3VNPA

Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
171
structure length
171
Chain Sequence
GMIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYKALQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (GK2848) from Geobacillus Kaustophilus
rcsb
molecule keywords Hypothetical conserved protein
molecule tags Structural genomics, unknown function
source organism Geobacillus kaustophilus
total genus 69
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3vnpA00
3MC4A 3P1BA 4MYOA 3R8YA 2IC7A 3VBIA 4AC3A 4G3PA 2V0KA 3ECTA 3FSXA 4MZUA 4KNXA 3VBJA 5U2KA 4M98A 1HM9A 2WLGA 5E3QA 1QRMA 2XATA 3FOQA 3R2WA 1KRVA 3R5BA 2WLEA 4K6RA 4N6BA 1MR9A 2JF2A 1QRLA 2WLFA 4G3SA 3FWWA 3R3IA 4N6AA 3SRTA 1MR7A 3F1XA 3HJJA 2WLDA 4HCQA 2ICYA 2VD4A 3BRKX 3I3XA 2OEGA 2JF3A 1KK5A 5E3PA 4E6UA 2V0HA 5ADXV 3P47A 3SPTA 2V0IA 1THJA 3OW5A 3FSBA 5AFUU 2W0VA 3DHOA 4KQLA 4M9CA 1YP3A 3OTMA 3R1WA 3GVDA 3MQHA 5E3RA 2IU8A 4EGGA 2OI5A 1LXAA 3KWCA 3CJ8A 3BSWA 3TK8A 3D8VA 4R37A 2FKOA 2Q4JA 1G97A 3TWDA 3GOSA 4G87A 3DJ4A 4M2AA 1FWYA 3JQYA 1HM8A 3NZ2A 4M99A 3TV0A 3HSQA 5F42A 5L6VA 2ICXA 1KK4A 3R5AA 4J09A 2VHEA 3V4EA 3IGJA 3R5CA 1KRRA 4HURA 3EEVA 3OU9A 2RIJA 3FS8A 4IHGA 1KGQA 3C8VA 4KPZA 3ST8A 1KRUA 3FTTA 3VBMA 2QKXA 3FSCA 1V67A 1T3DA 1SSMA 5DG3A 4M28A 3IXCA 2AQ9A 4AA7A 1QRFA 2NPOA 2OEFA 3KWDA 1S80A 1KGTA 5L6SA 4EA7A 4N27A 3BXYA 4EAAA 1XATA 3EG4A 1TDTA 4HUSA 4HZDA 4E75A 4ISXA 5DEMA 5DEPA 2WLCA 1SSQA 3VBNA 4FCEA 1YP4A 3BFPA 3Q1XA 2I5KA 3PMOA 3R3RA 1MRLA 3R5DA 4KPXA 2QIVX 1G95A 2OI7A 4AAWA 1SSTA 3MQGA 1QRGA 2V0LA 3TISA 1YP2A 4J18A 1QQ0A 2GGQA 3I3AA 4R36A 3VBLA 1XHDA 4R7PA 4H7OA 5ADXU 4N69A 2IU9A 4E1KA 4E79A 1V3WA 2TDTA 4EABA 4HZCA 2GGOA 4MFGA 3VNPA 4EQYA 4DCLA 4IHHA 1KQAA 3T57A 2W0WA 3OUPA 3GUEA 4G3QA 3TDTA 3VBKA 4EA9A 3OTZA 1KK6A 4IHFA 3KWEA 3TIOA 1HM0A 2IUAA 4KNRA 1J2ZA 1Z90A 1OCXA 4E6TA 1FXJA 1QREA 3R0SA 3BSYA 4M2BA 1KHRA 3VBPA 3DK5A 2V0JA 3BSSA 4EA8A 2OI6A 2QIAA 2P2OA 1HV9A 3FSYA 5AFUV 3EH0A 3D98A
chains in the Genus database with same CATH superfamily
1M8NA 1N4IA 3MC4A 3P1BA 4MYOA 3R8YA 2IC7A 3VBIA 4AC3A 4G3PA 2V0KA 3ECTA 3FSXA 4MZUA 4KNXA 3VBJA 5U2KA 4M98A 1HM9A 2WLGA 5E3QA 1QRMA 2XATA 3FOQA 3R2WA 1KRVA 3R5BA 2WLEA 4K6RA 4N6BA 3OH2A 1MR9A 2JF2A 1QRLA 2WLFA 4G3SA 3FWWA 3R3IA 4N6AA 3SRTA 1MR7A 3F1XA 3HJJA 2WLDA 4HCQA 2ICYA 2VD4A 3BRKX 3I3XA 2OEGA 2JF3A 1KK5A 3OH3A 5E3PA 4E6UA 2V0HA 5ADXV 3P47A 3SPTA 2V0IA 1THJA 3OW5A 5AFUV 3FSBA 5AFUU 2W0VA 3DHOA 4KQLA 3OGZA 4M9CA 1YP3A 3OTMA 3R1WA 3GVDA 3MQHA 5E3RA 2IU8A 4EGGA 2OI5A 1LXAA 3KWCA 3CJ8A 3BSWA 3TK8A 3D8VA 4R37A 2FKOA 2Q4JA 1G97A 3TWDA 3GOSA 3OH4A 3DJ4A 4G87A 4M2AA 1FWYA 3JQYA 1HM8A 3NZ2A 4M99A 3TV0A 3GQ7A 3HSQA 5F42A 5L6VA 2ICXA 1KK4A 3R5AA 4J09A 2VHEA 3V4EA 3IGJA 3R5CA 1KRRA 4HURA 3EEVA 3OU9A 2RIJA 3FS8A 4IHGA 1KGQA 3C8VA 4KPZA 3ST8A 1KRUA 3FTTA 3VBMA 2QKXA 3FSCA 1V67A 1T3DA 1SSMA 5DG3A 4M28A 3IXCA 2AQ9A 4AA7A 1QRFA 2NPOA 2OEFA 3KWDA 1S80A 1KGTA 5L6SA 4EA7A 4N27A 3BXYA 4EAAA 1XATA 3EG4A 1TDTA 4HUSA 4HZDA 4E75A 4ISXA 5DEMA 5DEPA 2WLCA 1SSQA 3VBNA 3SUCA 4FCEA 1YP4A 3BFPA 3Q1XA 2I5KA 3PMOA 3R3RA 1MRLA 3R5DA 4KPXA 2QIVX 1G95A 1Z2FA 2OI7A 3GQ8A 4AAWA 1SSTA 3MQGA 1QRGA 2V0LA 3GQ9A 3TISA 1YP2A 4J18A 1QQ0A 2GGQA 3I3AA 4R36A 3VBLA 1XHDA 4R7PA 4H7OA 5ADXU 4N69A 2IU9A 4E1KA 4E79A 1V3WA 2TDTA 4EABA 4HZCA 2GGOA 4MFGA 3VNPA 4EQYA 4DCLA 4IHHA 1KQAA 3T57A 1L0SA 2W0WA 3GUEA 3OUPA 4G3QA 3TDTA 3VBKA 3OTZA 1KK6A 4EA9A 4IHFA 3KWEA 3TIOA 1HM0A 2IUAA 4KNRA 1J2ZA 1Z90A 1OCXA 4E6TA 1FXJA 1QREA 3R0SA 3BSYA 4M2BA 1KHRA 3VBPA 3DK5A 2V0JA 3BSSA 4EA8A 2OI6A 2QIAA 3GQAA 2P2OA 1HV9A 1EWWA 3FSYA 3OH1A 3OH0A 3EH0A 3D98A
chains in the Genus database with same CATH topology
3MC4A 3P1BA 4MYOA 3R8YA 2IC7A 3VBIA 4AC3A 4G3PA 2V0KA 3ECTA 3FSXA 4MZUA 4KNXA 3VBJA 5U2KA 4M98A 1HM9A 2WLGA 5E3QA 1QRMA 2XATA 3FOQA 3R2WA 1KRVA 3R5BA 2WLEA 4K6RA 4N6BA 1MR9A 2JF2A 1QRLA 2WLFA 4G3SA 3FWWA 3R3IA 4N6AA 3SRTA 1MR7A 3F1XA 3HJJA 2WLDA 4HCQA 2ICYA 2VD4A 3BRKX 3I3XA 2OEGA 2JF3A 1KK5A 5E3PA 4E6UA 2V0HA 5ADXV 3P47A 3SPTA 2V0IA 1THJA 3OW5A 3FSBA 5AFUU 2W0VA 3DHOA 4KQLA 4M9CA 1YP3A 3OTMA 3R1WA 3GVDA 3MQHA 5E3RA 2IU8A 4EGGA 2OI5A 1LXAA 3KWCA 3CJ8A 3BSWA 3TK8A 3D8VA 4R37A 2FKOA 2Q4JA 1G97A 3TWDA 3GOSA 4G87A 3DJ4A 4M2AA 1FWYA 3JQYA 1HM8A 3NZ2A 4M99A 3TV0A 3HSQA 5F42A 5L6VA 2ICXA 1KK4A 3R5AA 4J09A 2VHEA 3V4EA 3IGJA 3R5CA 1KRRA 4HURA 3EEVA 3OU9A 2RIJA 3FS8A 4IHGA 1KGQA 3C8VA 4KPZA 3ST8A 1KRUA 3FTTA 3VBMA 2QKXA 3FSCA 1V67A 1T3DA 1SSMA 5DG3A 4M28A 3IXCA 2AQ9A 4AA7A 1QRFA 2NPOA 2OEFA 3KWDA 1S80A 1KGTA 5L6SA 4EA7A 4N27A 3BXYA 4EAAA 1XATA 3EG4A 1TDTA 4HUSA 4HZDA 4E75A 4ISXA 5DEMA 5DEPA 2WLCA 1SSQA 3VBNA 4FCEA 1YP4A 3BFPA 3Q1XA 2I5KA 3PMOA 3R3RA 1MRLA 3R5DA 4KPXA 2QIVX 1G95A 2OI7A 4AAWA 1SSTA 3MQGA 1QRGA 2V0LA 3TISA 1YP2A 4J18A 1QQ0A 2GGQA 3I3AA 4R36A 3VBLA 1XHDA 4R7PA 4H7OA 5ADXU 4N69A 2IU9A 4E1KA 4E79A 1V3WA 2TDTA 4EABA 4HZCA 2GGOA 4MFGA 3VNPA 4EQYA 4DCLA 4IHHA 1KQAA 3T57A 2W0WA 3OUPA 3GUEA 4G3QA 3TDTA 3VBKA 4EA9A 3OTZA 1KK6A 4IHFA 3KWEA 3TIOA 1HM0A 2IUAA 4KNRA 1J2ZA 1Z90A 1OCXA 4E6TA 1FXJA 1QREA 3R0SA 3BSYA 4M2BA 1KHRA 3VBPA 3DK5A 2V0JA 3BSSA 4EA8A 2OI6A 2QIAA 2P2OA 1HV9A 3FSYA 5AFUV 3EH0A 3D98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC4 A;  3P1B A;  4MYO A;  3R8Y A;  2IC7 A;  3VBI A;  4AC3 A;  4G3P A;  2V0K A;  3ECT A;  3FSX A;  4MZU A;  4KNX A;  3VBJ A;  5U2K A;  4M98 A;  1HM9 A;  2WLG A;  5E3Q A;  1QRM A;  2XAT A;  3FOQ A;  3R2W A;  1KRV A;  3R5B A;  2WLE A;  4K6R A;  4N6B A;  1MR9 A;  2JF2 A;  1QRL A;  2WLF A;  4G3S A;  3FWW A;  3R3I A;  4N6A A;  3SRT A;  1MR7 A;  3F1X A;  3HJJ A;  2WLD A;  4HCQ A;  2ICY A;  2VD4 A;  3BRK X;  3I3X A;  2OEG A;  2JF3 A;  1KK5 A;  5E3P A;  4E6U A;  2V0H A;  5ADX V;  3P47 A;  3SPT A;  2V0I A;  1THJ A;  3OW5 A;  3FSB A;  5AFU U;  2W0V A;  3DHO A;  4KQL A;  4M9C A;  1YP3 A;  3OTM A;  3R1W A;  3GVD A;  3MQH A;  5E3R A;  2IU8 A;  4EGG A;  2OI5 A;  1LXA A;  3KWC A;  3CJ8 A;  3BSW A;  3TK8 A;  3D8V A;  4R37 A;  2FKO A;  2Q4J A;  1G97 A;  3TWD A;  3GOS A;  4G87 A;  3DJ4 A;  4M2A A;  1FWY A;  3JQY A;  1HM8 A;  3NZ2 A;  4M99 A;  3TV0 A;  3HSQ A;  5F42 A;  5L6V A;  2ICX A;  1KK4 A;  3R5A A;  4J09 A;  2VHE A;  3V4E A;  3IGJ A;  3R5C A;  1KRR A;  4HUR A;  3EEV A;  3OU9 A;  2RIJ A;  3FS8 A;  4IHG A;  1KGQ A;  3C8V A;  4KPZ A;  3ST8 A;  1KRU A;  3FTT A;  3VBM A;  2QKX A;  3FSC A;  1V67 A;  1T3D A;  1SSM A;  5DG3 A;  4M28 A;  3IXC A;  2AQ9 A;  4AA7 A;  1QRF A;  2NPO A;  2OEF A;  3KWD A;  1S80 A;  1KGT A;  5L6S A;  4EA7 A;  4N27 A;  3BXY A;  4EAA A;  1XAT A;  3EG4 A;  1TDT A;  4HUS A;  4HZD A;  4E75 A;  4ISX A;  5DEM A;  5DEP A;  2WLC A;  1SSQ A;  3VBN A;  4FCE A;  1YP4 A;  3BFP A;  3Q1X A;  2I5K A;  3PMO A;  3R3R A;  1MRL A;  3R5D A;  4KPX A;  2QIV X;  1G95 A;  2OI7 A;  4AAW A;  1SST A;  3MQG A;  1QRG A;  2V0L A;  3TIS A;  1YP2 A;  4J18 A;  1QQ0 A;  2GGQ A;  3I3A A;  4R36 A;  3VBL A;  1XHD A;  4R7P A;  4H7O A;  5ADX U;  4N69 A;  2IU9 A;  4E1K A;  4E79 A;  1V3W A;  2TDT A;  4EAB A;  4HZC A;  2GGO A;  4MFG A;  3VNP A;  4EQY A;  4DCL A;  4IHH A;  1KQA A;  3T57 A;  2W0W A;  3OUP A;  3GUE A;  4G3Q A;  3TDT A;  3VBK A;  4EA9 A;  3OTZ A;  1KK6 A;  4IHF A;  3KWE A;  3TIO A;  1HM0 A;  2IUA A;  4KNR A;  1J2Z A;  1Z90 A;  1OCX A;  4E6T A;  1FXJ A;  1QRE A;  3R0S A;  3BSY A;  4M2B A;  1KHR A;  3VBP A;  3DK5 A;  2V0J A;  3BSS A;  4EA8 A;  2OI6 A;  2QIA A;  2P2O A;  1HV9 A;  3FSY A;  5AFU V;  3EH0 A;  3D98 A; 
#chains in the Genus database with same CATH topology
 1M8N A;  1N4I A;  3MC4 A;  3P1B A;  4MYO A;  3R8Y A;  2IC7 A;  3VBI A;  4AC3 A;  4G3P A;  2V0K A;  3ECT A;  3FSX A;  4MZU A;  4KNX A;  3VBJ A;  5U2K A;  4M98 A;  1HM9 A;  2WLG A;  5E3Q A;  1QRM A;  2XAT A;  3FOQ A;  3R2W A;  1KRV A;  3R5B A;  2WLE A;  4K6R A;  4N6B A;  3OH2 A;  1MR9 A;  2JF2 A;  1QRL A;  2WLF A;  4G3S A;  3FWW A;  3R3I A;  4N6A A;  3SRT A;  1MR7 A;  3F1X A;  3HJJ A;  2WLD A;  4HCQ A;  2ICY A;  2VD4 A;  3BRK X;  3I3X A;  2OEG A;  2JF3 A;  1KK5 A;  3OH3 A;  5E3P A;  4E6U A;  2V0H A;  5ADX V;  3P47 A;  3SPT A;  2V0I A;  1THJ A;  3OW5 A;  5AFU V;  3FSB A;  5AFU U;  2W0V A;  3DHO A;  4KQL A;  3OGZ A;  4M9C A;  1YP3 A;  3OTM A;  3R1W A;  3GVD A;  3MQH A;  5E3R A;  2IU8 A;  4EGG A;  2OI5 A;  1LXA A;  3KWC A;  3CJ8 A;  3BSW A;  3TK8 A;  3D8V A;  4R37 A;  2FKO A;  2Q4J A;  1G97 A;  3TWD A;  3GOS A;  3OH4 A;  3DJ4 A;  4G87 A;  4M2A A;  1FWY A;  3JQY A;  1HM8 A;  3NZ2 A;  4M99 A;  3TV0 A;  3GQ7 A;  3HSQ A;  5F42 A;  5L6V A;  2ICX A;  1KK4 A;  3R5A A;  4J09 A;  2VHE A;  3V4E A;  3IGJ A;  3R5C A;  1KRR A;  4HUR A;  3EEV A;  3OU9 A;  2RIJ A;  3FS8 A;  4IHG A;  1KGQ A;  3C8V A;  4KPZ A;  3ST8 A;  1KRU A;  3FTT A;  3VBM A;  2QKX A;  3FSC A;  1V67 A;  1T3D A;  1SSM A;  5DG3 A;  4M28 A;  3IXC A;  2AQ9 A;  4AA7 A;  1QRF A;  2NPO A;  2OEF A;  3KWD A;  1S80 A;  1KGT A;  5L6S A;  4EA7 A;  4N27 A;  3BXY A;  4EAA A;  1XAT A;  3EG4 A;  1TDT A;  4HUS A;  4HZD A;  4E75 A;  4ISX A;  5DEM A;  5DEP A;  2WLC A;  1SSQ A;  3VBN A;  3SUC A;  4FCE A;  1YP4 A;  3BFP A;  3Q1X A;  2I5K A;  3PMO A;  3R3R A;  1MRL A;  3R5D A;  4KPX A;  2QIV X;  1G95 A;  1Z2F A;  2OI7 A;  3GQ8 A;  4AAW A;  1SST A;  3MQG A;  1QRG A;  2V0L A;  3GQ9 A;  3TIS A;  1YP2 A;  4J18 A;  1QQ0 A;  2GGQ A;  3I3A A;  4R36 A;  3VBL A;  1XHD A;  4R7P A;  4H7O A;  5ADX U;  4N69 A;  2IU9 A;  4E1K A;  4E79 A;  1V3W A;  2TDT A;  4EAB A;  4HZC A;  2GGO A;  4MFG A;  3VNP A;  4EQY A;  4DCL A;  4IHH A;  1KQA A;  3T57 A;  1L0S A;  2W0W A;  3GUE A;  3OUP A;  4G3Q A;  3TDT A;  3VBK A;  3OTZ A;  1KK6 A;  4EA9 A;  4IHF A;  3KWE A;  3TIO A;  1HM0 A;  2IUA A;  4KNR A;  1J2Z A;  1Z90 A;  1OCX A;  4E6T A;  1FXJ A;  1QRE A;  3R0S A;  3BSY A;  4M2B A;  1KHR A;  3VBP A;  3DK5 A;  2V0J A;  3BSS A;  4EA8 A;  2OI6 A;  2QIA A;  3GQA A;  2P2O A;  1HV9 A;  1EWW A;  3FSY A;  3OH1 A;  3OH0 A;  3EH0 A;  3D98 A; 
#chains in the Genus database with same CATH homology
 3MC4 A;  3P1B A;  4MYO A;  3R8Y A;  2IC7 A;  3VBI A;  4AC3 A;  4G3P A;  2V0K A;  3ECT A;  3FSX A;  4MZU A;  4KNX A;  3VBJ A;  5U2K A;  4M98 A;  1HM9 A;  2WLG A;  5E3Q A;  1QRM A;  2XAT A;  3FOQ A;  3R2W A;  1KRV A;  3R5B A;  2WLE A;  4K6R A;  4N6B A;  1MR9 A;  2JF2 A;  1QRL A;  2WLF A;  4G3S A;  3FWW A;  3R3I A;  4N6A A;  3SRT A;  1MR7 A;  3F1X A;  3HJJ A;  2WLD A;  4HCQ A;  2ICY A;  2VD4 A;  3BRK X;  3I3X A;  2OEG A;  2JF3 A;  1KK5 A;  5E3P A;  4E6U A;  2V0H A;  5ADX V;  3P47 A;  3SPT A;  2V0I A;  1THJ A;  3OW5 A;  3FSB A;  5AFU U;  2W0V A;  3DHO A;  4KQL A;  4M9C A;  1YP3 A;  3OTM A;  3R1W A;  3GVD A;  3MQH A;  5E3R A;  2IU8 A;  4EGG A;  2OI5 A;  1LXA A;  3KWC A;  3CJ8 A;  3BSW A;  3TK8 A;  3D8V A;  4R37 A;  2FKO A;  2Q4J A;  1G97 A;  3TWD A;  3GOS A;  4G87 A;  3DJ4 A;  4M2A A;  1FWY A;  3JQY A;  1HM8 A;  3NZ2 A;  4M99 A;  3TV0 A;  3HSQ A;  5F42 A;  5L6V A;  2ICX A;  1KK4 A;  3R5A A;  4J09 A;  2VHE A;  3V4E A;  3IGJ A;  3R5C A;  1KRR A;  4HUR A;  3EEV A;  3OU9 A;  2RIJ A;  3FS8 A;  4IHG A;  1KGQ A;  3C8V A;  4KPZ A;  3ST8 A;  1KRU A;  3FTT A;  3VBM A;  2QKX A;  3FSC A;  1V67 A;  1T3D A;  1SSM A;  5DG3 A;  4M28 A;  3IXC A;  2AQ9 A;  4AA7 A;  1QRF A;  2NPO A;  2OEF A;  3KWD A;  1S80 A;  1KGT A;  5L6S A;  4EA7 A;  4N27 A;  3BXY A;  4EAA A;  1XAT A;  3EG4 A;  1TDT A;  4HUS A;  4HZD A;  4E75 A;  4ISX A;  5DEM A;  5DEP A;  2WLC A;  1SSQ A;  3VBN A;  4FCE A;  1YP4 A;  3BFP A;  3Q1X A;  2I5K A;  3PMO A;  3R3R A;  1MRL A;  3R5D A;  4KPX A;  2QIV X;  1G95 A;  2OI7 A;  4AAW A;  1SST A;  3MQG A;  1QRG A;  2V0L A;  3TIS A;  1YP2 A;  4J18 A;  1QQ0 A;  2GGQ A;  3I3A A;  4R36 A;  3VBL A;  1XHD A;  4R7P A;  4H7O A;  5ADX U;  4N69 A;  2IU9 A;  4E1K A;  4E79 A;  1V3W A;  2TDT A;  4EAB A;  4HZC A;  2GGO A;  4MFG A;  3VNP A;  4EQY A;  4DCL A;  4IHH A;  1KQA A;  3T57 A;  2W0W A;  3OUP A;  3GUE A;  4G3Q A;  3TDT A;  3VBK A;  4EA9 A;  3OTZ A;  1KK6 A;  4IHF A;  3KWE A;  3TIO A;  1HM0 A;  2IUA A;  4KNR A;  1J2Z A;  1Z90 A;  1OCX A;  4E6T A;  1FXJ A;  1QRE A;  3R0S A;  3BSY A;  4M2B A;  1KHR A;  3VBP A;  3DK5 A;  2V0J A;  3BSS A;  4EA8 A;  2OI6 A;  2QIA A;  2P2O A;  1HV9 A;  3FSY A;  5AFU V;  3EH0 A;  3D98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...