A;  1JZR A;  1WP0 A;  4O5R A;  2M80 A;  1YVL A;  1XWB A;  4PQ1 A;  5A1N A;  4G0I A;  4POM A;  14GS A;  2UV8 G;  1M9A A;  3I43 A;  4MZB A;  2J23 A;  2LUS A;  3HZ4 A;  3RPN A;  1XWA A;  4GQC A;  3UVT A;  5CP1 A;  5IM9 A;  3DXB A;  2YV7 A;  3CSI A;  4JZQ A;  2VCQ A;  3CRT A;  2OT3 A;  2H1L A;  2CZ3 A;  4DVC A;  4K9Z A;  4WXT A;  2C8U A;  5CYY A;  2EFC A;  5D73 A;  1EP7 A;  2HFD A;  1YEX A;  3Q18 A;  5IOW A;  2O85 A;  4L8E A;  3IE3 A;  5BRT A;  1VF4 A;  5BMU B;  1AAZ A;  1TTZ A;  5J41 A;  1GSF A;  4V1A g;  2E2G A;  3DEX A;  5F06 A;  2PBJ A;  5F8B A;  1VF3 A;  3E9J B;  2GSS A;  5IPH A;  2HSY A;  2MYG A;  2LNT A;  4MF7 A;  1WPI A;  1LJR A;  3ZZX A;  5DAK A;  1XZO A;  2TRC P;  5DCH A;  5D9T A;  2P5R A;  1EOH A;  2OAD A;  3C71 A;  2PGT A;  1ZCP A;  4TR1 B;  2B5Y A;  1BG5 A;  3L9V A;  3EUR A;  2JAC A;  5A5H A;  1RK4 A;  1U87 A;  1GNE A;  5CRD A;  3HVV A;  2TRX A;  1WMJ A;  2HXK A;  2J9H A;  1K0N A;  4BVX B;  3FZA A;  4ZL8 A;  4KAE A;  4POK A;  1AQW A;  4MP4 A;  3MIX A;  1EEM A;  2VUP A;  2BJX A;  4ZB7 A;  4EDZ A;  5GST A;  4AI6 A;  5DAK B;  1N25 A;  1OC3 A;  4XS6 A;  4EDY A;  4K6X A;  2HLS A;  4ZB8 A;  1FB6 A;  5HR1 A;  5DVB A;  3H1N A;  4QL7 A;  2V6O A;  1T7P B;  4AKI A;  1PA3 A;  5ECQ B;  2XPD A;  2HI7 A;  3TJB A;  2FWG A;  1ZYE A;  4OFN A;  4KB3 A;  4K5R A;  5DQY A;  3RDW A;  5B8A A;  1SL2 B;  3KP8 A;  2DIZ A;  2CT6 A;  3D4M A;  2V32 A;  4IP1 A;  5L71 A;  2JZS A;  1T3B A;  2LNS A;  3UJ1 A;  3H8Q A;  4WF4 A;  4EVM A;  2KHP A;  1GL8 A;  1TU7 A;  3IAS 2;  4F2I A;  1X5E A;  2DSA A;  4J57 E;  2HZE B;  4GST A;  4ACS A;  1HNA A;  2H1G A;  2QSI A;  3UL3 A;  3PPU A;  4MLY A;  3QCP A;  3AY8 A;  3KJY A;  2IMF A;  1JHB A;  3HJO A;  1FOH A;  3UIW A;  4LL4 B;  1T8E B;  4V2N A;  2H30 A;  3IK7 A;  3MDK A;  1SJI A;  1GSD A;  4O32 A;  1Y6E A;  3ZMK A;  4ISD A;  4AKG A;  3IPZ A;  4KSM A;  2YCD A;  1R5A A;  4IEL A;  4ML6 A;  3IAM 2;  4DSQ A;  1ERT A;  1M9B A;  5ABR A;  2YAN A;  1A8Y A;  4XRD A;  3BOA A;  4PUA A;  3LXT A;  3CXG A;  3DML A;  18GS A;  1HD2 A;  4TVE A;  4CDO A;  4HUA A;  5D9W A;  1BX9 A;  2QA1 A;  2MMN A;  2GLR A;  1M2D A;  5DQS A;  2C0F A;  2FCH A;  4X1U A;  3K8N A;  4NV2 A;  1GH2 A;  1X9S B;  4F82 A;  4GXZ A;  4NWY A;  2R0G A;  2JZT A;  3M3M A;  1JZW A;  3TRP A;  4K7N A;  3E3E A;  1R4W A;  4PQI A;  4JE1 A;  1TKD B;  5DAL A;  1HQO A;  4MNN A;  2ZCT A;  3LSZ A;  2C80 A;  5ECK B;  2C0E A;  1X0R A;  2HSH A;  2C0D A;  1XIY A;  3A3T A;  5ECS A;  4FO5 A;  4WF5 A;  4IN0 A;  4GLT A;  3ISO A;  5J4V A;  1ML6 A;  1WWJ A;  4PQH A;  2NTO A;  1SJ6 A;  1OYJ A;  3HY2 A;  1Y1U A;  4NV5 A;  4F9Z A;  1ERU A;  2WJU A;  2X8C A;  1UC7 A;  2H75 A;  1OC9 A;  1Z6M A;  3D6I A;  4CHS A;  3FZ9 A;  1MDK A;  3C8E A;  3HVX A;  4OMV A;  3IOS A;  4MK3 A;  1T1V A;  3GKN A;  1HNC A;  1J0F A;  3L4N A;  1PX7 A;  3U5R E;  4RQR A;  2H74 A;  2KOK A;  3GN3 A;  1B4P A;  4HJ2 A;  5DCG A;  1BAY A;  4IP6 A;  1J9B A;  1THO A;  2FGX A;  1M7T A;  3I9V 2;  1K3O A;  2YN1 A;  3IV4 A;  2FHE A;  1OAZ A;  5IQY A;  2M46 A;  5D8I A;  5FHI A;  2Z9S A;  3GX0 A;  4E8H A;  5B8B A;  3ERG A;  1QUW A;  1N8J A;  2GQL A;  1U6T A;  2O89 A;  5KN2 A;  1K0O A;  1EWX A;  2VCT A;  1K3L A;  3QR6 A;  3RPP A;  4WKW A;  1WOU A;  3BCK A;  2ALB A;  3Q74 A;  2H6Z A;  3M9K A;  2F8A A;  4IVF A;  3HYP A;  2VAF A;  5INY A;  1EEJ A;  1AC1 A;  2FWH A;  3QOU A;  1YDK A;  2H0H A;  5CRG A;  2LQQ A;  5H5Q A;  3TKS C;  3IK9 A;  4WET A;  1OKT A;  2O8V B;  3D21 A;  2MZC A;  4XIH A;  2X49 A;  4F03 A;  3TRQ A;  1H4O A;  3TB2 A;  1QGV A;  4AJ6 A;  4ULX A;  4OO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...