3VI7A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
molecule keywords Hematopoietic prostaglandin D synthase
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi7A01
4MZWA 5GZZB 2YCDA 1OE7A 5F06A 3KCMA 3TJKA 2GQLA 2EIRA 1MDJA 6GSVA 1SKRB 2H66A 1K3YA 2XPDA 4RI7A 5DDLA 3BJ5A 2IMEA 2VL9A 2H70A 4POBA 2NDOA 4XRAA 4ZILA 3Q6OA 3M8NA 4JBBA 1Z6NA 5D96A 3LQ7A 3GKMA 3VI7A 5F8BA 2O8VB 3L9VA 4AJ7A 1DUGA 1ZGNA 5AN1A 4FYUA 2DJ3A 4K1FA 1FG4A 2PU9C 2ZNMA 3P7XA 1XCCA 3F4RA 4PXOA 4IVFA 3ME8A 1YY7A 1XW5A 1OC8A 1GWCA 1ML6A 6GSYA 4MJEA 3Q74A 5D9WA 5F05A 2H75A 4MMMA 4K2DA 4EVMA 4QL9A 1T7PB 1KEBA 3HVSA 3ZREA 3ZLPA 3A2XA 2B5YA 1X9SB 4HJMA 4TR4A 1ZZYA 16GSA 4G2EA 2DC5A 3IDVA 2JU5A 4G0KA 4FO5A 2C0DA 3O6TA 5G30A 4BWSA 1A2JA 1TRSA 2P5QA 2LRTA 2FD3A 3F4TA 1J9BA 3FZ5A 4KNDA 3KXOA 3TOTA 19GSA 2M80A 2PN8A 1B9YC 5CYYA 3FY7A 2CVKA 4KH7A 1XFLA 4IHUA 5B6MA 2H8LA 1SU9A 3ZIJA 2FWGA 3VWWA 4DVCA 1M99A 3HDCA 4IS0A 1G7OA 3UARA 4WBJA 1TU8A 3IOSA 3UL3A 4ZBDA 2HRAA 1RK4A 4K7NA 1WMJA 2K9FA 3NOFA 2DIZA 2LJKA 4L0UA 3P90A 2OACA 2L6CA 2UZ8A 5ECNB 2DJ0A 1KBNA 2RM5A 1EP8A 5CRWA 1OKDA 1PSQA 1OAZA 4YQVA 1T00A 4I97A 3EYTA 4G19A 2CAQA 4HZ2A 3BCIA 5IMVA 3ZIVA 1PKWA 3KD0A 5ENUA 3LORA 3ZITA 4ZL8A 3QFAC 4PQIA 3P8WA 2FUG2 5ECKB 4PQ1A 2CA8A 3KGKA 3FZAA 1FHEA 1SKWB 3JCML 2B7JA 4IJIA 5E59A 2IMIA 2IFQB 4XHMA 2GT6A 1XXUA 2HRKA 4FYCA 4ZL9A 2TRXA 4TR1A 3RBTA 4IN0A 4ILFA 3WGDA 2WRTA 2N5BA 2RIIA 3ERWA 2JZTA 2FWFA 1SL1B 4ACSA 2WULA 2YP6A 1K0DA 4WXTA 1ACVA 3M9KA 2MMZA 3IA1A 2H1DA 3D22A 3A5WA 1SK1A 3GIXA 2V6KA 4TRXA 2DMLA 2LEGA 1Q98A 3MDKA 3L9UA 1TRVA 2IWTA 1HNAA 3GV1A 2MMOA 5G31A 2O85A 2H74A 3M1GA 5AISA 2OJLA 1AUCA 4CDOA 2GZYA 5BMUA 5IMFA 4ECBA 3KH7A 4ECJA 3U6VA 1XVWA 4EF0A 1F6MC 1FB6A 2X8GA 4ZB6A 1JZRA 1K0MA 3DKSA 2EIQA 2GSTA 1ABAA 2AUVA 5AIXA 3FHKA 1YKAA 2DBCA 2L6DA 4QQ7A 4TW5A 3HHVA 2AHEA 1OKTA 1WIKA 2RM6A 1V40A 2B3SA 3QAGA 4G10A 1V98A 3ERGA 4N0ZA 3BD2A 3QMXA 3VURA 3N5OA 1KNGA 4TOPA 1EWXA 3CYNA 4L5LA 6GSUA 1UN2A 5CO3A 3OR5A 3UEMA 4DSSA 2B1KA 4K8MA 1U3AA 3GMFA 4PX1A 2IIYA 3GX0A 1VF1A 3CMIA 3QAWA 1I5GA 4E8EA 2YOIA 2VL2A 5IMAA 2Z9SA 2BJXA 2V2GA 4L5OA 2VUPA 2GQKA 6GSTA 5E4WA 2VL3A 3RPPA 1R5PA 4IQ1A 1YZXA 3CRUA 2NPBA 1EEJA 2JL4A 3C71A 4WEYA 2CX3A 2H1GA 2KP1A 3D6IA 1K3LA 1K0CA 1ERTA 4BVXB 4F03A 1G6WA 2YPMA 1AQVA 2GVPA 2IPAA 2VD0A 4NAXA 3CSHA 1EGOA 4O5RA 3EVIA 4X43A 4ML1A 4BVYA 1EV4A 4HQSA 2YV9A 3AY8A 4K7OA 3DYRA 3IPZA 2OE0A 2AJQB 5A4VA 4TXVA 3MSZA 3F63A 1PRXA 4L8EA 4YAPA 1BG5A 5ECPB 3DIEA 3GKXA 2JSZA 1S3CA 4IQAA 2C80A 3KTBA 2LRCA 3IBHA 3BCKA 3VWUA 4WR4A 2C3QA 2B5XA 2NBSA 2CAIA 4NXIA 1TW9A 1Z6MA 1ZYEA 4IP6A 1SYXA 3TJGA 4POLA 1YF0A 1DBYA 3H4KA 2LV3A 4F0BA 1PL2A 1PGTA 2NVLA 1OYJA 4JZQA 3MAKA 4HZ4A 4NHZA 1JZWA 5ABRA 5GSSA 4IJ3A 1QGVA 4PNGA 4FIWA 1V2AA 2L59A 1OC3A 5D9TA 4ECCA 1YJ6A 2AB6A 2H71A 4GLTA 4AJ6A 4RUVA 2H0HA 4OCFA 1XZOA 1JZDA 4OCEA 2HZEB 3FW2A 1GTIA 3FEUA 2VAFA 1W89A 3ERFA 2HRNA 2CQ9A 2WB9A 2JZRA 4HI7A 1FO5A 2I9HA 1ERVA 4X1UA 4HEA2 4E8HA 4F0CA 1ERUA 1AC1A 2LNTA 3Q19A 1QXHA 5ECSA 2X64A 5ID2A 1J08A 4HS1A 3TOUA 5DALA 1B8XA 3FZ4A 4ZBAA 5H5RA 20GSA 2I81A 4FH8A 4FYBA 2GZPA 4XS6A 1EOHA 1K0NA 3GNJA 2OA7A 3WD6A 5JCWA 2VCQA 2HSMA 4GSSA 2YZHA 5H5SA 2TRCP 5DQSA 3G9BA 4ISDA 3G7YA 3CXGA 4ZB8A 2EC4A 2FCHA 3FR6A 3G7IA 1Q4JA 2R6KA 2HI7A 5JCGA 3IR4A 1O6JA 4F2IA 1O81A 3FRCA 3TJBA 1GULA 2OADA 2WS2A 5EY6A 4OO4A 3PH9A 3ZFBA 2I4AA 4WBRD 4LL1B 4PNFA 1GTAA 4KSMA 5IOWA 1NM3A 3HJOA 5EPFA 4TXOA 1XIYA 2BMXA 3APQA 2R37A 2RUEA 1K0OA 5J41A 2HZEA 17GSA 3IXRA 5B8AA 3VFIA 5CAXA 1G6YA 2JSYA 5AIVA 2DJKA 2JACA 5J3RA 4KSOA 1BQ7A 3ME7A 4NPBA 1J0FA 1THOA 5DAKA 2OBKA 1TK8B 2VIMA 3EE2A 5JWRB 3KJYA 1H4OA 5F07A 2YWMA 1FW1A 1X5EA 2DLXA 1U87A 1YKCA 1XWBA 3TKRA 3QOUA 2R3XA 2L5OA 2PWJA 1N2AA 2GLRA 2A2RA 4MF7A 3ZL5A 2C0GA 4NWYA 1T4ZA 2GGTA 1TOFA 2H1BA 4TR0A 1SD8A 2VCWA 3PPUA 2C3NA 2ES7A 2K8SA 1SK2A 4NV5A 4WF4A 4I2TA 1C72A 3TJFA 4BL7A 2P0GA 1ON4A 4K6XA 4IBPA 5G5EA 1GSDA 2X99A 2HQTA 2IL3A 1N8JA 1YF1A 3DVWA 3KZQA 1DE1A 4YAVA 2G0FA 4G0IA 3IRAA 1GLPA 4MF5A 3HA9A 3GN3A 3US3A 1Y6EA 2HE3A 2F51A 1XW6A 2HRKB 2YWOA 1GSFA 4TR1B 3GHAA 4Q5QA 4CHSA 2PPTA 1XWGA 14GSA 4V1Ap 1URMA 1TK5B 2CZ2A 1YDKA 4MK3A 2GDRA 1M9AA 18GSA 3HVXA 2KHPA 2GT5A 5C04A 5DJLA 1XOBA 5DBQA 3EU3A 3L78A 3V1WA 5KN3A 2MZCA 3O3TA 2I3YA 1T4YA 3FK8A 5IM9A 3TKPA 4MZCA 4GCIA 1GH2A 1QMVA 1R7HA 4K0NA 1KTEA 3HVVA 3H93A 1GLQA 1S3DA 4KB3A 1PX7A 3HY2A 1HNBA 2CX4A 5DVBA 4G9HA 3IK7A 2H6XA 3TRQA 3GSSA 2VLVA 4DSQA 5D9XA 1A23A 2RUFA 3UVTA 3C1RA 3GKKA 4ZXGA 3D4MA 4GF0A 3SWLA 3DVXA 4O7HA 4J2FA 2LTKA 1GL8A 4EXJA 4CW9A 4KX4A 1DE2A 1QK8A 3EC3A 2L57A 2LUSA 5D8IA 4KDXA 5ECQB 1X5CA 2WFCA 5FHIA 3LGCA 2ON5A 1THXA 1E6BA 4XS1A 3A2VA 4KUNA 3VPQA 3M0FA 4DSSB 4J57E 1AQWA 1VF4A 4OWYA 1GUMA 4USSA 4GWRA 4MH3A 5G5FA 4XTSA 4V2NA 2PBJA 5ECLB 1YQ1A 2N5FA 1XWKA 1Z5YE 3CTFA 3LXZA 1ZCPA 4EL1A 3GUSA 3DMLA 5HR2A 4KDUA 5LCZA 2LKUA 3QD9A 1BX9A 3GURA 3TKSC 5EL8A 5EVOA 5L71A 4LMWA 4GTUA 5CRDA 4POKA 5ECIB 3CTGA 3UVHA 4I6XA 3VLNA 4DEJA 4Q5FA 4MF6A 1V57A 1M2DA 4PQHA 3FR3A 7GSSA 2HT9A 4PTSA 1JZOA 1YEPA 4XS4A 3LWAA 1DSBA 3GRXA 3F4SA 1WWJA 3UAPA 4ECIA 4BVYB 3F9UA 1AW9A 2FY6A 1BJXA 3PINA 5A4UA 1GTBA 2HSHA 3HXSA 2MMAA 5IQYA 1JLWA 1SENA 1B4PA 3RDWA 4BPYA 3ZZXA 5FWGA 1O7UA 1OVNA 5INYA 1R26A 1QFNA 1F37A 3KEBA 3APSA 4EDZA 1LBKA 4EDYA 3LG6A 3WYWA 3D4TA 11GSA 3CBUA 2VM2A 2MBSA 1TU7A 3HCZA 2WCIA 2A4VA 3FR9A 5AGYA 1HQOA 3D5JA 3EWLA 3FYGA 8GSSA 2AAWA 5DCHA 4X0XA 1Z7PA 3KTLA 1VF2A 1NHYA 4XCSA 2QGVA 6GSWA 3L0HA 1TRUA 3J7Yb 2HYXA 4ULXA 3PR8A 2FWHA 2PERA 3I6AA 2GZZA 6GSSA 3KP8A 4GQFA 3VWVA 9GSSA 12GSA 1FB0A 3EU4A 2K6VA 1O73A 2YNXA 3BBYA 3EINA 2R2JA 2REMA 1FOVA 2L4CA 2M72A 3KMOA 4KW6A 2XBIA 4PGTA 1GSEA 4PUAA 2YJHA 1F2EA 1HD2A 2JADA 2PUKC 3APOA 5HQPA 5ID2B 3LXTA 5DALB 5ELAA 1Z7RA 1MDKA 1PN9A 5DJMA 1ZOFA 2P5RA 3F3QA 3GFKA 3RHCA 5KN2A 2H0GA 2HSNB 2HSMB 3HKRA 3RAZA 4IGJA 4F82A 4KCEA 5G1KA 3ZRDA 4MABA 1SJ6A 5D73A 1YEXA 4MLYA 3TKSE 2H73A 1ILOA 3KMNA 4NHWA 1R4WA 1UVZA 1X9MB 2H6ZA 1GNWA 2DIYA 1W4VA 22GSA 2GS3A 2WJUA 4HQZA 4OO5A 4P3YB 5ECOB 4Q5RA 1O8XA 4MH2A 4OFTA 1PA3A 3GYKA 4HJ2A 1TKDB 4N30A 4GXZA 2VO4A 1SYRA 3FZ9A 5F0GA 4TXOB 5G1LA 2QC7A 5KN0A 3GSTA 1AIUA 1JLVA 5ECRB 2C1YA 2I1UA 2ALBA 4HDEA 5J9CA 4EUYA 4RI6A 4JU5A 1VF3A 2O7KA 3HZ4A 4MDCA 3E9JB 2GSSA 3GL5A 1U88A 3I69A 2VLUA 1GP1A 1EZKA 5C00A 3IAS2 5DAKB 1XBSA 2YN1A 4YQUA 1AXDA 3LYPA 4XRDA 3TKQA 3D0ZA 3KM6A 1U6TA 2CZ3A 1F3AA 3KP9A 3VPTA 4I5QA 3G7JA 5ECHB 4HUAA 2H76A 4TVEA 1BYEA 2E0QA 4DSRA 1ZYQB 5HR1A 3UBKA 1TDIA 3IAM2 1JFUA 3DEXA 5CP1A 4ZL7A 4K7IA 1SL0B 1PKZA 3ZFLA 4LMVA 4LL4B 3F8UA 3ZYWA 2E7PA 5IOXA 4BL7B 2N5AA 2D2ZA 3GH9A 3TDGA 5IO2A 4NV2A 2GSQA 3N9JA 2HNLA 1OE8A 4MPGA 3DWVA 3TRXA 2FWEA 4KGIA 2R4VA 3QPMA 3F3RA 4HU9A 2B6MA 4L0WA 1EP7A 1MEKA 1SJZA 3D21A 3I43A 1PMTA 2HFDA 1Z9HA 4YQMA 3H8QA 2YJ7A 3TCOA 1M0UA 3H1NA 1T8EB 2H30A 2WGRA 2VLTA 1GSSA 1PL1A 3A3TA 2IJYA 2M46A 1K0AA 1HYUA 2YWIA 1G7EA 13GSA 4MJBA 1OC9A 2AV4A 3K8NA 4QL7A 5G2ZA 1SJIA 1M9BA 2F8AA 4MA9A 4N11A 5HR3A 2YZUA 2LSTA 1M2AA 3GH6A 3SBCA 2CVDA 5D93A 2MYGA 2CVBA 1A0FA 2L4QA 4XIHA 5B6NA 3RPNA 3VWXA 3C7MA 4KE3A 2FGXA 4I8BA 4Z7XA 4TN8A 2PMTA 4KAEA 3C8EA 3IC8A 1TXXA 5HFGA 4LA1A 4KF9A 4JE1A 4BWQA 2PGTA 2TIRA 1VRSD 4AF2A 1SKSB 2VD1A 4IKHA 3EMPA 4I2UA 5B7CA 4OMVA 2B5EA 2FA8A 4N0VA 3GTUA 2LJAA 4G0LA 1QQ2A 4POMA 3ZVJD 2P31A 1V9WA 4ZB9A 1O8WA 3Q18A 4KCAA 1I9DA 2YANA 2H72A 5HR0A 3KH9A 2B1LA 2H1AA 5IMDA 1USBA 2OBIA 2ZCTA 2F3MA 5DQYA 5GAPD 3WT1A 1K3OA 1Y25A 1TK0B 2FHEA 5A5KA 3EMXA 2O87A 4NMUA 4GRFA 2X8CA 2WZ9A 5HFKA 3TB2A 2VCZA 1EOGA 1AAZA 1R5AA 1M7TA 1X5DA 3ZTLA 3MWHA 2LS5A 1EGRA 3TKSA 2XPEA 3PGTA 3HZ8A 3TRPA 2H0IA 4XS4B 3UOMA 3DRNA 3HJMA 3KIJA 1JHBA 1ST9A 1XPVA 3HJPA 1PX6A 3BOAA 3DGQA 2B7KA 1A2MA 2H19A 3FKFA 2YV7A 4JEDA 2XHFA 2O89A 1TTZA 1MDIA 4MJAA 4J56E 2IN3A 4RQRA 5IIZA 3LFLA 3F6DA 3QFBC 4WF5A 4K0GA 2V6OA 5IPGA 2A2SA 2HRFA 2PVOC 3RHBA 4AJ8A 2GSRA 2K18A 5ECMB 2HSYA 1A24A 1SL2B 5J9BA 2C4JA 3O76A 2G2QA 2XC2A 3UBLA 1G0TA 2V32A 2C8UA 5IMZA 5B8BA 3MNGA 4ZIJA 1GSUA 4ID0A 2OE1A 3M9JA 3I9V2 2HXKA 4RQXA 2FNOA 3LJRA 3S9FA 3J7Yk 1E2YA 1NHOA 4F9ZA 2KUCA 4JR6A 4D73B 5HFIA 2FA4A 1GSYA 4JR4A 4GSNA 3GA4A 1QUWA 2H6YA 3UJ1A 1LU4A 1XWCA 2MMNA 2V1MA 2GTUA 2K8VA 3HYPA 1K0BA 3TUEA 10GSA 2LQQA 2LRNA 3UIWA 2X8HA 2E2GA 1X0RA 4LLRA 1ERWA 1A8YA 1WOUA 2LQOA 3L9SA 1B4QA 5CNWA 2FLSA 5H5QA 2IMKA 5DCGA 2RLIA 1H75A 1V58A 4OFNA 2DJ1A 2IFQA 2LNSA 1EEMA 4FQUA 3QR6A 3WGXA 2VM1A 5GAND 3M3MA 1WP0A 4WKWA 2WDUA 2VOCA 3QCPA 3H79A 5LD0A 1GUKA 2KOKA 3R2QA 3C1SA 2V41A 5FT3A 3CSJA 1GTUA 1IYIA 1B48A 1LJRA 4HOJA 5CRHA 4IW9A 3W8JA 4D73A 2HLSA 4MJCA 2LJRA 2VCTA 2ZUPA 3EURA 1T1VA 2J9HA 3ZMKA 5IO0A 2CT6A 3A2WA 1VGLA 4OFMA 3CSIA 1TI1A 2F8FA 4TR3A 3E0UA 5D9VA 3L4NA 3TGZA 5LNKe 2VCXA 3WGEA 3GKNA 1FAAA 4MP4A 3DD3A 4N10A 1S3AA 2EIOA 2YWNA 5COHA 4WR5A 3GL3A 3QDNA 1CQGA 5KEJA 3IE3A 4WETA 3NIVA 3ED3A 2OKAA 2F9SA 1GRXA 2XBQA 4EE0A 5ELGA 1SD9A 1UA5A 1ZMAA 3W8SA 4H86A 4ML6A 2VL2C 5J5NA 1WE0A 5IMCA 1F3BA 2HZFA 2DSAA 4IELA 1CQHA 2OE3A 3UMAA 2H01A 3IK9A 2IMFA 1Z3EA 1WJKA 3W6GA 1F9MA 1XW9A 4V2LA 3F0IA 4OD7A 1A8LA 4EKZA 1BAYA 1XWAA 2KP2A 4JRRA 3LSZA 1AQXA 3VK9A 4K9ZA 2GQMA 2MBTA 1MD4A 2NTOA 2DMMA 6GSXA 1RW1A 1MTCA 4EC0A 1NW2A 2ON7A 5KN1A 4BVXA 1EV9A 1MD3A 4Q5NA 2QSIA 2QKEA 4IP1A 2BTOT 5CREA 1A2LA 1PD21 1ZL9A 3DXBA 4ZBBA 1B9XC 4MCUA 1XOAA 5IPHA 3R3EA 3CRTA 5JWOB 1TP9A 5A4WA 1O85A 1OC9B 3QAVA 3C73A 1GSQA 1X9WB 1PQNA 4EO3A 5J4UA 3GX8A 4HU7A 1TI3A 4O32A 1IYHA 5CRGA 5JWQB 4V1Ag 1SK0A 4V2MA 1GUHA 3LYKA 4GSTA 2JZSA 4AGSA 2VCVA 5GSTA 4KA0A 1TJDA 3ZVJA 4O92A 1GNEA 4PUFC 1FVKA 4MZBA 3VI5A 4BA7A 1M2BA 2DJJA 2L5LA 2PVQA 1HNCA 3IHQA 1WRYA 2J23A 2KLXA 4KDYA 2AYTA 1TRWA 3WT2A 1RQMA 1FVJA 3NZNA 4PURA 1A0RP 2C0FA 3LEFA 1U3IA 5JCUA 3IV4A 3IC4A 2C0EA 4MPFA 3TJJA 3F6FA 2R5GA 3E3EA 3HD5A 2E2MA 3GTUB 2IMDA 1UC7A 3U5RE 2C3TA 3ISOA 1WPIA 4YH2A 3P2AA 2CV4A 2DJ2A 1XVQA 1NSWA 4TKYA 1BEDA 3ZMLA 1T3BA 4GQCA
chains in the Genus database with same CATH superfamily
4O5UA 4MZWA 4GDFA 2WW2A 5GZZB 2YCDA 1OE7A 5F06A 3KCMA 3TJKA 2GQLA 2EIRA 1MDJA 6GSVA 1SKRB 2H66A 1K3YA 2XPDA 4RI7A 5DDLA 3BJ5A 2IMEA 2VL9A 2H70A 4POBA 2NDOA 4XRAA 4ZILA 3Q6OA 3M8NA 4JBBA 1Z6NA 5D96A 3LQ7A 3GKMA 3VI7A 5F8BA 2O8VB 3L9VA 4AJ7A 1DUGA 1ZGNA 5AN1A 4FYUA 2DJ3A 4K1FA 1FG4A 2PU9C 2ZNMA 3P7XA 1XCCA 3F4RA 4PXOA 4IVFA 3ME8A 1YY7A 1XW5A 1OC8A 1GWCA 1ML6A 6GSYA 4AI6A 4MJEA 3Q74A 5D9WA 5F05A 2H75A 4MMMA 4K2DA 4EVMA 4QL9A 1T7PB 1KEBA 3HVSA 3ZREA 3ZLPA 3A2XA 2B5YA 4K5RA 1X9SB 4HJMA 4TR4A 1ZZYA 16GSA 4G2EA 2DC5A 3IDVA 2JU5A 4G0KA 4K2XA 2WVXB 4FO5A 2C0DA 3O6TA 5G30A 4BWSA 1A2JA 1TRSA 2P5QA 2LRTA 2FD3A 3F4TA 1J9BA 3FZ5A 4KNDA 3KXOA 3TOTA 19GSA 2M80A 2PN8A 1B9YC 5CYYA 3FY7A 2CVKA 4KH7A 1XFLA 2X49A 3TU3B 4IHUA 5B6MA 2H8LA 1SU9A 3ZIJA 2FWGA 3VWWA 4DVCA 1M99A 3HDCA 4IS0A 1G7OA 3UARA 4WBJA 1TU8A 3IOSA 3UL3A 4ZBDA 2HRAA 1RK4A 4K7NA 1WMJA 2K9FA 2QA2A 3NOFA 2DIZA 2LJKA 4L0UA 3P90A 2OACA 2L6CA 2UZ8A 2WW3A 5ECNB 2DJ0A 1KBNA 2RM5A 2QA1A 1EP8A 5CRWA 1OKDA 1PSQA 1OAZA 4YQVA 1T00A 4I97A 3EYTA 4G19A 2CAQA 4HZ2A 3BCIA 5IMVA 3ZIVA 1PKWA 3KD0A 5ENUA 3LORA 3ZITA 4ZL8A 3QFAC 4PQIA 3P8WA 2FUG2 5ECKB 4PQ1A 2CA8A 3KGKA 3FZAA 1FHEA 1SKWB 3JCML 2B7JA 4IJIA 5E59A 2IMIA 2IFQB 4XHMA 2GT6A 1XXUA 2HRKA 4FYCA 4ZL9A 2TRXA 4TR1A 4QMKA 3RBTA 4IN0A 4ILFA 3WGDA 2WRTA 2N5BA 2RIIA 3ERWA 2JZTA 2FWFA 1SL1B 4ACSA 2WULA 4N3ZA 2YP6A 1K0DA 4WXTA 1ACVA 1S4BP 3M9KA 2MMZA 3IA1A 2H1DA 3D22A 3A5WA 1SK1A 3GIXA 2V6KA 4TRXA 2DMLA 2LEGA 1Q98A 3MDKA 3L9UA 1TRVA 2IWTA 1HNAA 3GV1A 2MMOA 5G31A 2O85A 2H74A 3M1GA 5AISA 2OJLA 1AUCA 4CDOA 2GZYA 5BMUA 5IMFA 4ECBA 3KH7A 4ECJA 3U6VA 1XVWA 4EF0A 1F6MC 4PI2C 1FB6A 2X8GA 4ZB6A 1JZRA 1K0MA 2WVZA 3DKSA 2EIQA 4FXYP 2GSTA 1ABAA 2AUVA 5AIXA 3FHKA 1YKAA 5A5HB 2DBCA 2L6DA 4QQ7A 4TW5A 3HHVA 2AHEA 1OKTA 5A1NB 1WIKA 2UV8G 2RM6A 1V40A 2B3SA 3QAGA 4G10A 1V98A 3ERGA 4N0ZA 3BD2A 3QMXA 3VURA 3N5OA 1KNGA 4TOPA 1EWXA 3CYNA 4L5LA 1SVMA 6GSUA 1UN2A 5CO3A 3OR5A 3UEMA 4DSSA 4AKGA 2B1KA 1U3AA 4K8MA 2WW1A 3GMFA 3LW9A 4PX1A 4X4JA 2IIYA 3GX0A 1VF1A 3CMIA 3QAWA 1I5GA 4E8EA 2YOIA 2VL2A 3MIXA 5IMAA 2Z9SA 2BJXA 2V2GA 4L5OA 2VUPA 2GQKA 6GSTA 5E4WA 2VL3A 3RPPA 1R5PA 4IQ1A 1YZXA 3CRUA 2NPBA 1EEJA 2JL4A 3C71A 4WEYA 2CX3A 2H1GA 2KP1A 3D6IA 4EIQA 1K3LA 1K0CA 1ERTA 4BVXB 4F03A 1G6WA 2YPMA 1AQVA 2GVPA 2IPAA 2VD0A 4NAXA 3CSHA 1EGOA 4O5RA 3EVIA 4X43A 4ML1A 4BVYA 1EV4A 4HQSA 2YV9A 3AY8A 4K7OA 3DYRA 4K5SA 3IPZA 2OE0A 2AJQB 5A4VA 4TXVA 5A1NA 3MSZA 3F63A 1PRXA 4L8EA 4YAPA 1BG5A 5ECPB 3DIEA 3GKXA 2JSZA 1S3CA 4IQAA 2C80A 3KTBA 2LRCA 3IBHA 3BCKA 3VWUA 4WR4A 2C3QA 2B5XA 2NBSA 2CAIA 4NXIA 1TW9A 1Z6MA 1ZYEA 4IP6A 1SYXA 3TJGA 4POLA 1YF0A 1DBYA 3H4KA 2LV3A 4F0BA 1PL2A 1PGTA 2NVLA 1OYJA 4JZQA 3MAKA 4HZ4A 4NHZA 1JZWA 5ABRA 5GSSA 4IJ3A 1S3RA 1QGVA 4PNGA 4FIWA 1V2AA 2L59A 1OC3A 5D9TA 4ECCA 1YJ6A 2AB6A 2H71A 4GLTA 4AJ6A 4RUVA 2H0HA 4OCFA 2O36A 1XZOA 1JZDA 2EFEA 4OCEA 1YEWC 2HZEB 3FW2A 1GTIA 3FEUA 2VAFA 1W89A 3ERFA 2HRNA 2CQ9A 2WB9A 2JZRA 4HI7A 1FO5A 2I9HA 1ERVA 4X1UA 4HEA2 4E8HA 4F0CA 1ERUA 1AC1A 2LNTA 3Q19A 1QXHA 5ECSA 2X64A 5ID2A 1J08A 4HS1A 3TOUA 5DALA 1B8XA 3FZ4A 4ZBAA 5H5RA 20GSA 2I81A 4FH8A 4FYBA 2GZPA 4XS6A 1EOHA 1K0NA 3GNJA 2OA7A 3WD6A 5JCWA 2HSNA 2VCQA 2HSMA 4GSSA 2YZHA 5H5SA 2TRCP 5DQSA 3G9BA 4ISDA 1M3IA 3G7YA 3CXGA 4ZB8A 2EC4A 2FCHA 3FR6A 3G7IA 1Q4JA 2R6KA 2HI7A 5JCGA 3IR4A 1O6JA 4F2IA 1O81A 3FRCA 3TJBA 1GULA 2OADA 2WS2A 5EY6A 4OO4A 3PH9A 3ZFBA 2I4AA 4WBRD 4LL1B 4PNFA 1GTAA 4KSMA 5IOWA 1NM3A 3HJOA 5EPFA 4TXOA 1XIYA 2BMXA 3APQA 2R37A 2RUEA 1K0OA 4Z2TA 5J41A 2HZEA 17GSA 3IXRA 5B8AA 1XG8A 3VFIA 5CAXA 1G6YA 2JSYA 5AIVA 4YKGA 2DJKA 2JACA 5J3RA 4KSOA 1BQ7A 3ME7A 4NPBA 1J0FA 1THOA 5DAKA 5KOXA 2OBKA 1TK8B 2VIMA 3EE2A 5JWRB 3KJYA 1H4OA 5F07A 2YWMA 1FW1A 1X5EA 2DLXA 1U87A 1YKCA 1XWBA 3TKRA 3QOUA 2R3XA 2L5OA 2PWJA 1N2AA 2GLRA 2A2RA 4MF7A 3ZL5A 2C0GA 4NWYA 1T4ZA 2GGTA 1TOFA 2H1BA 4TR0A 1SD8A 2VCWA 3PPUA 2C3NA 2ES7A 2K8SA 1SK2A 4NV5A 4WF4A 4I2TA 1C72A 3TJFA 4BL7A 2P0GA 1ON4A 4K6XA 4IBPA 5G5EA 1GSDA 2X99A 2HQTA 2IL3A 1N8JA 1YF1A 3DVWA 3KZQA 1DE1A 4YAVA 2G0FA 4G0IA 3IRAA 1GLPA 4MF5A 3HA9A 3GN3A 3US3A 1Y6EA 2HE3A 4Z2UA 2F51A 1XW6A 2HRKB 2YWOA 1GSFA 4TR1B 3GHAA 4Q5QA 4CHSA 2PPTA 1XWGA 14GSA 4V1Ap 1URMA 1TK5B 1BG1A 2CZ2A 1YDKA 4MK3A 2GDRA 2H1LA 1M9AA 18GSA 4O5QA 3HVNA 3HVXA 2KHPA 2GT5A 5C04A 5DJLA 1XOBA 5DBQA 3EU3A 3L78A 3V1WA 5KN3A 2MZCA 3O3TA 2I3YA 1T4YA 3FK8A 2DKIA 5IM9A 3TKPA 4MZCA 4GCIA 1GH2A 1QMVA 1R7HA 4K0NA 1KTEA 3HVVA 3H93A 1GLQA 1S3DA 4KB3A 1PX7A 3HY2A 1HNBA 2CX4A 5DVBA 4G9HA 5BMUB 3IK7A 2H6XA 3TRQA 3GSSA 2VLVA 4DSQA 5D9XA 1A23A 4PI0C 2RUFA 3UVTA 3C1RA 3GKKA 4ZXGA 3D4MA 4GF0A 3SWLA 3DVXA 4O7HA 4J2FA 2LTKA 1GL8A 4EXJA 4CW9A 4KX4A 1DE2A 1QK8A 3EC3A 2L57A 2LUSA 5D8IA 4KDXA 5ECQB 1X5CA 2WFCA 5FHIA 3CQFA 3LGCA 2ON5A 1THXA 1E6BA 4XS1A 3HMJG 3A2VA 4KUNA 3VPQA 3M0FA 4DSSB 4J57E 1AQWA 1VF4A 4OWYA 1GUMA 4USSA 4GWRA 4MH3A 5G5FA 4XTSA 3CHXC 4V2NA 2PBJA 2DKHA 5ECLB 1YQ1A 2N5FA 1XWKA 1Z5YE 3CTFA 3LXZA 1ZCPA 4EL1A 3GUSA 3DMLA 5HR2A 4KDUA 5LCZA 2LKUA 3QD9A 2WZSA 1BX9A 3GURA 3TKSC 1PFOA 5EL8A 5EVOA 5L71A 4LMWA 4GTUA 5CRDA 4POKA 5ECIB 3CTGA 1TXUA 3UVHA 4I6XA 3VLNA 4DEJA 4Q5FA 4MF6A 1V57A 1M2DA 4PQHA 3FR3A 7GSSA 2HT9A 4PTSA 1JZOA 1YEPA 4XS4A 3LWAA 1DSBA 3GRXA 3F4SA 1WWJA 3UAPA 4ECIA 4BVYB 3F9UA 1AW9A 2FY6A 1BJXA 3PINA 5A4UA 1GTBA 2HSHA 3HXSA 3EPTA 2MMAA 5IQYA 1JLWA 1SENA 1B4PA 3RDWA 4BPYA 3ZZXA 5FWGA 1O7UA 1OVNA 5INYA 1R26A 1QFNA 4PHZC 1F37A 4A5PA 3KEBA 3APSA 4EDZA 1LBKA 4EDYA 3LG6A 3WYWA 3D4TA 11GSA 3CBUA 2VM2A 2MBSA 1TU7A 3HCZA 2WCIA 2A4VA 3FR9A 5AGYA 1HQOA 3D5JA 3EWLA 3FYGA 8GSSA 2AAWA 5DCHA 4X0XA 1Z7PA 2OT3A 3KTLA 1VF2A 1NHYA 4XCSA 2QGVA 6GSWA 3L0HA 1TRUA 3J7Yb 2HYXA 4ULXA 3PR8A 2FWHA 2PERA 3I6AA 5J40A 2GZZA 6GSSA 3KP8A 4GQFA 3VWVA 9GSSA 4HSCX 12GSA 1FB0A 3EU4A 2K6VA 1SVOA 1O73A 2YNXA 3BBYA 3EINA 2R2JA 2REMA 1FOVA 2VKZG 2L4CA 2M72A 3KMOA 4KW6A 2XBIA 4PGTA 1GSEA 4BIKA 4PUAA 2YJHA 1F2EA 1HD2A 2JADA 2PUKC 3APOA 1PN0A 4Z2RA 5HQPA 5ID2B 3LXTA 5DALB 3IHGA 5ELAA 1Z7RA 1MDKA 1PN9A 2EFCA 2X4AA 5DJMA 1ZOFA 2P5RA 3F3QA 3GFKA 3RHCA 5KN2A 2H0GA 2HSNB 2HSMB 3HKRA 1M3JA 3RAZA 4IGJA 4F82A 4KCEA 5G1KA 3ZRDA 4MABA 1SJ6A 5D73A 1YEXA 4MLYA 3TKSE 3FMWA 2H73A 1ILOA 3KMNA 4NHWA 1R4WA 1UVZA 1X9MB 2H6ZA 1GNWA 2DIYA 1W4VA 2R0CA 22GSA 2GS3A 2WJUA 4HQZA 4OO5A 4P3YB 5ECOB 4Q5RA 1O8XA 4MH2A 4OFTA 1PA3A 3GYKA 4HJ2A 1TKDB 4N30A 1ZYNA 4GXZA 2VO4A 1SYRA 3FZ9A 5F0GA 4TXOB 5G1LA 2O5VA 2QC7A 5KN0A 5BRTA 3GSTA 1AIUA 1JLVA 5ECRB 2C1YA 2I1UA 2ALBA 1I1IP 4HDEA 5J9CA 4EUYA 4RI6A 4JU5A 1VF3A 2O7KA 3HZ4A 2WVYA 4MDCA 3E9JB 2GSSA 3GL5A 1U88A 4G01A 3I69A 2VLUA 1GP1A 1EZKA 5C00A 3IAS2 5DAKB 1XBSA 2YN1A 4YQUA 1AXDA 3LYPA 4XRDA 3TKQA 3D0ZA 3KM6A 1U6TA 2CZ3A 3MYDA 1F3AA 3VPTA 3KP9A 1Y1UA 4I5QA 3G7JA 5ECHB 4HUAA 2H76A 4TVEA 1BYEA 2E0QA 4DSRA 1ZYQB 5HR1A 3UBKA 1TDIA 3IAM2 1JFUA 3DEXA 5CP1A 4ZL7A 4K7IA 1SL0B 1PKZA 3ZFLA 4LMVA 4LL4B 3F8UA 3ZYWA 2E7PA 5IOXA 4BL7B 2N5AA 2D2ZA 3GH9A 3TDGA 5IO2A 4NV2A 2GSQA 3N9JA 2HNLA 1OE8A 4MPGA 3DWVA 3TRXA 2FWEA 5KOWA 4KGIA 2R4VA 3QPMA 3F3RA 4HU9A 2A2PA 2B6MA 4L0WA 1EP7A 1MEKA 1SJZA 3D21A 3I43A 1PMTA 2HFDA 1Z9HA 4EIPA 4YQMA 3H8QA 2YJ7A 3TCOA 1M0UA 4CY8A 3H1NA 1T8EB 2H30A 2WGRA 2VLTA 1GSSA 2R0PA 1PL1A 3A3TA 2IJYA 2M46A 1K0AA 1HYUA 2YWIA 1ZYPA 1G7EA 13GSA 4MJBA 1OC9A 2AV4A 3K8NA 4QL7A 5G2ZA 1SJIA 1M9BA 2F8AA 4MA9A 4N11A 5HR3A 2YZUA 2LSTA 1M2AA 3GH6A 3SBCA 2CVDA 5D93A 2MYGA 4AKIA 2CVBA 1A0FA 2L4QA 4XIHA 5B6NA 3RPNA 3VWXA 3C7MA 4KE3A 2FGXA 4I8BA 4Z7XA 4TN8A 4CY6A 2PMTA 4KAEA 3C8EA 3IC8A 1TXXA 5HFGA 4LA1A 4KF9A 4JE1A 2EFHA 4BWQA 2PGTA 2TIRA 1VRSD 5A34A 4AF2A 1SKSB 2VD1A 4IKHA 3EMPA 4I2UA 5B7CA 4OMVA 2B5EA 2FA8A 4N0VA 3GTUA 2LJAA 4G0LA 2WW0A 1QQ2A 4POMA 3ZVJD 2P31A 1YVLA 1V9WA 4ZB9A 1O8WA 3Q18A 4KCAA 2YANA 1I9DA 1N25A 2H72A 5HR0A 3KH9A 2B1LA 2H1AA 5IMDA 1USBA 2OBIA 2ZCTA 2F3MA 5DQYA 5GAPD 3WT1A 1K3OA 1Y25A 1TK0B 2FHEA 5A5KA 3EMXA 5J4VA 2O87A 4NMUA 4GRFA 2X8CA 2WZ9A 5HFKA 3TB2A 2VCZA 1EOGA 1AAZA 1R5AA 1M7TA 3RGBC 3A5IA 1X5DA 3ZTLA 3MWHA 2LS5A 1EGRA 3TKSA 2XPEA 3PGTA 3HZ8A 3TRPA 2H0IA 4XS4B 3UOMA 3DRNA 3HJMA 3KIJA 1JHBA 1ST9A 1XPVA 3HJPA 1PX6A 3BOAA 3DGQA 2B7KA 1A2MA 2H19A 3FKFA 2YV7A 4JEDA 2XHFA 2O89A 1TTZA 1MDIA 4MJAA 1SVLA 4J56E 2IN3A 4RQRA 5IIZA 3LFLA 3F6DA 3QFBC 4WF5A 4K0GA 2EFDA 2V6OA 5IPGA 2A2SA 2HRFA 2PVOC 3RHBA 4AJ8A 2GSRA 2WVXA 2K18A 5ECMB 2HSYA 1A24A 1SL2B 5J9BA 2C4JA 3O76A 2G2QA 2XC2A 3UBLA 1G0TA 2V32A 2C8UA 5IMZA 5B8BA 3MNGA 4ZIJA 1GSUA 4ID0A 2OE1A 3I9V2 3M9JA 2HXKA 4RQXA 2FNOA 3LJRA 3S9FA 3J7Yk 1E2YA 1NHOA 4F9ZA 2KUCA 4JR6A 4D73B 5HFIA 2FA4A 1GSYA 4JR4A 4GSNA 3GA4A 4E68A 1QUWA 2H6YA 3UJ1A 1LU4A 1XWCA 2MMNA 2V1MA 2GTUA 2K8VA 3HYPA 1K0BA 3TUEA 10GSA 2LQQA 2LRNA 3UIWA 2X8HA 2E2GA 1X0RA 4LLRA 1ERWA 1A8YA 1WOUA 2LQOA 4ZB7A 3L9SA 1B4QA 5CNWA 2FLSA 5H5QA 2IMKA 5DCGA 2RLIA 1H75A 1V58A 4OFNA 2DJ1A 2IFQA 2LNSA 1EEMA 4FQUA 3QR6A 3WGXA 2VM1A 5GAND 3M3MA 1WP0A 4WKWA 2WDUA 2VOCA 3QCPA 3H79A 5LD0A 1GUKA 2KOKA 3R2QA 3C1SA 2V41A 5FT3A 3CSJA 1FOHA 4YKFA 1GTUA 1IYIA 1B48A 1LJRA 4HOJA 5CRHA 4IW9A 3W8JA 4D73A 2HLSA 5J4YA 4MJCA 2LJRA 2VCTA 2ZUPA 3EURA 1T1VA 2J9HA 3ZMKA 4AKHA 5IO0A 2CT6A 3A2WA 1VGLA 4OFMA 3CSIA 1TI1A 2F8FA 4TR3A 3E0UA 5D9VA 3L4NA 3TGZA 5LNKe 2VCXA 3WGEA 5A5HA 3GKNA 1FAAA 4MP4A 3DD3A 4N10A 1S3AA 2EIOA 2YWNA 5COHA 4WR5A 4ICYA 3GL3A 3QDNA 1CQGA 2A4HA 5KEJA 3IE3A 4WETA 3NIVA 3ED3A 2OKAA 2F9SA 1GRXA 2XBQA 4EE0A 5ELGA 1SD9A 1UA5A 1ZMAA 3W8SA 4H86A 4ML6A 2VL2C 5J5NA 1WE0A 5IMCA 1F3BA 2HZFA 2DSAA 4IELA 1CQHA 2OE3A 3UMAA 2H01A 3IK9A 2IMFA 1Z3EA 1WJKA 3W6GA 1F9MA 1XW9A 4V2LA 3F0IA 4OD7A 1A8LA 4EKZA 1BAYA 1XWAA 2KP2A 4JRRA 3LSZA 1AQXA 3VK9A 4K9ZA 2GQMA 2MBTA 1MD4A 2NTOA 2DMMA 6GSXA 1RW1A 1MTCA 4EC0A 1NW2A 2ON7A 4W66A 5KN1A 4BVXA 1EV9A 1MD3A 4Q5NA 2QSIA 3RFRC 2QKEA 4IP1A 2BTOT 5CREA 4MNNA 1A2LA 1PD21 1ZL9A 3DXBA 4ZBBA 1B9XC 3CWGA 4MCUA 1XOAA 5IPHA 3R3EA 3CRTA 5JWOB 1TP9A 5A4WA 1O85A 1OC9B 3QAVA 2O3EA 3C73A 1GSQA 1X9WB 1PQNA 4EO3A 5J4UA 3GX8A 4HU7A 1TI3A 4O32A 1IYHA 5CRGA 5JWQB 4V1Ag 1SK0A 4V2MA 1GUHA 5J47A 3LYKA 4GSTA 2JZSA 4AGSA 2VCVA 5GSTA 4KA0A 1TJDA 3ZVJA 4O92A 1GNEA 4AKXB 4PUFC 1FVKA 4MZBA 3VI5A 4BA7A 1M2BA 2DJJA 2L5LA 2PVQA 1HNCA 3IHQA 1WRYA 2J23A 2KLXA 1BF5A 4KDYA 2AYTA 1TRWA 5A34B 3WT2A 1RQMA 1FVJA 3NZNA 4PURA 1A0RP 2C0FA 2R0GA 3LEFA 1U3IA 5JCUA 3IV4A 3IC4A 2C0EA 4MPFA 3TJJA 3F6FA 2R5GA 3E3EA 3HD5A 2E2MA 3GTUB 2IMDA 1UC7A 3U5RE 2C3TA 3ISOA 1WPIA 4YH2A 2CV4A 3P2AA 2DJ2A 1XVQA 1NSWA 4TKYA 1BEDA 3ZMLA 1T3BA 4GQCA
chains in the Genus database with same CATH topology
4O5UA 4MZWA 4GDFA 5GZZB 2YCDA 1OE7A 5F06A 3KCMA 3TJKA 2GQLA 2EIRA 1MDJA 6GSVA 1SKRB 2H66A 1K3YA 2XPDA 4RI7A 5DDLA 3BJ5A 2IMEA 2VL9A 2H70A 4POBA 2NDOA 4XRAA 4ZILA 3Q6OA 3M8NA 4JBBA 1Z6NA 5D96A 3LQ7A 3GKMA 3VI7A 5F8BA 2O8VB 3L9VA 4AJ7A 1DUGA 1ZGNA 5AN1A 4FYUA 2DJ3A 4K1FA 1FG4A 2PU9C 2ZNMA 3P7XA 1XCCA 3F4RA 4PXOA 4IVFA 3ME8A 1YY7A 1XW5A 1OC8A 1GWCA 1ML6A 6GSYA 4AI6A 4MJEA 3Q74A 5D9WA 5F05A 2H75A 4MMMA 4K2DA 4EVMA 4QL9A 1T7PB 1KEBA 3HVSA 3ZREA 3ZLPA 3A2XA 2B5YA 4K5RA 1X9SB 4HJMA 4TR4A 1ZZYA 16GSA 4G2EA 2DC5A 3IDVA 2JU5A 4G0KA 4K2XA 4FO5A 2C0DA 3O6TA 5G30A 4BWSA 1A2JA 1TRSA 2P5QA 2LRTA 2FD3A 3F4TA 1J9BA 3FZ5A 4KNDA 3KXOA 3TOTA 19GSA 2M80A 2PN8A 1B9YC 5CYYA 3FY7A 2CVKA 4KH7A 1XFLA 2X49A 3TU3B 4IHUA 5B6MA 2H8LA 1SU9A 3ZIJA 2FWGA 3VWWA 4DVCA 1M99A 3HDCA 4IS0A 1G7OA 3UARA 4WBJA 1TU8A 3IOSA 3UL3A 4ZBDA 2HRAA 1RK4A 4K7NA 1WMJA 2K9FA 2QA2A 3NOFA 2DIZA 2LJKA 4L0UA 3P90A 2OACA 2L6CA 2UZ8A 5ECNB 2DJ0A 1KBNA 2RM5A 2QA1A 1EP8A 5CRWA 1OKDA 1PSQA 1OAZA 4YQVA 1T00A 4I97A 3EYTA 4G19A 2CAQA 4HZ2A 3BCIA 5IMVA 3ZIVA 1PKWA 3KD0A 5ENUA 3LORA 3ZITA 4ZL8A 3QFAC 4PQIA 3P8WA 2FUG2 5ECKB 4PQ1A 2CA8A 3KGKA 3FZAA 1FHEA 1SKWB 3JCML 2B7JA 4IJIA 5E59A 2IMIA 2IFQB 4XHMA 2GT6A 1XXUA 2HRKA 4FYCA 4ZL9A 2TRXA 4TR1A 4QMKA 3RBTA 4IN0A 4ILFA 3WGDA 2WRTA 2N5BA 2RIIA 3ERWA 2JZTA 2FWFA 1SL1B 4ACSA 2WULA 4N3ZA 2YP6A 1K0DA 4WXTA 1ACVA 3M9KA 2MMZA 3IA1A 2H1DA 3D22A 3A5WA 1SK1A 3GIXA 2V6KA 4TRXA 2DMLA 2LEGA 1Q98A 3MDKA 3L9UA 1TRVA 2IWTA 1HNAA 3GV1A 2MMOA 5G31A 2O85A 2H74A 3M1GA 5AISA 2OJLA 1AUCA 4CDOA 2GZYA 5BMUA 5IMFA 4ECBA 3KH7A 4ECJA 3U6VA 1XVWA 4EF0A 1F6MC 1FB6A 2X8GA 4ZB6A 1JZRA 1K0MA 3DKSA 2EIQA 2GSTA 1ABAA 2AUVA 5AIXA 3FHKA 1YKAA 5A5HB 2DBCA 2L6DA 4QQ7A 4TW5A 3HHVA 2AHEA 1OKTA 5A1NB 1WIKA 2UV8G 2RM6A 1V40A 2B3SA 3QAGA 4G10A 1V98A 3ERGA 4N0ZA 3BD2A 3QMXA 3VURA 3N5OA 1KNGA 4TOPA 1EWXA 3CYNA 4L5LA 1SVMA 6GSUA 1UN2A 5CO3A 3OR5A 3UEMA 4DSSA 4AKGA 2B1KA 1U3AA 4K8MA 3GMFA 3LW9A 4PX1A 4X4JA 2IIYA 3GX0A 1VF1A 3CMIA 3QAWA 1I5GA 4E8EA 2YOIA 2VL2A 3MIXA 5IMAA 2Z9SA 2BJXA 2V2GA 4L5OA 2VUPA 2GQKA 6GSTA 5E4WA 2VL3A 3RPPA 1R5PA 4IQ1A 1YZXA 3CRUA 2NPBA 1EEJA 2JL4A 3C71A 4WEYA 2CX3A 2H1GA 2KP1A 3D6IA 4EIQA 1K3LA 1K0CA 1ERTA 4BVXB 4F03A 1G6WA 2YPMA 1AQVA 2GVPA 2IPAA 2VD0A 4NAXA 3CSHA 1EGOA 4O5RA 3EVIA 4X43A 4ML1A 4BVYA 1EV4A 4HQSA 2YV9A 3AY8A 4K7OA 3DYRA 4K5SA 3IPZA 2OE0A 2AJQB 5A4VA 4TXVA 5A1NA 3MSZA 3F63A 1PRXA 4L8EA 4YAPA 1BG5A 5ECPB 3DIEA 3GKXA 2JSZA 1S3CA 4IQAA 2C80A 3KTBA 2LRCA 3IBHA 3BCKA 3VWUA 4WR4A 2C3QA 2B5XA 2NBSA 2CAIA 4NXIA 1TW9A 1Z6MA 1ZYEA 4IP6A 1SYXA 3TJGA 4POLA 1YF0A 1DBYA 3H4KA 2LV3A 4F0BA 1PL2A 1PGTA 2NVLA 1OYJA 4JZQA 3MAKA 4HZ4A 4NHZA 1JZWA 5ABRA 5GSSA 4IJ3A 1QGVA 4PNGA 4FIWA 1V2AA 2L59A 1OC3A 5D9TA 4ECCA 1YJ6A 2AB6A 2H71A 4GLTA 4AJ6A 4RUVA 2H0HA 4OCFA 1XZOA 1JZDA 2EFEA 4OCEA 2HZEB 3FW2A 1GTIA 3FEUA 2VAFA 1W89A 3ERFA 2HRNA 2CQ9A 2WB9A 2JZRA 4HI7A 1FO5A 2I9HA 1ERVA 4X1UA 4HEA2 4E8HA 4F0CA 1ERUA 1AC1A 2LNTA 3Q19A 1QXHA 5ECSA 2X64A 5ID2A 1J08A 4HS1A 3TOUA 5DALA 1B8XA 3FZ4A 4ZBAA 5H5RA 20GSA 2I81A 4FH8A 4FYBA 2GZPA 4XS6A 1EOHA 1K0NA 3GNJA 2OA7A 3WD6A 5JCWA 2HSNA 2VCQA 2HSMA 4GSSA 2YZHA 5H5SA 2TRCP 5DQSA 3G9BA 4ISDA 3G7YA 3CXGA 4ZB8A 2EC4A 2FCHA 3FR6A 3G7IA 1Q4JA 2R6KA 2HI7A 5JCGA 3IR4A 1O6JA 4F2IA 1O81A 3FRCA 3TJBA 1GULA 2OADA 2WS2A 5EY6A 4OO4A 3PH9A 3ZFBA 2I4AA 4WBRD 4LL1B 4PNFA 1GTAA 4KSMA 5IOWA 1NM3A 3HJOA 5EPFA 4TXOA 1XIYA 2BMXA 3APQA 2R37A 2RUEA 1K0OA 4Z2TA 5J41A 2HZEA 17GSA 3IXRA 5B8AA 3VFIA 5CAXA 1G6YA 2JSYA 5AIVA 4YKGA 2DJKA 2JACA 5J3RA 4KSOA 1BQ7A 3ME7A 4NPBA 1J0FA 1THOA 5DAKA 5KOXA 2OBKA 1TK8B 2VIMA 3EE2A 5JWRB 3KJYA 1H4OA 5F07A 2YWMA 1FW1A 1X5EA 2DLXA 1U87A 1YKCA 1XWBA 3TKRA 3QOUA 2R3XA 2L5OA 2PWJA 1N2AA 2GLRA 2A2RA 4MF7A 3ZL5A 2C0GA 4NWYA 1T4ZA 2GGTA 1TOFA 2H1BA 4TR0A 1SD8A 2VCWA 3PPUA 2C3NA 2ES7A 2K8SA 1SK2A 4NV5A 4WF4A 4I2TA 1C72A 3TJFA 4BL7A 2P0GA 1ON4A 4K6XA 4IBPA 5G5EA 1GSDA 2X99A 2HQTA 2IL3A 1N8JA 1YF1A 3DVWA 3KZQA 1DE1A 4YAVA 2G0FA 4G0IA 3IRAA 1GLPA 4MF5A 3HA9A 3GN3A 3US3A 1Y6EA 2HE3A 4Z2UA 2F51A 1XW6A 2HRKB 2YWOA 1GSFA 4TR1B 3GHAA 4Q5QA 4CHSA 2PPTA 1XWGA 14GSA 4V1Ap 1URMA 1TK5B 1BG1A 2CZ2A 1YDKA 4MK3A 2GDRA 2H1LA 1M9AA 18GSA 4O5QA 3HVXA 2KHPA 2GT5A 5C04A 5DJLA 1XOBA 5DBQA 3EU3A 3L78A 3V1WA 5KN3A 2MZCA 3O3TA 2I3YA 1T4YA 3FK8A 2DKIA 5IM9A 3TKPA 4MZCA 4GCIA 1GH2A 1QMVA 1R7HA 4K0NA 1KTEA 3HVVA 3H93A 1GLQA 1S3DA 4KB3A 1PX7A 3HY2A 1HNBA 2CX4A 5DVBA 4G9HA 5BMUB 3IK7A 2H6XA 3TRQA 3GSSA 2VLVA 4DSQA 5D9XA 1A23A 2RUFA 3UVTA 3C1RA 3GKKA 4ZXGA 3D4MA 4GF0A 3SWLA 3DVXA 4O7HA 4J2FA 2LTKA 1GL8A 4EXJA 4CW9A 4KX4A 1DE2A 1QK8A 3EC3A 2L57A 2LUSA 5D8IA 4KDXA 5ECQB 1X5CA 2WFCA 5FHIA 3LGCA 2ON5A 1THXA 1E6BA 4XS1A 3HMJG 3A2VA 4KUNA 3VPQA 3M0FA 4DSSB 4J57E 1AQWA 1VF4A 4OWYA 1GUMA 4USSA 4GWRA 4MH3A 5G5FA 4XTSA 4V2NA 2PBJA 2DKHA 5ECLB 1YQ1A 2N5FA 1XWKA 1Z5YE 3CTFA 3LXZA 1ZCPA 4EL1A 3GUSA 3DMLA 5HR2A 4KDUA 5LCZA 2LKUA 3QD9A 1BX9A 3GURA 3TKSC 5EL8A 5EVOA 5L71A 4LMWA 4GTUA 5CRDA 4POKA 5ECIB 3CTGA 1TXUA 3UVHA 4I6XA 3VLNA 4DEJA 4Q5FA 4MF6A 1V57A 1M2DA 4PQHA 3FR3A 7GSSA 2HT9A 4PTSA 1JZOA 1YEPA 4XS4A 3LWAA 1DSBA 3GRXA 3F4SA 1WWJA 3UAPA 4ECIA 4BVYB 3F9UA 1AW9A 2FY6A 1BJXA 3PINA 5A4UA 1GTBA 2HSHA 3HXSA 3EPTA 2MMAA 5IQYA 1JLWA 1SENA 1B4PA 3RDWA 4BPYA 3ZZXA 5FWGA 1O7UA 1OVNA 5INYA 1R26A 1QFNA 1F37A 4A5PA 3KEBA 3APSA 4EDZA 1LBKA 4EDYA 3LG6A 3WYWA 3D4TA 11GSA 3CBUA 2VM2A 2MBSA 1TU7A 3HCZA 2WCIA 2A4VA 3FR9A 5AGYA 1HQOA 3D5JA 3EWLA 3FYGA 8GSSA 2AAWA 5DCHA 4X0XA 1Z7PA 2OT3A 3KTLA 1VF2A 1NHYA 4XCSA 2QGVA 6GSWA 3L0HA 1TRUA 3J7Yb 2HYXA 4ULXA 3PR8A 2FWHA 2PERA 3I6AA 5J40A 2GZZA 6GSSA 3KP8A 4GQFA 3VWVA 9GSSA 12GSA 1FB0A 3EU4A 2K6VA 1SVOA 1O73A 2YNXA 3BBYA 3EINA 2R2JA 2REMA 1FOVA 2VKZG 2L4CA 2M72A 3KMOA 4KW6A 2XBIA 4PGTA 1GSEA 4PUAA 2YJHA 1F2EA 1HD2A 2JADA 2PUKC 3APOA 1PN0A 4Z2RA 5HQPA 5ID2B 3LXTA 5DALB 3IHGA 5ELAA 1Z7RA 1MDKA 1PN9A 2EFCA 2X4AA 5DJMA 1ZOFA 2P5RA 3F3QA 3GFKA 3RHCA 5KN2A 2H0GA 2HSNB 2HSMB 3HKRA 3RAZA 4IGJA 4F82A 4KCEA 5G1KA 3ZRDA 4MABA 1SJ6A 5D73A 1YEXA 4MLYA 3TKSE 3FMWA 2H73A 1ILOA 3KMNA 4NHWA 1R4WA 1UVZA 1X9MB 2H6ZA 1GNWA 2DIYA 1W4VA 2R0CA 22GSA 2GS3A 2WJUA 4HQZA 4OO5A 4P3YB 5ECOB 4Q5RA 1O8XA 4MH2A 4OFTA 1PA3A 3GYKA 4HJ2A 1TKDB 4N30A 1ZYNA 4GXZA 2VO4A 1SYRA 3FZ9A 5F0GA 4TXOB 5G1LA 2O5VA 2QC7A 5KN0A 5BRTA 3GSTA 1AIUA 1JLVA 5ECRB 2C1YA 2I1UA 2ALBA 4HDEA 5J9CA 4EUYA 4RI6A 4JU5A 1VF3A 2O7KA 3HZ4A 4MDCA 3E9JB 2GSSA 3GL5A 1U88A 4G01A 3I69A 2VLUA 1GP1A 1EZKA 5C00A 3IAS2 5DAKB 1XBSA 2YN1A 4YQUA 1AXDA 3LYPA 4XRDA 3TKQA 3D0ZA 3KM6A 1U6TA 2CZ3A 3MYDA 1F3AA 3KP9A 3VPTA 1Y1UA 4I5QA 3G7JA 5ECHB 4HUAA 2H76A 4TVEA 1BYEA 2E0QA 4DSRA 1ZYQB 5HR1A 3UBKA 1TDIA 3IAM2 1JFUA 3DEXA 5CP1A 4ZL7A 4K7IA 1SL0B 1PKZA 3ZFLA 4LMVA 4LL4B 3F8UA 3ZYWA 2E7PA 5IOXA 4BL7B 2N5AA 2D2ZA 3GH9A 3TDGA 5IO2A 4NV2A 2GSQA 3N9JA 2HNLA 1OE8A 4MPGA 3DWVA 3TRXA 2FWEA 5KOWA 4KGIA 2R4VA 3QPMA 3F3RA 4HU9A 2A2PA 2B6MA 4L0WA 1EP7A 1MEKA 1SJZA 3D21A 3I43A 1PMTA 2HFDA 1Z9HA 4EIPA 4YQMA 3H8QA 2YJ7A 3TCOA 1M0UA 4CY8A 3H1NA 1T8EB 2H30A 2WGRA 2VLTA 1GSSA 2R0PA 1PL1A 3A3TA 2IJYA 2M46A 1K0AA 1HYUA 2YWIA 1ZYPA 1G7EA 13GSA 4MJBA 1OC9A 2AV4A 3K8NA 4QL7A 5G2ZA 1SJIA 1M9BA 2F8AA 4MA9A 4N11A 5HR3A 2YZUA 2LSTA 1M2AA 3GH6A 3SBCA 2CVDA 5D93A 2MYGA 4AKIA 2CVBA 1A0FA 2L4QA 4XIHA 5B6NA 3RPNA 3VWXA 3C7MA 4KE3A 2FGXA 4I8BA 4Z7XA 4TN8A 4CY6A 2PMTA 4KAEA 3C8EA 3IC8A 1TXXA 5HFGA 4LA1A 4KF9A 4JE1A 2EFHA 4BWQA 2PGTA 2TIRA 1VRSD 5A34A 4AF2A 1SKSB 2VD1A 4IKHA 3EMPA 4I2UA 5B7CA 4OMVA 2B5EA 2FA8A 4N0VA 3GTUA 2LJAA 4G0LA 1QQ2A 4POMA 3ZVJD 2P31A 1YVLA 1V9WA 4ZB9A 1O8WA 3Q18A 4KCAA 2YANA 1I9DA 1N25A 2H72A 5HR0A 3KH9A 2B1LA 2H1AA 5IMDA 1USBA 2OBIA 2ZCTA 2F3MA 5DQYA 5GAPD 3WT1A 1K3OA 1Y25A 1TK0B 2FHEA 5A5KA 3EMXA 5J4VA 2O87A 4NMUA 4GRFA 2X8CA 2WZ9A 5HFKA 3TB2A 2VCZA 1EOGA 1AAZA 1R5AA 1M7TA 3A5IA 1X5DA 3ZTLA 3MWHA 2LS5A 1EGRA 3TKSA 2XPEA 3PGTA 3HZ8A 3TRPA 2H0IA 4XS4B 3UOMA 3DRNA 3HJMA 3KIJA 1JHBA 1ST9A 1XPVA 3HJPA 1PX6A 3BOAA 3DGQA 2B7KA 1A2MA 2H19A 3FKFA 2YV7A 4JEDA 2XHFA 2O89A 1TTZA 1MDIA 4MJAA 1SVLA 4J56E 2IN3A 4RQRA 5IIZA 3LFLA 3F6DA 3QFBC 4WF5A 4K0GA 2EFDA 2V6OA 5IPGA 2A2SA 2HRFA 2PVOC 3RHBA 4AJ8A 2GSRA 2K18A 5ECMB 2HSYA 1A24A 1SL2B 5J9BA 2C4JA 3O76A 2G2QA 2XC2A 3UBLA 1G0TA 2V32A 2C8UA 5IMZA 5B8BA 3MNGA 4ZIJA 1GSUA 4ID0A 2OE1A 3M9JA 3I9V2 2HXKA 4RQXA 2FNOA 3LJRA 3S9FA 3J7Yk 1E2YA 1NHOA 4F9ZA 2KUCA 4JR6A 4D73B 5HFIA 2FA4A 1GSYA 4JR4A 4GSNA 3GA4A 4E68A 1QUWA 2H6YA 3UJ1A 1LU4A 1XWCA 2MMNA 2V1MA 2GTUA 2K8VA 3HYPA 1K0BA 3TUEA 10GSA 2LQQA 2LRNA 3UIWA 2X8HA 2E2GA 1X0RA 4LLRA 1ERWA 1A8YA 1WOUA 2LQOA 4ZB7A 3L9SA 1B4QA 5CNWA 2FLSA 5H5QA 2IMKA 5DCGA 2RLIA 1H75A 1V58A 4OFNA 2DJ1A 2IFQA 2LNSA 1EEMA 4FQUA 3QR6A 3WGXA 2VM1A 5GAND 3M3MA 1WP0A 4WKWA 2WDUA 2VOCA 3QCPA 3H79A 5LD0A 1GUKA 2KOKA 3R2QA 3C1SA 2V41A 5FT3A 3CSJA 1FOHA 4YKFA 1GTUA 1IYIA 1B48A 1LJRA 4HOJA 5CRHA 4IW9A 3W8JA 4D73A 2HLSA 5J4YA 4MJCA 2LJRA 2VCTA 2ZUPA 3EURA 1T1VA 2J9HA 3ZMKA 4AKHA 5IO0A 2CT6A 3A2WA 1VGLA 4OFMA 3CSIA 1TI1A 2F8FA 4TR3A 3E0UA 5D9VA 3L4NA 3TGZA 5LNKe 2VCXA 3WGEA 5A5HA 3GKNA 1FAAA 4MP4A 3DD3A 4N10A 1S3AA 2EIOA 2YWNA 5COHA 4WR5A 4ICYA 3GL3A 3QDNA 1CQGA 2A4HA 5KEJA 3IE3A 4WETA 3NIVA 3ED3A 2OKAA 2F9SA 1GRXA 2XBQA 4EE0A 5ELGA 1SD9A 1UA5A 1ZMAA 3W8SA 4H86A 4ML6A 2VL2C 5J5NA 1WE0A 5IMCA 1F3BA 2HZFA 2DSAA 4IELA 1CQHA 2OE3A 3UMAA 2H01A 3IK9A 2IMFA 1Z3EA 1WJKA 3W6GA 1F9MA 1XW9A 4V2LA 3F0IA 4OD7A 1A8LA 4EKZA 1BAYA 1XWAA 2KP2A 4JRRA 3LSZA 1AQXA 3VK9A 4K9ZA 2GQMA 2MBTA 1MD4A 2NTOA 2DMMA 6GSXA 1RW1A 1MTCA 4EC0A 1NW2A 2ON7A 4W66A 5KN1A 4BVXA 1EV9A 1MD3A 4Q5NA 2QSIA 2QKEA 4IP1A 2BTOT 5CREA 4MNNA 1A2LA 1PD21 1ZL9A 3DXBA 4ZBBA 1B9XC 3CWGA 4MCUA 1XOAA 5IPHA 3R3EA 3CRTA 5JWOB 1TP9A 5A4WA 1O85A 1OC9B 3QAVA 3C73A 1GSQA 1X9WB 1PQNA 4EO3A 5J4UA 3GX8A 4HU7A 1TI3A 4O32A 1IYHA 5CRGA 5JWQB 4V1Ag 1SK0A 4V2MA 1GUHA 5J47A 3LYKA 4GSTA 2JZSA 4AGSA 2VCVA 5GSTA 4KA0A 1TJDA 3ZVJA 4O92A 1GNEA 4AKXB 4PUFC 1FVKA 4MZBA 3VI5A 4BA7A 1M2BA 2DJJA 2L5LA 2PVQA 1HNCA 3IHQA 1WRYA 2J23A 2KLXA 1BF5A 4KDYA 2AYTA 1TRWA 5A34B 3WT2A 1RQMA 1FVJA 3NZNA 4PURA 1A0RP 2C0FA 2R0GA 3LEFA 1U3IA 5JCUA 3IV4A 3IC4A 2C0EA 4MPFA 3TJJA 3F6FA 2R5GA 3E3EA 3HD5A 2E2MA 3GTUB 2IMDA 1UC7A 3U5RE 2C3TA 3ISOA 1WPIA 4YH2A 2CV4A 3P2AA 2DJ2A 1XVQA 1NSWA 4TKYA 1BEDA 3ZMLA 1T3BA 4GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZW A;  5GZZ B;  2YCD A;  1OE7 A;  5F06 A;  3KCM A;  3TJK A;  2GQL A;  2EIR A;  1MDJ A;  6GSV A;  1SKR B;  2H66 A;  1K3Y A;  2XPD A;  4RI7 A;  5DDL A;  3BJ5 A;  2IME A;  2VL9 A;  2H70 A;  4POB A;  2NDO A;  4XRA A;  4ZIL A;  3Q6O A;  3M8N A;  4JBB A;  1Z6N A;  5D96 A;  3LQ7 A;  3GKM A;  3VI7 A;  5F8B A;  2O8V B;  3L9V A;  4AJ7 A;  1DUG A;  1ZGN A;  5AN1 A;  4FYU A;  2DJ3 A;  4K1F A;  1FG4 A;  2PU9 C;  2ZNM A;  3P7X A;  1XCC A;  3F4R A;  4PXO A;  4IVF A;  3ME8 A;  1YY7 A;  1XW5 A;  1OC8 A;  1GWC A;  1ML6 A;  6GSY A;  4MJE A;  3Q74 A;  5D9W A;  5F05 A;  2H75 A;  4MMM A;  4K2D A;  4EVM A;  4QL9 A;  1T7P B;  1KEB A;  3HVS A;  3ZRE A;  3ZLP A;  3A2X A;  2B5Y A;  1X9S B;  4HJM A;  4TR4 A;  1ZZY A;  16GS A;  4G2E A;  2DC5 A;  3IDV A;  2JU5 A;  4G0K A;  4FO5 A;  2C0D A;  3O6T A;  5G30 A;  4BWS A;  1A2J A;  1TRS A;  2P5Q A;  2LRT A;  2FD3 A;  3F4T A;  1J9B A;  3FZ5 A;  4KND A;  3KXO A;  3TOT A;  19GS A;  2M80 A;  2PN8 A;  1B9Y C;  5CYY A;  3FY7 A;  2CVK A;  4KH7 A;  1XFL A;  4IHU A;  5B6M A;  2H8L A;  1SU9 A;  3ZIJ A;  2FWG A;  3VWW A;  4DVC A;  1M99 A;  3HDC A;  4IS0 A;  1G7O A;  3UAR A;  4WBJ A;  1TU8 A;  3IOS A;  3UL3 A;  4ZBD A;  2HRA A;  1RK4 A;  4K7N A;  1WMJ A;  2K9F A;  3NOF A;  2DIZ A;  2LJK A;  4L0U A;  3P90 A;  2OAC A;  2L6C A;  2UZ8 A;  5ECN B;  2DJ0 A;  1KBN A;  2RM5 A;  1EP8 A;  5CRW A;  1OKD A;  1PSQ A;  1OAZ A;  4YQV A;  1T00 A;  4I97 A;  3EYT A;  4G19 A;  2CAQ A;  4HZ2 A;  3BCI A;  5IMV A;  3ZIV A;  1PKW A;  3KD0 A;  5ENU A;  3LOR A;  3ZIT A;  4ZL8 A;  3QFA C;  4PQI A;  3P8W A;  2FUG 2;  5ECK B;  4PQ1 A;  2CA8 A;  3KGK A;  3FZA A;  1FHE A;  1SKW B;  3JCM L;  2B7J A;  4IJI A;  5E59 A;  2IMI A;  2IFQ B;  4XHM A;  2GT6 A;  1XXU A;  2HRK A;  4FYC A;  4ZL9 A;  2TRX A;  4TR1 A;  3RBT A;  4IN0 A;  4ILF A;  3WGD A;  2WRT A;  2N5B A;  2RII A;  3ERW A;  2JZT A;  2FWF A;  1SL1 B;  4ACS A;  2WUL A;  2YP6 A;  1K0D A;  4WXT A;  1ACV A;  3M9K A;  2MMZ A;  3IA1 A;  2H1D A;  3D22 A;  3A5W A;  1SK1 A;  3GIX A;  2V6K A;  4TRX A;  2DML A;  2LEG A;  1Q98 A;  3MDK A;  3L9U A;  1TRV A;  2IWT A;  1HNA A;  3GV1 A;  2MMO A;  5G31 A;  2O85 A;  2H74 A;  3M1G A;  5AIS A;  2OJL A;  1AUC A;  4CDO A;  2GZY A;  5BMU A;  5IMF A;  4ECB A;  3KH7 A;  4ECJ A;  3U6V A;  1XVW A;  4EF0 A;  1F6M C;  1FB6 A;  2X8G A;  4ZB6 A;  1JZR A;  1K0M A;  3DKS A;  2EIQ A;  2GST A;  1ABA A;  2AUV A;  5AIX A;  3FHK A;  1YKA A;  2DBC A;  2L6D A;  4QQ7 A;  4TW5 A;  3HHV A;  2AHE A;  1OKT A;  1WIK A;  2RM6 A;  1V40 A;  2B3S A;  3QAG A;  4G10 A;  1V98 A;  3ERG A;  4N0Z A;  3BD2 A;  3QMX A;  3VUR A;  3N5O A;  1KNG A;  4TOP A;  1EWX A;  3CYN A;  4L5L A;  6GSU A;  1UN2 A;  5CO3 A;  3OR5 A;  3UEM A;  4DSS A;  2B1K A;  4K8M A;  1U3A A;  3GMF A;  4PX1 A;  2IIY A;  3GX0 A;  1VF1 A;  3CMI A;  3QAW A;  1I5G A;  4E8E A;  2YOI A;  2VL2 A;  5IMA A;  2Z9S A;  2BJX A;  2V2G A;  4L5O A;  2VUP A;  2GQK A;  6GST A;  5E4W A;  2VL3 A;  3RPP A;  1R5P A;  4IQ1 A;  1YZX A;  3CRU A;  2NPB A;  1EEJ A;  2JL4 A;  3C71 A;  4WEY A;  2CX3 A;  2H1G A;  2KP1 A;  3D6I A;  1K3L A;  1K0C A;  1ERT A;  4BVX B;  4F03 A;  1G6W A;  2YPM A;  1AQV A;  2GVP A;  2IPA A;  2VD0 A;  4NAX A;  3CSH A;  1EGO A;  4O5R A;  3EVI A;  4X43 A;  4ML1 A;  4BVY A;  1EV4 A;  4HQS A;  2YV9 A;  3AY8 A;  4K7O A;  3DYR A;  3IPZ A;  2OE0 A;  2AJQ B;  5A4V A;  4TXV A;  3MSZ A;  3F63 A;  1PRX A;  4L8E A;  4YAP A;  1BG5 A;  5ECP B;  3DIE A;  3GKX A;  2JSZ A;  1S3C A;  4IQA A;  2C80 A;  3KTB A;  2LRC A;  3IBH A;  3BCK A;  3VWU A;  4WR4 A;  2C3Q A;  2B5X A;  2NBS A;  2CAI A;  4NXI A;  1TW9 A;  1Z6M A;  1ZYE A;  4IP6 A;  1SYX A;  3TJG A;  4POL A;  1YF0 A;  1DBY A;  3H4K A;  2LV3 A;  4F0B A;  1PL2 A;  1PGT A;  2NVL A;  1OYJ A;  4JZQ A;  3MAK A;  4HZ4 A;  4NHZ A;  1JZW A;  5ABR A;  5GSS A;  4IJ3 A;  1QGV A;  4PNG A;  4FIW A;  1V2A A;  2L59 A;  1OC3 A;  5D9T A;  4ECC A;  1YJ6 A;  2AB6 A;  2H71 A;  4GLT A;  4AJ6 A;  4RUV A;  2H0H A;  4OCF A;  1XZO A;  1JZD A;  4OCE A;  2HZE B;  3FW2 A;  1GTI A;  3FEU A;  2VAF A;  1W89 A;  3ERF A;  2HRN A;  2CQ9 A;  2WB9 A;  2JZR A;  4HI7 A;  1FO5 A;  2I9H A;  1ERV A;  4X1U A;  4HEA 2;  4E8H A;  4F0C A;  1ERU A;  1AC1 A;  2LNT A;  3Q19 A;  1QXH A;  5ECS A;  2X64 A;  5ID2 A;  1J08 A;  4HS1 A;  3TOU A;  5DAL A;  1B8X A;  3FZ4 A;  4ZBA A;  5H5R A;  20GS A;  2I81 A;  4FH8 A;  4FYB A;  2GZP A;  4XS6 A;  1EOH A;  1K0N A;  3GNJ A;  2OA7 A;  3WD6 A;  5JCW A;  2VCQ A;  2HSM A;  4GSS A;  2YZH A;  5H5S A;  2TRC P;  5DQS A;  3G9B A;  4ISD A;  3G7Y A;  3CXG A;  4ZB8 A;  2EC4 A;  2FCH A;  3FR6 A;  3G7I A;  1Q4J A;  2R6K A;  2HI7 A;  5JCG A;  3IR4 A;  1O6J A;  4F2I A;  1O81 A;  3FRC A;  3TJB A;  1GUL A;  2OAD A;  2WS2 A;  5EY6 A;  4OO4 A;  3PH9 A;  3ZFB A;  2I4A A;  4WBR D;  4LL1 B;  4PNF A;  1GTA A;  4KSM A;  5IOW A;  1NM3 A;  3HJO A;  5EPF A;  4TXO A;  1XIY A;  2BMX A;  3APQ A;  2R37 A;  2RUE A;  1K0O A;  5J41 A;  2HZE A;  17GS A;  3IXR A;  5B8A A;  3VFI A;  5CAX A;  1G6Y A;  2JSY A;  5AIV A;  2DJK A;  2JAC A;  5J3R A;  4KSO A;  1BQ7 A;  3ME7 A;  4NPB A;  1J0F A;  1THO A;  5DAK A;  2OBK A;  1TK8 B;  2VIM A;  3EE2 A;  5JWR B;  3KJY A;  1H4O A;  5F07 A;  2YWM A;  1FW1 A;  1X5E A;  2DLX A;  1U87 A;  1YKC A;  1XWB A;  3TKR A;  3QOU A;  2R3X A;  2L5O A;  2PWJ A;  1N2A A;  2GLR A;  2A2R A;  4MF7 A;  3ZL5 A;  2C0G A;  4NWY A;  1T4Z A;  2GGT A;  1TOF A;  2H1B A;  4TR0 A;  1SD8 A;  2VCW A;  3PPU A;  2C3N A;  2ES7 A;  2K8S A;  1SK2 A;  4NV5 A;  4WF4 A;  4I2T A;  1C72 A;  3TJF A;  4BL7 A;  2P0G A;  1ON4 A;  4K6X A;  4IBP A;  5G5E A;  1GSD A;  2X99 A;  2HQT A;  2IL3 A;  1N8J A;  1YF1 A;  3DVW A;  3KZQ A;  1DE1 A;  4YAV A;  2G0F A;  4G0I A;  3IRA A;  1GLP A;  4MF5 A;  3HA9 A;  3GN3 A;  3US3 A;  1Y6E A;  2HE3 A;  2F51 A;  1XW6 A;  2HRK B;  2YWO A;  1GSF A;  4TR1 B;  3GHA A;  4Q5Q A;  4CHS A;  2PPT A;  1XWG A;  14GS A;  4V1A p;  1URM A;  1TK5 B;  2CZ2 A;  1YDK A;  4MK3 A;  2GDR A;  1M9A A;  18GS A;  3HVX A;  2KHP A;  2GT5 A;  5C04 A;  5DJL A;  1XOB A;  5DBQ A;  3EU3 A;  3L78 A;  3V1W A;  5KN3 A;  2MZC A;  3O3T A;  2I3Y A;  1T4Y A;  3FK8 A;  5IM9 A;  3TKP A;  4MZC A;  4GCI A;  1GH2 A;  1QMV A;  1R7H A;  4K0N A;  1KTE A;  3HVV A;  3H93 A;  1GLQ A;  1S3D A;  4KB3 A;  1PX7 A;  3HY2 A;  1HNB A;  2CX4 A;  5DVB A;  4G9H A;  3IK7 A;  2H6X A;  3TRQ A;  3GSS A;  2VLV A;  4DSQ A;  5D9X A;  1A23 A;  2RUF A;  3UVT A;  3C1R A;  3GKK A;  4ZXG A;  3D4M A;  4GF0 A;  3SWL A;  3DVX A;  4O7H A;  4J2F A;  2LTK A;  1GL8 A;  4EXJ A;  4CW9 A;  4KX4 A;  1DE2 A;  1QK8 A;  3EC3 A;  2L57 A;  2LUS A;  5D8I A;  4KDX A;  5ECQ B;  1X5C A;  2WFC A;  5FHI A;  3LGC A;  2ON5 A;  1THX A;  1E6B A;  4XS1 A;  3A2V A;  4KUN A;  3VPQ A;  3M0F A;  4DSS B;  4J57 E;  1AQW A;  1VF4 A;  4OWY A;  1GUM A;  4USS A;  4GWR A;  4MH3 A;  5G5F A;  4XTS A;  4V2N A;  2PBJ A;  5ECL B;  1YQ1 A;  2N5F A;  1XWK A;  1Z5Y E;  3CTF A;  3LXZ A;  1ZCP A;  4EL1 A;  3GUS A;  3DML A;  5HR2 A;  4KDU A;  5LCZ A;  2LKU A;  3QD9 A;  1BX9 A;  3GUR A;  3TKS C;  5EL8 A;  5EVO A;  5L71 A;  4LMW A;  4GTU A;  5CRD A;  4POK A;  5ECI B;  3CTG A;  3UVH A;  4I6X A;  3VLN A;  4DEJ A;  4Q5F A;  4MF6 A;  1V57 A;  1M2D A;  4PQH A;  3FR3 A;  7GSS A;  2HT9 A;  4PTS A;  1JZO A;  1YEP A;  4XS4 A;  3LWA A;  1DSB A;  3GRX A;  3F4S A;  1WWJ A;  3UAP A;  4ECI A;  4BVY B;  3F9U A;  1AW9 A;  2FY6 A;  1BJX A;  3PIN A;  5A4U A;  1GTB A;  2HSH A;  3HXS A;  2MMA A;  5IQY A;  1JLW A;  1SEN A;  1B4P A;  3RDW A;  4BPY A;  3ZZX A;  5FWG A;  1O7U A;  1OVN A;  5INY A;  1R26 A;  1QFN A;  1F37 A;  3KEB A;  3APS A;  4EDZ A;  1LBK A;  4EDY A;  3LG6 A;  3WYW A;  3D4T A;  11GS A;  3CBU A;  2VM2 A;  2MBS A;  1TU7 A;  3HCZ A;  2WCI A;  2A4V A;  3FR9 A;  5AGY A;  1HQO A;  3D5J A;  3EWL A;  3FYG A;  8GSS A;  2AAW A;  5DCH A;  4X0X A;  1Z7P A;  3KTL A;  1VF2 A;  1NHY A;  4XCS A;  2QGV A;  6GSW A;  3L0H A;  1TRU A;  3J7Y b;  2HYX A;  4ULX A;  3PR8 A;  2FWH A;  2PER A;  3I6A A;  2GZZ A;  6GSS A;  3KP8 A;  4GQF A;  3VWV A;  9GSS A;  12GS A;  1FB0 A;  3EU4 A;  2K6V A;  1O73 A;  2YNX A;  3BBY A;  3EIN A;  2R2J A;  2REM A;  1FOV A;  2L4C A;  2M72 A;  3KMO A;  4KW6 A;  2XBI A;  4PGT A;  1GSE A;  4PUA A;  2YJH A;  1F2E A;  1HD2 A;  2JAD A;  2PUK C;  3APO A;  5HQP A;  5ID2 B;  3LXT A;  5DAL B;  5ELA A;  1Z7R A;  1MDK A;  1PN9 A;  5DJM A;  1ZOF A;  2P5R A;  3F3Q A;  3GFK A;  3RHC A;  5KN2 A;  2H0G A;  2HSN B;  2HSM B;  3HKR A;  3RAZ A;  4IGJ A;  4F82 A;  4KCE A;  5G1K A;  3ZRD A;  4MAB A;  1SJ6 A;  5D73 A;  1YEX A;  4MLY A;  3TKS E;  2H73 A;  1ILO A;  3KMN A;  4NHW A;  1R4W A;  1UVZ A;  1X9M B;  2H6Z A;  1GNW A;  2DIY A;  1W4V A;  22GS A;  2GS3 A;  2WJU A;  4HQZ A;  4OO5 A;  4P3Y B;  5ECO B;  4Q5R A;  1O8X A;  4MH2 A;  4OFT A;  1PA3 A;  3GYK A;  4HJ2 A;  1TKD B;  4N30 A;  4GXZ A;  2VO4 A;  1SYR A;  3FZ9 A;  5F0G A;  4TXO B;  5G1L A;  2QC7 A;  5KN0 A;  3GST A;  1AIU A;  1JLV A;  5ECR B;  2C1Y A;  2I1U A;  2ALB A;  4HDE A;  5J9C A;  4EUY A;  4RI6 A;  4JU5 A;  1VF3 A;  2O7K A;  3HZ4 A;  4MDC A;  3E9J B;  2GSS A;  3GL5 A;  1U88 A;  3I69 A;  2VLU A;  1GP1 A;  1EZK A;  5C00 A;  3IAS 2;  5DAK B;  1XBS A;  2YN1 A;  4YQU A;  1AXD A;  3LYP A;  4XRD A;  3TKQ A;  3D0Z A;  3KM6 A;  1U6T A;  2CZ3 A;  1F3A A;  3KP9 A;  3VPT A;  4I5Q A;  3G7J A;  5ECH B;  4HUA A;  2H76 A;  4TVE A;  1BYE A;  2E0Q A;  4DSR A;  1ZYQ B;  5HR1 A;  3UBK A;  1TDI A;  3IAM 2;  1JFU A;  3DEX A;  5CP1 A;  4ZL7 A;  4K7I A;  1SL0 B;  1PKZ A;  3ZFL A;  4LMV A;  4LL4 B;  3F8U A;  3ZYW A;  2E7P A;  5IOX A;  4BL7 B;  2N5A A;  2D2Z A;  3GH9 A;  3TDG A;  5IO2 A;  4NV2 A;  2GSQ A;  3N9J A;  2HNL A;  1OE8 A;  4MPG A;  3DWV A;  3TRX A;  2FWE A;  4KGI A;  2R4V A;  3QPM A;  3F3R A;  4HU9 A;  2B6M A;  4L0W A;  1EP7 A;  1MEK A;  1SJZ A;  3D21 A;  3I43 A;  1PMT A;  2HFD A;  1Z9H A;  4YQM A;  3H8Q A;  2YJ7 A;  3TCO A;  1M0U A;  3H1N A;  1T8E B;  2H30 A;  2WGR A;  2VLT A;  1GSS A;  1PL1 A;  3A3T A;  2IJY A;  2M46 A;  1K0A A;  1HYU A;  2YWI A;  1G7E A;  13GS A;  4MJB A;  1OC9 A;  2AV4 A;  3K8N A;  4QL7 A;  5G2Z A;  1SJI A;  1M9B A;  2F8A A;  4MA9 A;  4N11 A;  5HR3 A;  2YZU A;  2LST A;  1M2A A;  3GH6 A;  3SBC A;  2CVD A;  5D93 A;  2MYG A;  2CVB A;  1A0F A;  2L4Q A;  4XIH A;  5B6N A;  3RPN A;  3VWX A;  3C7M A;  4KE3 A;  2FGX A;  4I8B A;  4Z7X A;  4TN8 A;  2PMT A;  4KAE A;  3C8E A;  3IC8 A;  1TXX A;  5HFG A;  4LA1 A;  4KF9 A;  4JE1 A;  4BWQ A;  2PGT A;  2TIR A;  1VRS D;  4AF2 A;  1SKS B;  2VD1 A;  4IKH A;  3EMP A;  4I2U A;  5B7C A;  4OMV A;  2B5E A;  2FA8 A;  4N0V A;  3GTU A;  2LJA A;  4G0L A;  1QQ2 A;  4POM A;  3ZVJ D;  2P31 A;  1V9W A;  4ZB9 A;  1O8W A;  3Q18 A;  4KCA A;  1I9D A;  2YAN A;  2H72 A;  5HR0 A;  3KH9 A;  2B1L A;  2H1A A;  5IMD A;  1USB A;  2OBI A;  2ZCT A;  2F3M A;  5DQY A;  5GAP D;  3WT1 A;  1K3O A;  1Y25 A;  1TK0 B;  2FHE A;  5A5K A;  3EMX A;  2O87 A;  4NMU A;  4GRF A;  2X8C A;  2WZ9 A;  5HFK A;  3TB2 A;  2VCZ A;  1EOG A;  1AAZ A;  1R5A A;  1M7T A;  1X5D A;  3ZTL A;  3MWH A;  2LS5 A;  1EGR A;  3TKS A;  2XPE A;  3PGT A;  3HZ8 A;  3TRP A;  2H0I A;  4XS4 B;  3UOM A;  3DRN A;  3HJM A;  3KIJ A;  1JHB A;  1ST9 A;  1XPV A;  3HJP A;  1PX6 A;  3BOA A;  3DGQ A;  2B7K A;  1A2M A;  2H19 A;  3FKF A;  2YV7 A;  4JED A;  2XHF A;  2O89 A;  1TTZ A;  1MDI A;  4MJA A;  4J56 E;  2IN3 A;  4RQR A;  5IIZ A;  3LFL A;  3F6D A;  3QFB C;  4WF5 A;  4K0G A;  2V6O A;  5IPG A;  2A2S A;  2HRF A;  2PVO C;  3RHB A;  4AJ8 A;  2GSR A;  2K18 A;  5ECM B;  2HSY A;  1A24 A;  1SL2 B;  5J9B A;  2C4J A;  3O76 A;  2G2Q A;  2XC2 A;  3UBL A;  1G0T A;  2V32 A;  2C8U A;  5IMZ A;  5B8B A;  3MNG A;  4ZIJ A;  1GSU A;  4ID0 A;  2OE1 A;  3M9J A;  3I9V 2;  2HXK A;  4RQX A;  2FNO A;  3LJR A;  3S9F A;  3J7Y k;  1E2Y A;  1NHO A;  4F9Z A;  2KUC A;  4JR6 A;  4D73 B;  5HFI A;  2FA4 A;  1GSY A;  4JR4 A;  4GSN A;  3GA4 A;  1QUW A;  2H6Y A;  3UJ1 A;  1LU4 A;  1XWC A;  2MMN A;  2V1M A;  2GTU A;  2K8V A;  3HYP A;  1K0B A;  3TUE A;  10GS A;  2LQQ A;  2LRN A;  3UIW A;  2X8H A;  2E2G A;  1X0R A;  4LLR A;  1ERW A;  1A8Y A;  1WOU A;  2LQO A;  3L9S A;  1B4Q A;  5CNW A;  2FLS A;  5H5Q A;  2IMK A;  5DCG A;  2RLI A;  1H75 A;  1V58 A;  4OFN A;  2DJ1 A;  2IFQ A;  2LNS A;  1EEM A;  4FQU A;  3QR6 A;  3WGX A;  2VM1 A;  5GAN D;  3M3M A;  1WP0 A;  4WKW A;  2WDU A;  2VOC A;  3QCP A;  3H79 A;  5LD0 A;  1GUK A;  2KOK A;  3R2Q A;  3C1S A;  2V41 A;  5FT3 A;  3CSJ A;  1GTU A;  1IYI A;  1B48 A;  1LJR A;  4HOJ A;  5CRH A;  4IW9 A;  3W8J A;  4D73 A;  2HLS A;  4MJC A;  2LJR A;  2VCT A;  2ZUP A;  3EUR A;  1T1V A;  2J9H A;  3ZMK A;  5IO0 A;  2CT6 A;  3A2W A;  1VGL A;  4OFM A;  3CSI A;  1TI1 A;  2F8F A;  4TR3 A;  3E0U A;  5D9V A;  3L4N A;  3TGZ A;  5LNK e;  2VCX A;  3WGE A;  3GKN A;  1FAA A;  4MP4 A;  3DD3 A;  4N10 A;  1S3A A;  2EIO A;  2YWN A;  5COH A;  4WR5 A;  3GL3 A;  3QDN A;  1CQG A;  5KEJ A;  3IE3 A;  4WET A;  3NIV A;  3ED3 A;  2OKA A;  2F9S A;  1GRX A;  2XBQ A;  4EE0 A;  5ELG A;  1SD9 A;  1UA5 A;  1ZMA A;  3W8S A;  4H86 A;  4ML6 A;  2VL2 C;  5J5N A;  1WE0 A;  5IMC A;  1F3B A;  2HZF A;  2DSA A;  4IEL A;  1CQH A;  2OE3 A;  3UMA A;  2H01 A;  3IK9 A;  2IMF A;  1Z3E A;  1WJK A;  3W6G A;  1F9M A;  1XW9 A;  4V2L A;  3F0I A;  4OD7 A;  1A8L A;  4EKZ A;  1BAY A;  1XWA A;  2KP2 A;  4JRR A;  3LSZ A;  1AQX A;  3VK9 A;  4K9Z A;  2GQM A;  2MBT A;  1MD4 A;  2NTO A;  2DMM A;  6GSX A;  1RW1 A;  1MTC A;  4EC0 A;  1NW2 A;  2ON7 A;  5KN1 A;  4BVX A;  1EV9 A;  1MD3 A;  4Q5N A;  2QSI A;  2QKE A;  4IP1 A;  2BTO T;  5CRE A;  1A2L A;  1PD2 1;  1ZL9 A;  3DXB A;  4ZBB A;  1B9X C;  4MCU A;  1XOA A;  5IPH A;  3R3E A;  3CRT A;  5JWO B;  1TP9 A;  5A4W A;  1O85 A;  1OC9 B;  3QAV A;  3C73 A;  1GSQ A;  1X9W B;  1PQN A;  4EO3 A;  5J4U A;  3GX8 A;  4HU7 A;  1TI3 A;  4O32 A;  1IYH A;  5CRG A;  5JWQ B;  4V1A g;  1SK0 A;  4V2M A;  1GUH A;  3LYK A;  4GST A;  2JZS A;  4AGS A;  2VCV A;  5GST A;  4KA0 A;  1TJD A;  3ZVJ A;  4O92 A;  1GNE A;  4PUF C;  1FVK A;  4MZB A;  3VI5 A;  4BA7 A;  1M2B A;  2DJJ A;  2L5L A;  2PVQ A;  1HNC A;  3IHQ A;  1WRY A;  2J23 A;  2KLX A;  4KDY A;  2AYT A;  1TRW A;  3WT2 A;  1RQM A;  1FVJ A;  3NZN A;  4PUR A;  1A0R P;  2C0F A;  3LEF A;  1U3I A;  5JCU A;  3IV4 A;  3IC4 A;  2C0E A;  4MPF A;  3TJJ A;  3F6F A;  2R5G A;  3E3E A;  3HD5 A;  2E2M A;  3GTU B;  2IMD A;  1UC7 A;  3U5R E;  2C3T A;  3ISO A;  1WPI A;  4YH2 A;  3P2A A;  2CV4 A;  2DJ2 A;  1XVQ A;  1NSW A;  4TKY A;  1BED A;  3ZML A;  1T3B A;  4GQC A; 
#chains in the Genus database with same CATH topology
 4O5U A;  4MZW A;  4GDF A;  2WW2 A;  5GZZ B;  2YCD A;  1OE7 A;  5F06 A;  3KCM A;  3TJK A;  2GQL A;  2EIR A;  1MDJ A;  6GSV A;  1SKR B;  2H66 A;  1K3Y A;  2XPD A;  4RI7 A;  5DDL A;  3BJ5 A;  2IME A;  2VL9 A;  2H70 A;  4POB A;  2NDO A;  4XRA A;  4ZIL A;  3Q6O A;  3M8N A;  4JBB A;  1Z6N A;  5D96 A;  3LQ7 A;  3GKM A;  3VI7 A;  5F8B A;  2O8V B;  3L9V A;  4AJ7 A;  1DUG A;  1ZGN A;  5AN1 A;  4FYU A;  2DJ3 A;  4K1F A;  1FG4 A;  2PU9 C;  2ZNM A;  3P7X A;  1XCC A;  3F4R A;  4PXO A;  4IVF A;  3ME8 A;  1YY7 A;  1XW5 A;  1OC8 A;  1GWC A;  1ML6 A;  6GSY A;  4AI6 A;  4MJE A;  3Q74 A;  5D9W A;  5F05 A;  2H75 A;  4MMM A;  4K2D A;  4EVM A;  4QL9 A;  1T7P B;  1KEB A;  3HVS A;  3ZRE A;  3ZLP A;  3A2X A;  2B5Y A;  4K5R A;  1X9S B;  4HJM A;  4TR4 A;  1ZZY A;  16GS A;  4G2E A;  2DC5 A;  3IDV A;  2JU5 A;  4G0K A;  4K2X A;  2WVX B;  4FO5 A;  2C0D A;  3O6T A;  5G30 A;  4BWS A;  1A2J A;  1TRS A;  2P5Q A;  2LRT A;  2FD3 A;  3F4T A;  1J9B A;  3FZ5 A;  4KND A;  3KXO A;  3TOT A;  19GS A;  2M80 A;  2PN8 A;  1B9Y C;  5CYY A;  3FY7 A;  2CVK A;  4KH7 A;  1XFL A;  2X49 A;  3TU3 B;  4IHU A;  5B6M A;  2H8L A;  1SU9 A;  3ZIJ A;  2FWG A;  3VWW A;  4DVC A;  1M99 A;  3HDC A;  4IS0 A;  1G7O A;  3UAR A;  4WBJ A;  1TU8 A;  3IOS A;  3UL3 A;  4ZBD A;  2HRA A;  1RK4 A;  4K7N A;  1WMJ A;  2K9F A;  2QA2 A;  3NOF A;  2DIZ A;  2LJK A;  4L0U A;  3P90 A;  2OAC A;  2L6C A;  2UZ8 A;  2WW3 A;  5ECN B;  2DJ0 A;  1KBN A;  2RM5 A;  2QA1 A;  1EP8 A;  5CRW A;  1OKD A;  1PSQ A;  1OAZ A;  4YQV A;  1T00 A;  4I97 A;  3EYT A;  4G19 A;  2CAQ A;  4HZ2 A;  3BCI A;  5IMV A;  3ZIV A;  1PKW A;  3KD0 A;  5ENU A;  3LOR A;  3ZIT A;  4ZL8 A;  3QFA C;  4PQI A;  3P8W A;  2FUG 2;  5ECK B;  4PQ1 A;  2CA8 A;  3KGK A;  3FZA A;  1FHE A;  1SKW B;  3JCM L;  2B7J A;  4IJI A;  5E59 A;  2IMI A;  2IFQ B;  4XHM A;  2GT6 A;  1XXU A;  2HRK A;  4FYC A;  4ZL9 A;  2TRX A;  4TR1 A;  4QMK A;  3RBT A;  4IN0 A;  4ILF A;  3WGD A;  2WRT A;  2N5B A;  2RII A;  3ERW A;  2JZT A;  2FWF A;  1SL1 B;  4ACS A;  2WUL A;  4N3Z A;  2YP6 A;  1K0D A;  4WXT A;  1ACV A;  1S4B P;  3M9K A;  2MMZ A;  3IA1 A;  2H1D A;  3D22 A;  3A5W A;  1SK1 A;  3GIX A;  2V6K A;  4TRX A;  2DML A;  2LEG A;  1Q98 A;  3MDK A;  3L9U A;  1TRV A;  2IWT A;  1HNA A;  3GV1 A;  2MMO A;  5G31 A;  2O85 A;  2H74 A;  3M1G A;  5AIS A;  2OJL A;  1AUC A;  4CDO A;  2GZY A;  5BMU A;  5IMF A;  4ECB A;  3KH7 A;  4ECJ A;  3U6V A;  1XVW A;  4EF0 A;  1F6M C;  4PI2 C;  1FB6 A;  2X8G A;  4ZB6 A;  1JZR A;  1K0M A;  2WVZ A;  3DKS A;  2EIQ A;  4FXY P;  2GST A;  1ABA A;  2AUV A;  5AIX A;  3FHK A;  1YKA A;  5A5H B;  2DBC A;  2L6D A;  4QQ7 A;  4TW5 A;  3HHV A;  2AHE A;  1OKT A;  5A1N B;  1WIK A;  2UV8 G;  2RM6 A;  1V40 A;  2B3S A;  3QAG A;  4G10 A;  1V98 A;  3ERG A;  4N0Z A;  3BD2 A;  3QMX A;  3VUR A;  3N5O A;  1KNG A;  4TOP A;  1EWX A;  3CYN A;  4L5L A;  1SVM A;  6GSU A;  1UN2 A;  5CO3 A;  3OR5 A;  3UEM A;  4DSS A;  4AKG A;  2B1K A;  1U3A A;  4K8M A;  2WW1 A;  3GMF A;  3LW9 A;  4PX1 A;  4X4J A;  2IIY A;  3GX0 A;  1VF1 A;  3CMI A;  3QAW A;  1I5G A;  4E8E A;  2YOI A;  2VL2 A;  3MIX A;  5IMA A;  2Z9S A;  2BJX A;  2V2G A;  4L5O A;  2VUP A;  2GQK A;  6GST A;  5E4W A;  2VL3 A;  3RPP A;  1R5P A;  4IQ1 A;  1YZX A;  3CRU A;  2NPB A;  1EEJ A;  2JL4 A;  3C71 A;  4WEY A;  2CX3 A;  2H1G A;  2KP1 A;  3D6I A;  4EIQ A;  1K3L A;  1K0C A;  1ERT A;  4BVX B;  4F03 A;  1G6W A;  2YPM A;  1AQV A;  2GVP A;  2IPA A;  2VD0 A;  4NAX A;  3CSH A;  1EGO A;  4O5R A;  3EVI A;  4X43 A;  4ML1 A;  4BVY A;  1EV4 A;  4HQS A;  2YV9 A;  3AY8 A;  4K7O A;  3DYR A;  4K5S A;  3IPZ A;  2OE0 A;  2AJQ B;  5A4V A;  4TXV A;  5A1N A;  3MSZ A;  3F63 A;  1PRX A;  4L8E A;  4YAP A;  1BG5 A;  5ECP B;  3DIE A;  3GKX A;  2JSZ A;  1S3C A;  4IQA A;  2C80 A;  3KTB A;  2LRC A;  3IBH A;  3BCK A;  3VWU A;  4WR4 A;  2C3Q A;  2B5X A;  2NBS A;  2CAI A;  4NXI A;  1TW9 A;  1Z6M A;  1ZYE A;  4IP6 A;  1SYX A;  3TJG A;  4POL A;  1YF0 A;  1DBY A;  3H4K A;  2LV3 A;  4F0B A;  1PL2 A;  1PGT A;  2NVL A;  1OYJ A;  4JZQ A;  3MAK A;  4HZ4 A;  4NHZ A;  1JZW A;  5ABR A;  5GSS A;  4IJ3 A;  1S3R A;  1QGV A;  4PNG A;  4FIW A;  1V2A A;  2L59 A;  1OC3 A;  5D9T A;  4ECC A;  1YJ6 A;  2AB6 A;  2H71 A;  4GLT A;  4AJ6 A;  4RUV A;  2H0H A;  4OCF A;  2O36 A;  1XZO A;  1JZD A;  2EFE A;  4OCE A;  1YEW C;  2HZE B;  3FW2 A;  1GTI A;  3FEU A;  2VAF A;  1W89 A;  3ERF A;  2HRN A;  2CQ9 A;  2WB9 A;  2JZR A;  4HI7 A;  1FO5 A;  2I9H A;  1ERV A;  4X1U A;  4HEA 2;  4E8H A;  4F0C A;  1ERU A;  1AC1 A;  2LNT A;  3Q19 A;  1QXH A;  5ECS A;  2X64 A;  5ID2 A;  1J08 A;  4HS1 A;  3TOU A;  5DAL A;  1B8X A;  3FZ4 A;  4ZBA A;  5H5R A;  20GS A;  2I81 A;  4FH8 A;  4FYB A;  2GZP A;  4XS6 A;  1EOH A;  1K0N A;  3GNJ A;  2OA7 A;  3WD6 A;  5JCW A;  2HSN A;  2VCQ A;  2HSM A;  4GSS A;  2YZH A;  5H5S A;  2TRC P;  5DQS A;  3G9B A;  4ISD A;  1M3I A;  3G7Y A;  3CXG A;  4ZB8 A;  2EC4 A;  2FCH A;  3FR6 A;  3G7I A;  1Q4J A;  2R6K A;  2HI7 A;  5JCG A;  3IR4 A;  1O6J A;  4F2I A;  1O81 A;  3FRC A;  3TJB A;  1GUL A;  2OAD A;  2WS2 A;  5EY6 A;  4OO4 A;  3PH9 A;  3ZFB A;  2I4A A;  4WBR D;  4LL1 B;  4PNF A;  1GTA A;  4KSM A;  5IOW A;  1NM3 A;  3HJO A;  5EPF A;  4TXO A;  1XIY A;  2BMX A;  3APQ A;  2R37 A;  2RUE A;  1K0O A;  4Z2T A;  5J41 A;  2HZE A;  17GS A;  3IXR A;  5B8A A;  1XG8 A;  3VFI A;  5CAX A;  1G6Y A;  2JSY A;  5AIV A;  4YKG A;  2DJK A;  2JAC A;  5J3R A;  4KSO A;  1BQ7 A;  3ME7 A;  4NPB A;  1J0F A;  1THO A;  5DAK A;  5KOX A;  2OBK A;  1TK8 B;  2VIM A;  3EE2 A;  5JWR B;  3KJY A;  1H4O A;  5F07 A;  2YWM A;  1FW1 A;  1X5E A;  2DLX A;  1U87 A;  1YKC A;  1XWB A;  3TKR A;  3QOU A;  2R3X A;  2L5O A;  2PWJ A;  1N2A A;  2GLR A;  2A2R A;  4MF7 A;  3ZL5 A;  2C0G A;  4NWY A;  1T4Z A;  2GGT A;  1TOF A;  2H1B A;  4TR0 A;  1SD8 A;  2VCW A;  3PPU A;  2C3N A;  2ES7 A;  2K8S A;  1SK2 A;  4NV5 A;  4WF4 A;  4I2T A;  1C72 A;  3TJF A;  4BL7 A;  2P0G A;  1ON4 A;  4K6X A;  4IBP A;  5G5E A;  1GSD A;  2X99 A;  2HQT A;  2IL3 A;  1N8J A;  1YF1 A;  3DVW A;  3KZQ A;  1DE1 A;  4YAV A;  2G0F A;  4G0I A;  3IRA A;  1GLP A;  4MF5 A;  3HA9 A;  3GN3 A;  3US3 A;  1Y6E A;  2HE3 A;  4Z2U A;  2F51 A;  1XW6 A;  2HRK B;  2YWO A;  1GSF A;  4TR1 B;  3GHA A;  4Q5Q A;  4CHS A;  2PPT A;  1XWG A;  14GS A;  4V1A p;  1URM A;  1TK5 B;  1BG1 A;  2CZ2 A;  1YDK A;  4MK3 A;  2GDR A;  2H1L A;  1M9A A;  18GS A;  4O5Q A;  3HVN A;  3HVX A;  2KHP A;  2GT5 A;  5C04 A;  5DJL A;  1XOB A;  5DBQ A;  3EU3 A;  3L78 A;  3V1W A;  5KN3 A;  2MZC A;  3O3T A;  2I3Y A;  1T4Y A;  3FK8 A;  2DKI A;  5IM9 A;  3TKP A;  4MZC A;  4GCI A;  1GH2 A;  1QMV A;  1R7H A;  4K0N A;  1KTE A;  3HVV A;  3H93 A;  1GLQ A;  1S3D A;  4KB3 A;  1PX7 A;  3HY2 A;  1HNB A;  2CX4 A;  5DVB A;  4G9H A;  5BMU B;  3IK7 A;  2H6X A;  3TRQ A;  3GSS A;  2VLV A;  4DSQ A;  5D9X A;  1A23 A;  4PI0 C;  2RUF A;  3UVT A;  3C1R A;  3GKK A;  4ZXG A;  3D4M A;  4GF0 A;  3SWL A;  3DVX A;  4O7H A;  4J2F A;  2LTK A;  1GL8 A;  4EXJ A;  4CW9 A;  4KX4 A;  1DE2 A;  1QK8 A;  3EC3 A;  2L57 A;  2LUS A;  5D8I A;  4KDX A;  5ECQ B;  1X5C A;  2WFC A;  5FHI A;  3CQF A;  3LGC A;  2ON5 A;  1THX A;  1E6B A;  4XS1 A;  3HMJ G;  3A2V A;  4KUN A;  3VPQ A;  3M0F A;  4DSS B;  4J57 E;  1AQW A;  1VF4 A;  4OWY A;  1GUM A;  4USS A;  4GWR A;  4MH3 A;  5G5F A;  4XTS A;  3CHX C;  4V2N A;  2PBJ A;  2DKH A;  5ECL B;  1YQ1 A;  2N5F A;  1XWK A;  1Z5Y E;  3CTF A;  3LXZ A;  1ZCP A;  4EL1 A;  3GUS A;  3DML A;  5HR2 A;  4KDU A;  5LCZ A;  2LKU A;  3QD9 A;  2WZS A;  1BX9 A;  3GUR A;  3TKS C;  1PFO A;  5EL8 A;  5EVO A;  5L71 A;  4LMW A;  4GTU A;  5CRD A;  4POK A;  5ECI B;  3CTG A;  1TXU A;  3UVH A;  4I6X A;  3VLN A;  4DEJ A;  4Q5F A;  4MF6 A;  1V57 A;  1M2D A;  4PQH A;  3FR3 A;  7GSS A;  2HT9 A;  4PTS A;  1JZO A;  1YEP A;  4XS4 A;  3LWA A;  1DSB A;  3GRX A;  3F4S A;  1WWJ A;  3UAP A;  4ECI A;  4BVY B;  3F9U A;  1AW9 A;  2FY6 A;  1BJX A;  3PIN A;  5A4U A;  1GTB A;  2HSH A;  3HXS A;  3EPT A;  2MMA A;  5IQY A;  1JLW A;  1SEN A;  1B4P A;  3RDW A;  4BPY A;  3ZZX A;  5FWG A;  1O7U A;  1OVN A;  5INY A;  1R26 A;  1QFN A;  4PHZ C;  1F37 A;  4A5P A;  3KEB A;  3APS A;  4EDZ A;  1LBK A;  4EDY A;  3LG6 A;  3WYW A;  3D4T A;  11GS A;  3CBU A;  2VM2 A;  2MBS A;  1TU7 A;  3HCZ A;  2WCI A;  2A4V A;  3FR9 A;  5AGY A;  1HQO A;  3D5J A;  3EWL A;  3FYG A;  8GSS A;  2AAW A;  5DCH A;  4X0X A;  1Z7P A;  2OT3 A;  3KTL A;  1VF2 A;  1NHY A;  4XCS A;  2QGV A;  6GSW A;  3L0H A;  1TRU A;  3J7Y b;  2HYX A;  4ULX A;  3PR8 A;  2FWH A;  2PER A;  3I6A A;  5J40 A;  2GZZ A;  6GSS A;  3KP8 A;  4GQF A;  3VWV A;  9GSS A;  4HSC X;  12GS A;  1FB0 A;  3EU4 A;  2K6V A;  1SVO A;  1O73 A;  2YNX A;  3BBY A;  3EIN A;  2R2J A;  2REM A;  1FOV A;  2VKZ G;  2L4C A;  2M72 A;  3KMO A;  4KW6 A;  2XBI A;  4PGT A;  1GSE A;  4BIK A;  4PUA A;  2YJH A;  1F2E A;  1HD2 A;  2JAD A;  2PUK C;  3APO A;  1PN0 A;  4Z2R A;  5HQP A;  5ID2 B;  3LXT A;  5DAL B;  3IHG A;  5ELA A;  1Z7R A;  1MDK A;  1PN9 A;  2EFC A;  2X4A A;  5DJM A;  1ZOF A;  2P5R A;  3F3Q A;  3GFK A;  3RHC A;  5KN2 A;  2H0G A;  2HSN B;  2HSM B;  3HKR A;  1M3J A;  3RAZ A;  4IGJ A;  4F82 A;  4KCE A;  5G1K A;  3ZRD A;  4MAB A;  1SJ6 A;  5D73 A;  1YEX A;  4MLY A;  3TKS E;  3FMW A;  2H73 A;  1ILO A;  3KMN A;  4NHW A;  1R4W A;  1UVZ A;  1X9M B;  2H6Z A;  1GNW A;  2DIY A;  1W4V A;  2R0C A;  22GS A;  2GS3 A;  2WJU A;  4HQZ A;  4OO5 A;  4P3Y B;  5ECO B;  4Q5R A;  1O8X A;  4MH2 A;  4OFT A;  1PA3 A;  3GYK A;  4HJ2 A;  1TKD B;  4N30 A;  1ZYN A;  4GXZ A;  2VO4 A;  1SYR A;  3FZ9 A;  5F0G A;  4TXO B;  5G1L A;  2O5V A;  2QC7 A;  5KN0 A;  5BRT A;  3GST A;  1AIU A;  1JLV A;  5ECR B;  2C1Y A;  2I1U A;  2ALB A;  1I1I P;  4HDE A;  5J9C A;  4EUY A;  4RI6 A;  4JU5 A;  1VF3 A;  2O7K A;  3HZ4 A;  2WVY A;  4MDC A;  3E9J B;  2GSS A;  3GL5 A;  1U88 A;  4G01 A;  3I69 A;  2VLU A;  1GP1 A;  1EZK A;  5C00 A;  3IAS 2;  5DAK B;  1XBS A;  2YN1 A;  4YQU A;  1AXD A;  3LYP A;  4XRD A;  3TKQ A;  3D0Z A;  3KM6 A;  1U6T A;  2CZ3 A;  3MYD A;  1F3A A;  3VPT A;  3KP9 A;  1Y1U A;  4I5Q A;  3G7J A;  5ECH B;  4HUA A;  2H76 A;  4TVE A;  1BYE A;  2E0Q A;  4DSR A;  1ZYQ B;  5HR1 A;  3UBK A;  1TDI A;  3IAM 2;  1JFU A;  3DEX A;  5CP1 A;  4ZL7 A;  4K7I A;  1SL0 B;  1PKZ A;  3ZFL A;  4LMV A;  4LL4 B;  3F8U A;  3ZYW A;  2E7P A;  5IOX A;  4BL7 B;  2N5A A;  2D2Z A;  3GH9 A;  3TDG A;  5IO2 A;  4NV2 A;  2GSQ A;  3N9J A;  2HNL A;  1OE8 A;  4MPG A;  3DWV A;  3TRX A;  2FWE A;  5KOW A;  4KGI A;  2R4V A;  3QPM A;  3F3R A;  4HU9 A;  2A2P A;  2B6M A;  4L0W A;  1EP7 A;  1MEK A;  1SJZ A;  3D21 A;  3I43 A;  1PMT A;  2HFD A;  1Z9H A;  4EIP A;  4YQM A;  3H8Q A;  2YJ7 A;  3TCO A;  1M0U A;  4CY8 A;  3H1N A;  1T8E B;  2H30 A;  2WGR A;  2VLT A;  1GSS A;  2R0P A;  1PL1 A;  3A3T A;  2IJY A;  2M46 A;  1K0A A;  1HYU A;  2YWI A;  1ZYP A;  1G7E A;  13GS A;  4MJB A;  1OC9 A;  2AV4 A;  3K8N A;  4QL7 A;  5G2Z A;  1SJI A;  1M9B A;  2F8A A;  4MA9 A;  4N11 A;  5HR3 A;  2YZU A;  2LST A;  1M2A A;  3GH6 A;  3SBC A;  2CVD A;  5D93 A;  2MYG A;  4AKI A;  2CVB A;  1A0F A;  2L4Q A;  4XIH A;  5B6N A;  3RPN A;  3VWX A;  3C7M A;  4KE3 A;  2FGX A;  4I8B A;  4Z7X A;  4TN8 A;  4CY6 A;  2PMT A;  4KAE A;  3C8E A;  3IC8 A;  1TXX A;  5HFG A;  4LA1 A;  4KF9 A;  4JE1 A;  2EFH A;  4BWQ A;  2PGT A;  2TIR A;  1VRS D;  5A34 A;  4AF2 A;  1SKS B;  2VD1 A;  4IKH A;  3EMP A;  4I2U A;  5B7C A;  4OMV A;  2B5E A;  2FA8 A;  4N0V A;  3GTU A;  2LJA A;  4G0L A;  2WW0 A;  1QQ2 A;  4POM A;  3ZVJ D;  2P31 A;  1YVL A;  1V9W A;  4ZB9 A;  1O8W A;  3Q18 A;  4KCA A;  2YAN A;  1I9D A;  1N25 A;  2H72 A;  5HR0 A;  3KH9 A;  2B1L A;  2H1A A;  5IMD A;  1USB A;  2OBI A;  2ZCT A;  2F3M A;  5DQY A;  5GAP D;  3WT1 A;  1K3O A;  1Y25 A;  1TK0 B;  2FHE A;  5A5K A;  3EMX A;  5J4V A;  2O87 A;  4NMU A;  4GRF A;  2X8C A;  2WZ9 A;  5HFK A;  3TB2 A;  2VCZ A;  1EOG A;  1AAZ A;  1R5A A;  1M7T A;  3RGB C;  3A5I A;  1X5D A;  3ZTL A;  3MWH A;  2LS5 A;  1EGR A;  3TKS A;  2XPE A;  3PGT A;  3HZ8 A;  3TRP A;  2H0I A;  4XS4 B;  3UOM A;  3DRN A;  3HJM A;  3KIJ A;  1JHB A;  1ST9 A;  1XPV A;  3HJP A;  1PX6 A;  3BOA A;  3DGQ A;  2B7K A;  1A2M A;  2H19 A;  3FKF A;  2YV7 A;  4JED A;  2XHF A;  2O89 A;  1TTZ A;  1MDI A;  4MJA A;  1SVL A;  4J56 E;  2IN3 A;  4RQR A;  5IIZ A;  3LFL A;  3F6D A;  3QFB C;  4WF5 A;  4K0G A;  2EFD A;  2V6O A;  5IPG A;  2A2S A;  2HRF A;  2PVO C;  3RHB A;  4AJ8 A;  2GSR A;  2WVX A;  2K18 A;  5ECM B;  2HSY A;  1A24 A;  1SL2 B;  5J9B A;  2C4J A;  3O76 A;  2G2Q A;  2XC2 A;  3UBL A;  1G0T A;  2V32 A;  2C8U A;  5IMZ A;  5B8B A;  3MNG A;  4ZIJ A;  1GSU A;  4ID0 A;  2OE1 A;  3I9V 2;  3M9J A;  2HXK A;  4RQX A;  2FNO A;  3LJR A;  3S9F A;  3J7Y k;  1E2Y A;  1NHO A;  4F9Z A;  2KUC A;  4JR6 A;  4D73 B;  5HFI A;  2FA4 A;  1GSY A;  4JR4 A;  4GSN A;  3GA4 A;  4E68 A;  1QUW A;  2H6Y A;  3UJ1 A;  1LU4 A;  1XWC A;  2MMN A;  2V1M A;  2GTU A;  2K8V A;  3HYP A;  1K0B A;  3TUE A;  10GS A;  2LQQ A;  2LRN A;  3UIW A;  2X8H A;  2E2G A;  1X0R A;  4LLR A;  1ERW A;  1A8Y A;  1WOU A;  2LQO A;  4ZB7 A;  3L9S A;  1B4Q A;  5CNW A;  2FLS A;  5H5Q A;  2IMK A;  5DCG A;  2RLI A;  1H75 A;  1V58 A;  4OFN A;  2DJ1 A;  2IFQ A;  2LNS A;  1EEM A;  4FQU A;  3QR6 A;  3WGX A;  2VM1 A;  5GAN D;  3M3M A;  1WP0 A;  4WKW A;  2WDU A;  2VOC A;  3QCP A;  3H79 A;  5LD0 A;  1GUK A;  2KOK A;  3R2Q A;  3C1S A;  2V41 A;  5FT3 A;  3CSJ A;  1FOH A;  4YKF A;  1GTU A;  1IYI A;  1B48 A;  1LJR A;  4HOJ A;  5CRH A;  4IW9 A;  3W8J A;  4D73 A;  2HLS A;  5J4Y A;  4MJC A;  2LJR A;  2VCT A;  2ZUP A;  3EUR A;  1T1V A;  2J9H A;  3ZMK A;  4AKH A;  5IO0 A;  2CT6 A;  3A2W A;  1VGL A;  4OFM A;  3CSI A;  1TI1 A;  2F8F A;  4TR3 A;  3E0U A;  5D9V A;  3L4N A;  3TGZ A;  5LNK e;  2VCX A;  3WGE A;  5A5H A;  3GKN A;  1FAA A;  4MP4 A;  3DD3 A;  4N10 A;  1S3A A;  2EIO A;  2YWN A;  5COH A;  4WR5 A;  4ICY A;  3GL3 A;  3QDN A;  1CQG A;  2A4H A;  5KEJ A;  3IE3 A;  4WET A;  3NIV A;  3ED3 A;  2OKA A;  2F9S A;  1GRX A;  2XBQ A;  4EE0 A;  5ELG A;  1SD9 A;  1UA5 A;  1ZMA A;  3W8S A;  4H86 A;  4ML6 A;  2VL2 C;  5J5N A;  1WE0 A;  5IMC A;  1F3B A;  2HZF A;  2DSA A;  4IEL A;  1CQH A;  2OE3 A;  3UMA A;  2H01 A;  3IK9 A;  2IMF A;  1Z3E A;  1WJK A;  3W6G A;  1F9M A;  1XW9 A;  4V2L A;  3F0I A;  4OD7 A;  1A8L A;  4EKZ A;  1BAY A;  1XWA A;  2KP2 A;  4JRR A;  3LSZ A;  1AQX A;  3VK9 A;  4K9Z A;  2GQM A;  2MBT A;  1MD4 A;  2NTO A;  2DMM A;  6GSX A;  1RW1 A;  1MTC A;  4EC0 A;  1NW2 A;  2ON7 A;  4W66 A;  5KN1 A;  4BVX A;  1EV9 A;  1MD3 A;  4Q5N A;  2QSI A;  3RFR C;  2QKE A;  4IP1 A;  2BTO T;  5CRE A;  4MNN A;  1A2L A;  1PD2 1;  1ZL9 A;  3DXB A;  4ZBB A;  1B9X C;  3CWG A;  4MCU A;  1XOA A;  5IPH A;  3R3E A;  3CRT A;  5JWO B;  1TP9 A;  5A4W A;  1O85 A;  1OC9 B;  3QAV A;  2O3E A;  3C73 A;  1GSQ A;  1X9W B;  1PQN A;  4EO3 A;  5J4U A;  3GX8 A;  4HU7 A;  1TI3 A;  4O32 A;  1IYH A;  5CRG A;  5JWQ B;  4V1A g;  1SK0 A;  4V2M A;  1GUH A;  5J47 A;  3LYK A;  4GST A;  2JZS A;  4AGS A;  2VCV A;  5GST A;  4KA0 A;  1TJD A;  3ZVJ A;  4O92 A;  1GNE A;  4AKX B;  4PUF C;  1FVK A;  4MZB A;  3VI5 A;  4BA7 A;  1M2B A;  2DJJ A;  2L5L A;  2PVQ A;  1HNC A;  3IHQ A;  1WRY A;  2J23 A;  2KLX A;  1BF5 A;  4KDY A;  2AYT A;  1TRW A;  5A34 B;  3WT2 A;  1RQM A;  1FVJ A;  3NZN A;  4PUR A;  1A0R P;  2C0F A;  2R0G A;  3LEF A;  1U3I A;  5JCU A;  3IV4 A;  3IC4 A;  2C0E A;  4MPF A;  3TJJ A;  3F6F A;  2R5G A;  3E3E A;  3HD5 A;  2E2M A;  3GTU B;  2IMD A;  1UC7 A;  3U5R E;  2C3T A;  3ISO A;  1WPI A;  4YH2 A;  2CV4 A;  3P2A A;  2DJ2 A;  1XVQ A;  1NSW A;  4TKY A;  1BED A;  3ZML A;  1T3B A;  4GQC A; 
#chains in the Genus database with same CATH homology
 4O5U A;  4MZW A;  4GDF A;  5GZZ B;  2YCD A;  1OE7 A;  5F06 A;  3KCM A;  3TJK A;  2GQL A;  2EIR A;  1MDJ A;  6GSV A;  1SKR B;  2H66 A;  1K3Y A;  2XPD A;  4RI7 A;  5DDL A;  3BJ5 A;  2IME A;  2VL9 A;  2H70 A;  4POB A;  2NDO A;  4XRA A;  4ZIL A;  3Q6O A;  3M8N A;  4JBB A;  1Z6N A;  5D96 A;  3LQ7 A;  3GKM A;  3VI7 A;  5F8B A;  2O8V B;  3L9V A;  4AJ7 A;  1DUG A;  1ZGN A;  5AN1 A;  4FYU A;  2DJ3 A;  4K1F A;  1FG4 A;  2PU9 C;  2ZNM A;  3P7X A;  1XCC A;  3F4R A;  4PXO A;  4IVF A;  3ME8 A;  1YY7 A;  1XW5 A;  1OC8 A;  1GWC A;  1ML6 A;  6GSY A;  4AI6 A;  4MJE A;  3Q74 A;  5D9W A;  5F05 A;  2H75 A;  4MMM A;  4K2D A;  4EVM A;  4QL9 A;  1T7P B;  1KEB A;  3HVS A;  3ZRE A;  3ZLP A;  3A2X A;  2B5Y A;  4K5R A;  1X9S B;  4HJM A;  4TR4 A;  1ZZY A;  16GS A;  4G2E A;  2DC5 A;  3IDV A;  2JU5 A;  4G0K A;  4K2X A;  4FO5 A;  2C0D A;  3O6T A;  5G30 A;  4BWS A;  1A2J A;  1TRS A;  2P5Q A;  2LRT A;  2FD3 A;  3F4T A;  1J9B A;  3FZ5 A;  4KND A;  3KXO A;  3TOT A;  19GS A;  2M80 A;  2PN8 A;  1B9Y C;  5CYY A;  3FY7 A;  2CVK A;  4KH7 A;  1XFL A;  2X49 A;  3TU3 B;  4IHU A;  5B6M A;  2H8L A;  1SU9 A;  3ZIJ A;  2FWG A;  3VWW A;  4DVC A;  1M99 A;  3HDC A;  4IS0 A;  1G7O A;  3UAR A;  4WBJ A;  1TU8 A;  3IOS A;  3UL3 A;  4ZBD A;  2HRA A;  1RK4 A;  4K7N A;  1WMJ A;  2K9F A;  2QA2 A;  3NOF A;  2DIZ A;  2LJK A;  4L0U A;  3P90 A;  2OAC A;  2L6C A;  2UZ8 A;  5ECN B;  2DJ0 A;  1KBN A;  2RM5 A;  2QA1 A;  1EP8 A;  5CRW A;  1OKD A;  1PSQ A;  1OAZ A;  4YQV A;  1T00 A;  4I97 A;  3EYT A;  4G19 A;  2CAQ A;  4HZ2 A;  3BCI A;  5IMV A;  3ZIV A;  1PKW A;  3KD0 A;  5ENU A;  3LOR A;  3ZIT A;  4ZL8 A;  3QFA C;  4PQI A;  3P8W A;  2FUG 2;  5ECK B;  4PQ1 A;  2CA8 A;  3KGK A;  3FZA A;  1FHE A;  1SKW B;  3JCM L;  2B7J A;  4IJI A;  5E59 A;  2IMI A;  2IFQ B;  4XHM A;  2GT6 A;  1XXU A;  2HRK A;  4FYC A;  4ZL9 A;  2TRX A;  4TR1 A;  4QMK A;  3RBT A;  4IN0 A;  4ILF A;  3WGD A;  2WRT A;  2N5B A;  2RII A;  3ERW A;  2JZT A;  2FWF A;  1SL1 B;  4ACS A;  2WUL A;  4N3Z A;  2YP6 A;  1K0D A;  4WXT A;  1ACV A;  3M9K A;  2MMZ A;  3IA1 A;  2H1D A;  3D22 A;  3A5W A;  1SK1 A;  3GIX A;  2V6K A;  4TRX A;  2DML A;  2LEG A;  1Q98 A;  3MDK A;  3L9U A;  1TRV A;  2IWT A;  1HNA A;  3GV1 A;  2MMO A;  5G31 A;  2O85 A;  2H74 A;  3M1G A;  5AIS A;  2OJL A;  1AUC A;  4CDO A;  2GZY A;  5BMU A;  5IMF A;  4ECB A;  3KH7 A;  4ECJ A;  3U6V A;  1XVW A;  4EF0 A;  1F6M C;  1FB6 A;  2X8G A;  4ZB6 A;  1JZR A;  1K0M A;  3DKS A;  2EIQ A;  2GST A;  1ABA A;  2AUV A;  5AIX A;  3FHK A;  1YKA A;  5A5H B;  2DBC A;  2L6D A;  4QQ7 A;  4TW5 A;  3HHV A;  2AHE A;  1OKT A;  5A1N B;  1WIK A;  2UV8 G;  2RM6 A;  1V40 A;  2B3S A;  3QAG A;  4G10 A;  1V98 A;  3ERG A;  4N0Z A;  3BD2 A;  3QMX A;  3VUR A;  3N5O A;  1KNG A;  4TOP A;  1EWX A;  3CYN A;  4L5L A;  1SVM A;  6GSU A;  1UN2 A;  5CO3 A;  3OR5 A;  3UEM A;  4DSS A;  4AKG A;  2B1K A;  1U3A A;  4K8M A;  3GMF A;  3LW9 A;  4PX1 A;  4X4J A;  2IIY A;  3GX0 A;  1VF1 A;  3CMI A;  3QAW A;  1I5G A;  4E8E A;  2YOI A;  2VL2 A;  3MIX A;  5IMA A;  2Z9S A;  2BJX A;  2V2G A;  4L5O A;  2VUP A;  2GQK A;  6GST A;  5E4W A;  2VL3 A;  3RPP A;  1R5P A;  4IQ1 A;  1YZX A;  3CRU A;  2NPB A;  1EEJ A;  2JL4 A;  3C71 A;  4WEY A;  2CX3 A;  2H1G A;  2KP1 A;  3D6I A;  4EIQ A;  1K3L A;  1K0C A;  1ERT A;  4BVX B;  4F03 A;  1G6W A;  2YPM A;  1AQV A;  2GVP A;  2IPA A;  2VD0 A;  4NAX A;  3CSH A;  1EGO A;  4O5R A;  3EVI A;  4X43 A;  4ML1 A;  4BVY A;  1EV4 A;  4HQS A;  2YV9 A;  3AY8 A;  4K7O A;  3DYR A;  4K5S A;  3IPZ A;  2OE0 A;  2AJQ B;  5A4V A;  4TXV A;  5A1N A;  3MSZ A;  3F63 A;  1PRX A;  4L8E A;  4YAP A;  1BG5 A;  5ECP B;  3DIE A;  3GKX A;  2JSZ A;  1S3C A;  4IQA A;  2C80 A;  3KTB A;  2LRC A;  3IBH A;  3BCK A;  3VWU A;  4WR4 A;  2C3Q A;  2B5X A;  2NBS A;  2CAI A;  4NXI A;  1TW9 A;  1Z6M A;  1ZYE A;  4IP6 A;  1SYX A;  3TJG A;  4POL A;  1YF0 A;  1DBY A;  3H4K A;  2LV3 A;  4F0B A;  1PL2 A;  1PGT A;  2NVL A;  1OYJ A;  4JZQ A;  3MAK A;  4HZ4 A;  4NHZ A;  1JZW A;  5ABR A;  5GSS A;  4IJ3 A;  1QGV A;  4PNG A;  4FIW A;  1V2A A;  2L59 A;  1OC3 A;  5D9T A;  4ECC A;  1YJ6 A;  2AB6 A;  2H71 A;  4GLT A;  4AJ6 A;  4RUV A;  2H0H A;  4OCF A;  1XZO A;  1JZD A;  2EFE A;  4OCE A;  2HZE B;  3FW2 A;  1GTI A;  3FEU A;  2VAF A;  1W89 A;  3ERF A;  2HRN A;  2CQ9 A;  2WB9 A;  2JZR A;  4HI7 A;  1FO5 A;  2I9H A;  1ERV A;  4X1U A;  4HEA 2;  4E8H A;  4F0C A;  1ERU A;  1AC1 A;  2LNT A;  3Q19 A;  1QXH A;  5ECS A;  2X64 A;  5ID2 A;  1J08 A;  4HS1 A;  3TOU A;  5DAL A;  1B8X A;  3FZ4 A;  4ZBA A;  5H5R A;  20GS A;  2I81 A;  4FH8 A;  4FYB A;  2GZP A;  4XS6 A;  1EOH A;  1K0N A;  3GNJ A;  2OA7 A;  3WD6 A;  5JCW A;  2HSN A;  2VCQ A;  2HSM A;  4GSS A;  2YZH A;  5H5S A;  2TRC P;  5DQS A;  3G9B A;  4ISD A;  3G7Y A;  3CXG A;  4ZB8 A;  2EC4 A;  2FCH A;  3FR6 A;  3G7I A;  1Q4J A;  2R6K A;  2HI7 A;  5JCG A;  3IR4 A;  1O6J A;  4F2I A;  1O81 A;  3FRC A;  3TJB A;  1GUL A;  2OAD A;  2WS2 A;  5EY6 A;  4OO4 A;  3PH9 A;  3ZFB A;  2I4A A;  4WBR D;  4LL1 B;  4PNF A;  1GTA A;  4KSM A;  5IOW A;  1NM3 A;  3HJO A;  5EPF A;  4TXO A;  1XIY A;  2BMX A;  3APQ A;  2R37 A;  2RUE A;  1K0O A;  4Z2T A;  5J41 A;  2HZE A;  17GS A;  3IXR A;  5B8A A;  3VFI A;  5CAX A;  1G6Y A;  2JSY A;  5AIV A;  4YKG A;  2DJK A;  2JAC A;  5J3R A;  4KSO A;  1BQ7 A;  3ME7 A;  4NPB A;  1J0F A;  1THO A;  5DAK A;  5KOX A;  2OBK A;  1TK8 B;  2VIM A;  3EE2 A;  5JWR B;  3KJY A;  1H4O A;  5F07 A;  2YWM A;  1FW1 A;  1X5E A;  2DLX A;  1U87 A;  1YKC A;  1XWB A;  3TKR A;  3QOU A;  2R3X A;  2L5O A;  2PWJ A;  1N2A A;  2GLR A;  2A2R A;  4MF7 A;  3ZL5 A;  2C0G A;  4NWY A;  1T4Z A;  2GGT A;  1TOF A;  2H1B A;  4TR0 A;  1SD8 A;  2VCW A;  3PPU A;  2C3N A;  2ES7 A;  2K8S A;  1SK2 A;  4NV5 A;  4WF4 A;  4I2T A;  1C72 A;  3TJF A;  4BL7 A;  2P0G A;  1ON4 A;  4K6X A;  4IBP A;  5G5E A;  1GSD A;  2X99 A;  2HQT A;  2IL3 A;  1N8J A;  1YF1 A;  3DVW A;  3KZQ A;  1DE1 A;  4YAV A;  2G0F A;  4G0I A;  3IRA A;  1GLP A;  4MF5 A;  3HA9 A;  3GN3 A;  3US3 A;  1Y6E A;  2HE3 A;  4Z2U A;  2F51 A;  1XW6 A;  2HRK B;  2YWO A;  1GSF A;  4TR1 B;  3GHA A;  4Q5Q A;  4CHS A;  2PPT A;  1XWG A;  14GS A;  4V1A p;  1URM A;  1TK5 B;  1BG1 A;  2CZ2 A;  1YDK A;  4MK3 A;  2GDR A;  2H1L A;  1M9A A;  18GS A;  4O5Q A;  3HVX A;  2KHP A;  2GT5 A;  5C04 A;  5DJL A;  1XOB A;  5DBQ A;  3EU3 A;  3L78 A;  3V1W A;  5KN3 A;  2MZC A;  3O3T A;  2I3Y A;  1T4Y A;  3FK8 A;  2DKI A;  5IM9 A;  3TKP A;  4MZC A;  4GCI A;  1GH2 A;  1QMV A;  1R7H A;  4K0N A;  1KTE A;  3HVV A;  3H93 A;  1GLQ A;  1S3D A;  4KB3 A;  1PX7 A;  3HY2 A;  1HNB A;  2CX4 A;  5DVB A;  4G9H A;  5BMU B;  3IK7 A;  2H6X A;  3TRQ A;  3GSS A;  2VLV A;  4DSQ A;  5D9X A;  1A23 A;  2RUF A;  3UVT A;  3C1R A;  3GKK A;  4ZXG A;  3D4M A;  4GF0 A;  3SWL A;  3DVX A;  4O7H A;  4J2F A;  2LTK A;  1GL8 A;  4EXJ A;  4CW9 A;  4KX4 A;  1DE2 A;  1QK8 A;  3EC3 A;  2L57 A;  2LUS A;  5D8I A;  4KDX A;  5ECQ B;  1X5C A;  2WFC A;  5FHI A;  3LGC A;  2ON5 A;  1THX A;  1E6B A;  4XS1 A;  3HMJ G;  3A2V A;  4KUN A;  3VPQ A;  3M0F A;  4DSS B;  4J57 E;  1AQW A;  1VF4 A;  4OWY A;  1GUM A;  4USS A;  4GWR A;  4MH3 A;  5G5F A;  4XTS A;  4V2N A;  2PBJ A;  2DKH A;  5ECL B;  1YQ1 A;  2N5F A;  1XWK A;  1Z5Y E;  3CTF A;  3LXZ A;  1ZCP A;  4EL1 A;  3GUS A;  3DML A;  5HR2 A;  4KDU A;  5LCZ A;  2LKU A;  3QD9 A;  1BX9 A;  3GUR A;  3TKS C;  5EL8 A;  5EVO A;  5L71 A;  4LMW A;  4GTU A;  5CRD A;  4POK A;  5ECI B;  3CTG A;  1TXU A;  3UVH A;  4I6X A;  3VLN A;  4DEJ A;  4Q5F A;  4MF6 A;  1V57 A;  1M2D A;  4PQH A;  3FR3 A;  7GSS A;  2HT9 A;  4PTS A;  1JZO A;  1YEP A;  4XS4 A;  3LWA A;  1DSB A;  3GRX A;  3F4S A;  1WWJ A;  3UAP A;  4ECI A;  4BVY B;  3F9U A;  1AW9 A;  2FY6 A;  1BJX A;  3PIN A;  5A4U A;  1GTB A;  2HSH A;  3HXS A;  3EPT A;  2MMA A;  5IQY A;  1JLW A;  1SEN A;  1B4P A;  3RDW A;  4BPY A;  3ZZX A;  5FWG A;  1O7U A;  1OVN A;  5INY A;  1R26 A;  1QFN A;  1F37 A;  4A5P A;  3KEB A;  3APS A;  4EDZ A;  1LBK A;  4EDY A;  3LG6 A;  3WYW A;  3D4T A;  11GS A;  3CBU A;  2VM2 A;  2MBS A;  1TU7 A;  3HCZ A;  2WCI A;  2A4V A;  3FR9 A;  5AGY A;  1HQO A;  3D5J A;  3EWL A;  3FYG A;  8GSS A;  2AAW A;  5DCH A;  4X0X A;  1Z7P A;  2OT3 A;  3KTL A;  1VF2 A;  1NHY A;  4XCS A;  2QGV A;  6GSW A;  3L0H A;  1TRU A;  3J7Y b;  2HYX A;  4ULX A;  3PR8 A;  2FWH A;  2PER A;  3I6A A;  5J40 A;  2GZZ A;  6GSS A;  3KP8 A;  4GQF A;  3VWV A;  9GSS A;  12GS A;  1FB0 A;  3EU4 A;  2K6V A;  1SVO A;  1O73 A;  2YNX A;  3BBY A;  3EIN A;  2R2J A;  2REM A;  1FOV A;  2VKZ G;  2L4C A;  2M72 A;  3KMO A;  4KW6 A;  2XBI A;  4PGT A;  1GSE A;  4PUA A;  2YJH A;  1F2E A;  1HD2 A;  2JAD A;  2PUK C;  3APO A;  1PN0 A;  4Z2R A;  5HQP A;  5ID2 B;  3LXT A;  5DAL B;  3IHG A;  5ELA A;  1Z7R A;  1MDK A;  1PN9 A;  2EFC A;  2X4A A;  5DJM A;  1ZOF A;  2P5R A;  3F3Q A;  3GFK A;  3RHC A;  5KN2 A;  2H0G A;  2HSN B;  2HSM B;  3HKR A;  3RAZ A;  4IGJ A;  4F82 A;  4KCE A;  5G1K A;  3ZRD A;  4MAB A;  1SJ6 A;  5D73 A;  1YEX A;  4MLY A;  3TKS E;  3FMW A;  2H73 A;  1ILO A;  3KMN A;  4NHW A;  1R4W A;  1UVZ A;  1X9M B;  2H6Z A;  1GNW A;  2DIY A;  1W4V A;  2R0C A;  22GS A;  2GS3 A;  2WJU A;  4HQZ A;  4OO5 A;  4P3Y B;  5ECO B;  4Q5R A;  1O8X A;  4MH2 A;  4OFT A;  1PA3 A;  3GYK A;  4HJ2 A;  1TKD B;  4N30 A;  1ZYN A;  4GXZ A;  2VO4 A;  1SYR A;  3FZ9 A;  5F0G A;  4TXO B;  5G1L A;  2O5V A;  2QC7 A;  5KN0 A;  5BRT A;  3GST A;  1AIU A;  1JLV A;  5ECR B;  2C1Y A;  2I1U A;  2ALB A;  4HDE A;  5J9C A;  4EUY A;  4RI6 A;  4JU5 A;  1VF3 A;  2O7K A;  3HZ4 A;  4MDC A;  3E9J B;  2GSS A;  3GL5 A;  1U88 A;  4G01 A;  3I69 A;  2VLU A;  1GP1 A;  1EZK A;  5C00 A;  3IAS 2;  5DAK B;  1XBS A;  2YN1 A;  4YQU A;  1AXD A;  3LYP A;  4XRD A;  3TKQ A;  3D0Z A;  3KM6 A;  1U6T A;  2CZ3 A;  3MYD A;  1F3A A;  3KP9 A;  3VPT A;  1Y1U A;  4I5Q A;  3G7J A;  5ECH B;  4HUA A;  2H76 A;  4TVE A;  1BYE A;  2E0Q A;  4DSR A;  1ZYQ B;  5HR1 A;  3UBK A;  1TDI A;  3IAM 2;  1JFU A;  3DEX A;  5CP1 A;  4ZL7 A;  4K7I A;  1SL0 B;  1PKZ A;  3ZFL A;  4LMV A;  4LL4 B;  3F8U A;  3ZYW A;  2E7P A;  5IOX A;  4BL7 B;  2N5A A;  2D2Z A;  3GH9 A;  3TDG A;  5IO2 A;  4NV2 A;  2GSQ A;  3N9J A;  2HNL A;  1OE8 A;  4MPG A;  3DWV A;  3TRX A;  2FWE A;  5KOW A;  4KGI A;  2R4V A;  3QPM A;  3F3R A;  4HU9 A;  2A2P A;  2B6M A;  4L0W A;  1EP7 A;  1MEK A;  1SJZ A;  3D21 A;  3I43 A;  1PMT A;  2HFD A;  1Z9H A;  4EIP A;  4YQM A;  3H8Q A;  2YJ7 A;  3TCO A;  1M0U A;  4CY8 A;  3H1N A;  1T8E B;  2H30 A;  2WGR A;  2VLT A;  1GSS A;  2R0P A;  1PL1 A;  3A3T A;  2IJY A;  2M46 A;  1K0A A;  1HYU A;  2YWI A;  1ZYP A;  1G7E A;  13GS A;  4MJB A;  1OC9 A;  2AV4 A;  3K8N A;  4QL7 A;  5G2Z A;  1SJI A;  1M9B A;  2F8A A;  4MA9 A;  4N11 A;  5HR3 A;  2YZU A;  2LST A;  1M2A A;  3GH6 A;  3SBC A;  2CVD A;  5D93 A;  2MYG A;  4AKI A;  2CVB A;  1A0F A;  2L4Q A;  4XIH A;  5B6N A;  3RPN A;  3VWX A;  3C7M A;  4KE3 A;  2FGX A;  4I8B A;  4Z7X A;  4TN8 A;  4CY6 A;  2PMT A;  4KAE A;  3C8E A;  3IC8 A;  1TXX A;  5HFG A;  4LA1 A;  4KF9 A;  4JE1 A;  2EFH A;  4BWQ A;  2PGT A;  2TIR A;  1VRS D;  5A34 A;  4AF2 A;  1SKS B;  2VD1 A;  4IKH A;  3EMP A;  4I2U A;  5B7C A;  4OMV A;  2B5E A;  2FA8 A;  4N0V A;  3GTU A;  2LJA A;  4G0L A;  1QQ2 A;  4POM A;  3ZVJ D;  2P31 A;  1YVL A;  1V9W A;  4ZB9 A;  1O8W A;  3Q18 A;  4KCA A;  2YAN A;  1I9D A;  1N25 A;  2H72 A;  5HR0 A;  3KH9 A;  2B1L A;  2H1A A;  5IMD A;  1USB A;  2OBI A;  2ZCT A;  2F3M A;  5DQY A;  5GAP D;  3WT1 A;  1K3O A;  1Y25 A;  1TK0 B;  2FHE A;  5A5K A;  3EMX A;  5J4V A;  2O87 A;  4NMU A;  4GRF A;  2X8C A;  2WZ9 A;  5HFK A;  3TB2 A;  2VCZ A;  1EOG A;  1AAZ A;  1R5A A;  1M7T A;  3A5I A;  1X5D A;  3ZTL A;  3MWH A;  2LS5 A;  1EGR A;  3TKS A;  2XPE A;  3PGT A;  3HZ8 A;  3TRP A;  2H0I A;  4XS4 B;  3UOM A;  3DRN A;  3HJM A;  3KIJ A;  1JHB A;  1ST9 A;  1XPV A;  3HJP A;  1PX6 A;  3BOA A;  3DGQ A;  2B7K A;  1A2M A;  2H19 A;  3FKF A;  2YV7 A;  4JED A;  2XHF A;  2O89 A;  1TTZ A;  1MDI A;  4MJA A;  1SVL A;  4J56 E;  2IN3 A;  4RQR A;  5IIZ A;  3LFL A;  3F6D A;  3QFB C;  4WF5 A;  4K0G A;  2EFD A;  2V6O A;  5IPG A;  2A2S A;  2HRF A;  2PVO C;  3RHB A;  4AJ8 A;  2GSR A;  2K18 A;  5ECM B;  2HSY A;  1A24 A;  1SL2 B;  5J9B A;  2C4J A;  3O76 A;  2G2Q A;  2XC2 A;  3UBL A;  1G0T A;  2V32 A;  2C8U A;  5IMZ A;  5B8B A;  3MNG A;  4ZIJ A;  1GSU A;  4ID0 A;  2OE1 A;  3M9J A;  3I9V 2;  2HXK A;  4RQX A;  2FNO A;  3LJR A;  3S9F A;  3J7Y k;  1E2Y A;  1NHO A;  4F9Z A;  2KUC A;  4JR6 A;  4D73 B;  5HFI A;  2FA4 A;  1GSY A;  4JR4 A;  4GSN A;  3GA4 A;  4E68 A;  1QUW A;  2H6Y A;  3UJ1 A;  1LU4 A;  1XWC A;  2MMN A;  2V1M A;  2GTU A;  2K8V A;  3HYP A;  1K0B A;  3TUE A;  10GS A;  2LQQ A;  2LRN A;  3UIW A;  2X8H A;  2E2G A;  1X0R A;  4LLR A;  1ERW A;  1A8Y A;  1WOU A;  2LQO A;  4ZB7 A;  3L9S A;  1B4Q A;  5CNW A;  2FLS A;  5H5Q A;  2IMK A;  5DCG A;  2RLI A;  1H75 A;  1V58 A;  4OFN A;  2DJ1 A;  2IFQ A;  2LNS A;  1EEM A;  4FQU A;  3QR6 A;  3WGX A;  2VM1 A;  5GAN D;  3M3M A;  1WP0 A;  4WKW A;  2WDU A;  2VOC A;  3QCP A;  3H79 A;  5LD0 A;  1GUK A;  2KOK A;  3R2Q A;  3C1S A;  2V41 A;  5FT3 A;  3CSJ A;  1FOH A;  4YKF A;  1GTU A;  1IYI A;  1B48 A;  1LJR A;  4HOJ A;  5CRH A;  4IW9 A;  3W8J A;  4D73 A;  2HLS A;  5J4Y A;  4MJC A;  2LJR A;  2VCT A;  2ZUP A;  3EUR A;  1T1V A;  2J9H A;  3ZMK A;  4AKH A;  5IO0 A;  2CT6 A;  3A2W A;  1VGL A;  4OFM A;  3CSI A;  1TI1 A;  2F8F A;  4TR3 A;  3E0U A;  5D9V A;  3L4N A;  3TGZ A;  5LNK e;  2VCX A;  3WGE A;  5A5H A;  3GKN A;  1FAA A;  4MP4 A;  3DD3 A;  4N10 A;  1S3A A;  2EIO A;  2YWN A;  5COH A;  4WR5 A;  4ICY A;  3GL3 A;  3QDN A;  1CQG A;  2A4H A;  5KEJ A;  3IE3 A;  4WET A;  3NIV A;  3ED3 A;  2OKA A;  2F9S A;  1GRX A;  2XBQ A;  4EE0 A;  5ELG A;  1SD9 A;  1UA5 A;  1ZMA A;  3W8S A;  4H86 A;  4ML6 A;  2VL2 C;  5J5N A;  1WE0 A;  5IMC A;  1F3B A;  2HZF A;  2DSA A;  4IEL A;  1CQH A;  2OE3 A;  3UMA A;  2H01 A;  3IK9 A;  2IMF A;  1Z3E A;  1WJK A;  3W6G A;  1F9M A;  1XW9 A;  4V2L A;  3F0I A;  4OD7 A;  1A8L A;  4EKZ A;  1BAY A;  1XWA A;  2KP2 A;  4JRR A;  3LSZ A;  1AQX A;  3VK9 A;  4K9Z A;  2GQM A;  2MBT A;  1MD4 A;  2NTO A;  2DMM A;  6GSX A;  1RW1 A;  1MTC A;  4EC0 A;  1NW2 A;  2ON7 A;  4W66 A;  5KN1 A;  4BVX A;  1EV9 A;  1MD3 A;  4Q5N A;  2QSI A;  2QKE A;  4IP1 A;  2BTO T;  5CRE A;  4MNN A;  1A2L A;  1PD2 1;  1ZL9 A;  3DXB A;  4ZBB A;  1B9X C;  3CWG A;  4MCU A;  1XOA A;  5IPH A;  3R3E A;  3CRT A;  5JWO B;  1TP9 A;  5A4W A;  1O85 A;  1OC9 B;  3QAV A;  3C73 A;  1GSQ A;  1X9W B;  1PQN A;  4EO3 A;  5J4U A;  3GX8 A;  4HU7 A;  1TI3 A;  4O32 A;  1IYH A;  5CRG A;  5JWQ B;  4V1A g;  1SK0 A;  4V2M A;  1GUH A;  5J47 A;  3LYK A;  4GST A;  2JZS A;  4AGS A;  2VCV A;  5GST A;  4KA0 A;  1TJD A;  3ZVJ A;  4O92 A;  1GNE A;  4AKX B;  4PUF C;  1FVK A;  4MZB A;  3VI5 A;  4BA7 A;  1M2B A;  2DJJ A;  2L5L A;  2PVQ A;  1HNC A;  3IHQ A;  1WRY A;  2J23 A;  2KLX A;  1BF5 A;  4KDY A;  2AYT A;  1TRW A;  5A34 B;  3WT2 A;  1RQM A;  1FVJ A;  3NZN A;  4PUR A;  1A0R P;  2C0F A;  2R0G A;  3LEF A;  1U3I A;  5JCU A;  3IV4 A;  3IC4 A;  2C0E A;  4MPF A;  3TJJ A;  3F6F A;  2R5G A;  3E3E A;  3HD5 A;  2E2M A;  3GTU B;  2IMD A;  1UC7 A;  3U5R E;  2C3T A;  3ISO A;  1WPI A;  4YH2 A;  2CV4 A;  3P2A A;  2DJ2 A;  1XVQ A;  1NSW A;  4TKY A;  1BED A;  3ZML A;  1T3B A;  4GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...